Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F11528g7.341ON1211216393e-87
TDEL0C020607.341ON88852372e-26
Kwal_YGOB_Anc_7.3417.341ON86822102e-22
NCAS0A140807.341ON78802083e-22
Kpol_530.377.341ON88852042e-21
SAKL0F10956g7.341ON86811981e-20
Ecym_45207.341ON91911972e-20
KLTH0H01452g7.341ON86821944e-20
Suva_4.847.341ON81821936e-20
TPHA0F029107.341ON1081001861e-18
TBLA0E004707.341ON1161111843e-18
CAGL0I03432g7.341ON1491211786e-17
ACL158W7.341ON95831684e-16
YDL160C-A (MHF2)7.341ON80821581e-14
Skud_4.957.341ON79821536e-14
KNAG0C038107.341ON82801529e-14
NDAI0A019507.341ON1221011559e-14
Smik_4.767.341ON80821468e-13
KLLA0C16709g7.341ON79751415e-12
KAFR0B009007.341ON78811283e-10
TPHA0A049105.125ON30981642.0
TBLA0C034005.323ON22150642.1
Kpol_520.214.347ON18443632.4
Skud_4.5665.323ON22578614.9
NCAS0E013603.29ON33233607.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F11528g
         (121 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some si...   250   3e-87
TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}...    96   2e-26
Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON} ...    86   2e-22
NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}               85   3e-22
Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON} c...    83   2e-21
SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON...    81   1e-20
Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar t...    80   2e-20
KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON...    79   4e-20
Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON} Y...    79   6e-20
TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.34...    76   1e-18
TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341 ...    75   3e-18
CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {O...    73   6e-17
ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolo...    69   4e-16
YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}  ...    65   1e-14
Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON} Y...    64   6e-14
KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}...    63   9e-14
NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.34...    64   9e-14
Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON} Y...    61   8e-13
KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conser...    59   5e-12
KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}...    54   3e-10
TPHA0A04910 Chr1 (1106316..1107245) [930 bp, 309 aa] {ON} Anc_5....    29   2.0  
TBLA0C03400 Chr3 complement(818286..818951) [666 bp, 221 aa] {ON...    29   2.1  
Kpol_520.21 s520 (54060..54614) [555 bp, 184 aa] {ON} (54060..54...    29   2.4  
Skud_4.566 Chr4 complement(1014294..1014971) [678 bp, 225 aa] {O...    28   4.9  
NCAS0E01360 Chr5 complement(263103..264101) [999 bp, 332 aa] {ON...    28   7.9  

>ZYRO0F11528g Chr6 (946636..947001) [366 bp, 121 aa] {ON} some
           similarities with uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160C-A Identified by homology to Ashbya
           gossypii
          Length = 121

 Score =  250 bits (639), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 121/121 (100%), Positives = 121/121 (100%)

Query: 1   MEFYFVQWLFGYDVHVTFNQADEQPNLIHKIQNIGHVDMSMVPKETIVRILKLQAFEHES 60
           MEFYFVQWLFGYDVHVTFNQADEQPNLIHKIQNIGHVDMSMVPKETIVRILKLQAFEHES
Sbjct: 1   MEFYFVQWLFGYDVHVTFNQADEQPNLIHKIQNIGHVDMSMVPKETIVRILKLQAFEHES 60

Query: 61  TTITEETVTMLQKYLEVFVREAVQRSVANKDSQGSHGDGDGEIQLNHEDLEKITGMLLLD 120
           TTITEETVTMLQKYLEVFVREAVQRSVANKDSQGSHGDGDGEIQLNHEDLEKITGMLLLD
Sbjct: 61  TTITEETVTMLQKYLEVFVREAVQRSVANKDSQGSHGDGDGEIQLNHEDLEKITGMLLLD 120

Query: 121 M 121
           M
Sbjct: 121 M 121

>TDEL0C02060 Chr3 complement(356665..356931) [267 bp, 88 aa] {ON}
           Anc_7.341 YDL160C-A
          Length = 88

 Score = 95.9 bits (237), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 63/85 (74%), Gaps = 6/85 (7%)

Query: 42  VPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKDS-----QGSH 96
           +PKETI R  ++ AFE+EST IT+ETV M+QKY+EVFVREAV RS ANK+       G+ 
Sbjct: 5   IPKETIARTFQVGAFENESTNITDETVGMMQKYMEVFVREAVLRSSANKEQIKVEHSGAQ 64

Query: 97  GDGDGEIQLNHEDLEKITGMLLLDM 121
            + + EI L HEDLE ITG+LLLDM
Sbjct: 65  RNSN-EIVLTHEDLENITGLLLLDM 88

>Kwal_YGOB_Anc_7.341 s56 (1073424..1073684) [261 bp, 86 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 86

 Score = 85.5 bits (210), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 63/82 (76%), Gaps = 2/82 (2%)

Query: 42  VPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKDS-QGSHGDGD 100
           VPK+TI RI +  +F+++ST ITE T+T++ +YLE+FVREA+ RS+ NKD  +  H D  
Sbjct: 5   VPKDTIARIFQTCSFQNDSTRITETTLTLVDEYLEIFVREAILRSIENKDQVKDEHQDQL 64

Query: 101 G-EIQLNHEDLEKITGMLLLDM 121
           G ++ L H+DLE+++G+LLLDM
Sbjct: 65  GSQVVLTHKDLERVSGLLLLDM 86

>NCAS0A14080 Chr1 (2768035..2768271) [237 bp, 78 aa] {ON}
          Length = 78

 Score = 84.7 bits (208), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 39/80 (48%), Positives = 62/80 (77%), Gaps = 4/80 (5%)

Query: 42  VPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKDSQGSHGDGDG 101
           +PKETI +IL+L+AFE+  T +TEET++M+Q+Y+E+F+REA+ RS+ NK+ +    D   
Sbjct: 3   IPKETIAQILQLEAFENADTKMTEETLSMIQRYMELFIREAMCRSLDNKEKELGQTD--- 59

Query: 102 EIQLNHEDLEKITGMLLLDM 121
            I ++ +DLE++ G+LLLDM
Sbjct: 60  -IVIDEKDLERVVGLLLLDM 78

>Kpol_530.37 s530 complement(86462..86728) [267 bp, 88 aa] {ON}
           complement(86462..86728) [267 nt, 89 aa]
          Length = 88

 Score = 83.2 bits (204), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 43/85 (50%), Positives = 56/85 (65%), Gaps = 1/85 (1%)

Query: 38  DMSMVPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKDSQGSHG 97
           D   +PKETI R+L+  +FEH ST ITE+ V  LQKY+E+FVREA+ RS+  K       
Sbjct: 3   DNGPIPKETIARLLETSSFEHSSTRITEDVVEGLQKYMELFVREAIMRSIETKAKLEEEN 62

Query: 98  DGDG-EIQLNHEDLEKITGMLLLDM 121
              G  ++L H DLE+I G+LLLDM
Sbjct: 63  SFTGVRVELTHTDLEEIAGLLLLDM 87

>SAKL0F10956g Chr6 complement(858747..859007) [261 bp, 86 aa] {ON}
           similar to uniprot|Q3E829 Saccharomyces cerevisiae
           YDL160C-A Putative protein of unknown function
          Length = 86

 Score = 80.9 bits (198), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 57/81 (70%), Gaps = 1/81 (1%)

Query: 42  VPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKDSQGSHGDG-D 100
           +PK+TI RI +  +F  +ST ITE+TV +  KY+E+FVREAV RS+ NK+      +  D
Sbjct: 6   LPKDTIARIFQTCSFTQDSTRITEDTVALTNKYIELFVREAVLRSLENKEKVKPETESLD 65

Query: 101 GEIQLNHEDLEKITGMLLLDM 121
               L+HEDLE+I+G+LLLDM
Sbjct: 66  NGTVLSHEDLEEISGLLLLDM 86

>Ecym_4520 Chr4 (1036442..1036717) [276 bp, 91 aa] {ON} similar to
           Ashbya gossypii ACL158W
          Length = 91

 Score = 80.5 bits (197), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 63/91 (69%), Gaps = 5/91 (5%)

Query: 34  IGHVDMSMVPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKDSQ 93
           + H    +VP +TI RI +L +F  +ST ITE+T+T+ +KY+++FVREAV RS+ NKD +
Sbjct: 1   MNHSQEPVVPSDTIARIFQLCSFTQDSTRITEDTITLTEKYIKLFVREAVLRSLENKD-K 59

Query: 94  GSHGDGDGEI----QLNHEDLEKITGMLLLD 120
               DG G +     L+H DLE+I+G+LLLD
Sbjct: 60  VKKEDGKGSLIEGPVLHHTDLEEISGILLLD 90

>KLTH0H01452g Chr8 complement(134324..134584) [261 bp, 86 aa] {ON}
           weakly similar to uniprot|Q3E829 Saccharomyces
           cerevisiae YDL160c-a
          Length = 86

 Score = 79.3 bits (194), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 39/82 (47%), Positives = 60/82 (73%), Gaps = 2/82 (2%)

Query: 42  VPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKDS-QGSHGDGD 100
           +P +TI RI +  +F+ +ST ITE T++++  YLEVFVREA+ RS+ NK+  +  H D  
Sbjct: 5   IPSDTIARIFQTCSFKDDSTRITESTLSLVDAYLEVFVREALLRSIENKEQVKSEHQDQL 64

Query: 101 GE-IQLNHEDLEKITGMLLLDM 121
           G+ + L H+DLE+++G+LLLDM
Sbjct: 65  GDQVVLTHKDLERVSGLLLLDM 86

>Suva_4.84 Chr4 complement(156977..157219) [243 bp, 81 aa] {ON}
           YDL160C-A (REAL)
          Length = 81

 Score = 79.0 bits (193), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 39/82 (47%), Positives = 61/82 (74%), Gaps = 3/82 (3%)

Query: 41  MVPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSV-ANKDSQGSHGDG 99
           ++PKE I++IL  Q    ++  I ++ + M+QKYLE+F+ EA  RS+ ++KDS G+H DG
Sbjct: 2   ILPKEAIIKILS-QNNSDKNIKIDDKVIPMIQKYLEIFIEEAALRSLQSHKDSSGAH-DG 59

Query: 100 DGEIQLNHEDLEKITGMLLLDM 121
           DG ++L+H DLE+I G+LL+DM
Sbjct: 60  DGPLELSHLDLERIVGLLLMDM 81

>TPHA0F02910 Chr6 (644434..644760) [327 bp, 108 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 108

 Score = 76.3 bits (186), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 65/100 (65%), Gaps = 22/100 (22%)

Query: 42  VPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKDSQGSHGDG-- 99
           +PK+TI RIL+L++F  E T I+ E+V +LQKY+E+FVREAV RS+ N++ + S+ +   
Sbjct: 10  IPKDTIARILQLESF-GEETRISAESVGILQKYMELFVREAVLRSIENREQKQSNIEALK 68

Query: 100 ------------------DGEIQLNHEDLEKITGMLLLDM 121
                             +G I+L HEDLE+I+G+LLLDM
Sbjct: 69  KAPAKANPDQLQTFQHSFNG-IELTHEDLEEISGLLLLDM 107

>TBLA0E00470 Chr5 (86619..86969) [351 bp, 116 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 116

 Score = 75.5 bits (184), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 65/111 (58%), Gaps = 22/111 (19%)

Query: 32  QNIGHVDMSMVPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKD 91
           +N    D+ + P+ TI RIL+  +F  E+T IT+ TVT LQKY+E+F+REA  RS+ NK+
Sbjct: 7   KNTTETDVKL-PENTIARILQTSSFVDENTRITKNTVTKLQKYMELFIREAALRSLENKE 65

Query: 92  SQGSH---------GDGDGE------------IQLNHEDLEKITGMLLLDM 121
            Q S+         G  D +            I+L+HE LE ITG+LLLDM
Sbjct: 66  EQISNEKSAVKNEPGLEDTKIFNDNNKLNDNDIELSHEALEAITGLLLLDM 116

>CAGL0I03432g Chr9 complement(292162..292611) [450 bp, 149 aa] {ON}
           some similarities with KLLA0C16709g Kluyveromyces lactis
           and DEHA0G05016g Debaryomyces hansenii and CA5994|IPF677
           Candida albicans
          Length = 149

 Score = 73.2 bits (178), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 68/121 (56%), Gaps = 2/121 (1%)

Query: 1   MEFYFVQWLFGYDVHVTFNQADEQPNLIHKIQNIGHVDMSMVPKETIVRILKLQAFEHES 60
           +  +   W F +  +  +   D     I K + I  + +  VP++TI R+L++ AF+ + 
Sbjct: 31  LWIFLAGWKFDH-WNCNYWNCDHWKCEIWKCE-IWTIPIMDVPQDTIARVLQVAAFKDKK 88

Query: 61  TTITEETVTMLQKYLEVFVREAVQRSVANKDSQGSHGDGDGEIQLNHEDLEKITGMLLLD 120
           T I  + V  LQ+Y++VF REAV RS+ + D+     + + + ++ H DLE I G+LLLD
Sbjct: 89  TRIESDVVDALQRYIDVFAREAVLRSIEHHDASQEGLEQEQDKEITHTDLENIAGLLLLD 148

Query: 121 M 121
           M
Sbjct: 149 M 149

>ACL158W Chr3 (78852..79139) [288 bp, 95 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL161CX; YDL161CX was
           overlooked in Saccharomyces cerevisiae
          Length = 95

 Score = 69.3 bits (168), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 58/83 (69%), Gaps = 5/83 (6%)

Query: 42  VPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKD--SQGSHGD- 98
           +P +TI R+    +F  +ST ITE+ VT++++Y+++F+REAV RS+ NK+   Q +  D 
Sbjct: 13  IPTDTIARLFHTCSFTQDSTKITEDAVTLVERYMKLFIREAVLRSLENKEKVKQETRADS 72

Query: 99  -GDGEIQLNHEDLEKITGMLLLD 120
             +G + L H DLE+I+G+L+LD
Sbjct: 73  FAEGPV-LQHTDLEEISGVLILD 94

>YDL160C-A Chr4 complement(169366..169608) [243 bp, 80 aa] {ON}
           MHF2Protein of unknown function; ortholog of human MHF2,
           and component of the heterotetrameric MHF histone-fold
           complex that in humans interacts with both DNA and Mph1p
           ortholog FANCM to stabilize and remodel blocked
           replication forks and repair damaged DNA; mhf2 srs2
           double mutants are MMS hypersensitive
          Length = 80

 Score = 65.5 bits (158), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/82 (43%), Positives = 55/82 (67%), Gaps = 3/82 (3%)

Query: 41  MVPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSV-ANKDSQGSHGDG 99
           M+ KE +++IL  Q        I +E V M+QKYL++F+ EAV RS+ ++KD  G  GD 
Sbjct: 1   MLSKEALIKILS-QNEGGNDMKIADEVVPMIQKYLDIFIDEAVLRSLQSHKDINGERGD- 58

Query: 100 DGEIQLNHEDLEKITGMLLLDM 121
              ++L+H+DLE+I G+LL+DM
Sbjct: 59  KSPLELSHQDLERIVGLLLMDM 80

>Skud_4.95 Chr4 complement(164983..165219) [237 bp, 79 aa] {ON}
           YDL160C-A (REAL)
          Length = 79

 Score = 63.5 bits (153), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 54/82 (65%), Gaps = 4/82 (4%)

Query: 41  MVPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSV-ANKDSQGSHGDG 99
           M+ K+ +++IL    F  +   I ++ + M+Q YL++F+ EA  RS+ + KD+ G H DG
Sbjct: 1   MLSKDALIKILSQNNFRKD-IKIDDKVLPMIQNYLDIFIEEAALRSLQSQKDASGGHRDG 59

Query: 100 DGEIQLNHEDLEKITGMLLLDM 121
              ++L+H DLE+I G+LL+DM
Sbjct: 60  --PLELSHLDLERIVGLLLMDM 79

>KNAG0C03810 Chr3 complement(748315..748563) [249 bp, 82 aa] {ON}
           Anc_7.341 YDL160C-A
          Length = 82

 Score = 63.2 bits (152), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 54/80 (67%), Gaps = 7/80 (8%)

Query: 42  VPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKDSQGSHGDGDG 101
           + +ET+ RIL  Q+F+++STTI ++ +T +QKY+E +V+E + RS+ NKD       G  
Sbjct: 9   ISRETLSRILT-QSFKNKSTTIDDQALTSVQKYVETYVQEIILRSLENKDL------GVN 61

Query: 102 EIQLNHEDLEKITGMLLLDM 121
             +L   D+E+I G+LLLDM
Sbjct: 62  PAELTERDIERILGLLLLDM 81

>NDAI0A01950 Chr1 (434811..435179) [369 bp, 122 aa] {ON} Anc_7.341
           YDL160C-A
          Length = 122

 Score = 64.3 bits (155), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 69/101 (68%), Gaps = 10/101 (9%)

Query: 29  HKIQNIGHVDMSMVPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVA 88
           + ++NI   DM+++  ETI +IL+ ++F+++ TTIT+ET+ M+Q+Y+++F++EAV RS  
Sbjct: 24  NALRNI-QADMTILL-ETIEKILRSESFQNKDTTITKETILMIQRYMDLFIKEAVIRSYE 81

Query: 89  NKDS--------QGSHGDGDGEIQLNHEDLEKITGMLLLDM 121
           NK +        +    + D  I+L H DLE+I G+LL+++
Sbjct: 82  NKVATQVEDFDDEEDADEEDKTIELTHLDLERIVGLLLMEL 122

>Smik_4.76 Chr4 complement(146162..146401) [240 bp, 80 aa] {ON}
           YDL160C-A (REAL)
          Length = 80

 Score = 60.8 bits (146), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 55/82 (67%), Gaps = 3/82 (3%)

Query: 41  MVPKETIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSV-ANKDSQGSHGDG 99
           M+ KE +V+IL  Q    +   I++E + M+QKYL++F+ EA  RS+ ++KD    H   
Sbjct: 1   MLSKEALVKILS-QNNCGKDIEISDEVIPMIQKYLDIFIEEAALRSLQSHKDINKEHDKK 59

Query: 100 DGEIQLNHEDLEKITGMLLLDM 121
           D  ++L+H+DLE++ G+LL+DM
Sbjct: 60  DP-LELSHQDLERVVGVLLMDM 80

>KLLA0C16709g Chr3 (1463056..1463295) [240 bp, 79 aa] {ON} conserved
           hypothetical protein
          Length = 79

 Score = 58.9 bits (141), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (62%), Gaps = 6/75 (8%)

Query: 46  TIVRILKLQAFEHESTTITEETVTMLQKYLEVFVREAVQRSVANKDSQGSHGDGDGEIQL 105
           TI RIL+ + F+  +T ITEE + +L+ Y+E+FVRE V RS+ NK       D   +  +
Sbjct: 9   TIARILQTEGFQDSNTRITEECMQLLEPYIELFVREGVLRSLENK------ADMLADKTV 62

Query: 106 NHEDLEKITGMLLLD 120
           +  DLE + G+LL+D
Sbjct: 63  DFVDLEAVAGLLLMD 77

>KAFR0B00900 Chr2 complement(167674..167910) [237 bp, 78 aa] {ON}
           Anc_7.341 YDL160C-A
          Length = 78

 Score = 53.9 bits (128), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (61%), Gaps = 6/81 (7%)

Query: 42  VPKETIVRILKLQAFEH-ESTTITEETVTMLQKYLEVFVREAVQRSVANKDSQGSHGDGD 100
           +PKETI RIL  +  E+ E+ +I  ETV  + KY +V + E V RS+ NK++       +
Sbjct: 3   IPKETISRILLNKLNENGENFSINTETVESVTKYTDVLIEEMVLRSLENKENI-----AE 57

Query: 101 GEIQLNHEDLEKITGMLLLDM 121
               L+ +DLEKI G+LLLDM
Sbjct: 58  ATPTLDVDDLEKIIGLLLLDM 78

>TPHA0A04910 Chr1 (1106316..1107245) [930 bp, 309 aa] {ON} Anc_5.125
           YGR208W
          Length = 309

 Score = 29.3 bits (64), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 40/81 (49%), Gaps = 4/81 (4%)

Query: 13  DVHVTFNQADEQPNLIHKIQNI--GHVDMSMVPKETIVRILKLQAFEHESTTITEETVTM 70
           D +   N +    N+I +I +     +D+S+   +   +  K+  F+ +ST I +E + +
Sbjct: 46  DTYFIINDSKNVKNVISEIIDYYSKEIDISIQKNDENRKFKKMMVFDMDSTLIYQEVIEL 105

Query: 71  LQKYLEV--FVREAVQRSVAN 89
           +  Y +V   VRE   R++ N
Sbjct: 106 IASYADVEDKVREITNRAMNN 126

>TBLA0C03400 Chr3 complement(818286..818951) [666 bp, 221 aa] {ON}
           Anc_5.323 YDR304C
          Length = 221

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 29/50 (58%), Gaps = 4/50 (8%)

Query: 8   WLFGYDVHVTFNQADEQPNLIHKIQNIGHVDMSMVPKETIVRILKLQAFE 57
           WL G   HV F +  E  +++H I+N+   D S  P+ETI +I+K  A +
Sbjct: 160 WLDGR--HVVFGEVLEGMDVVHYIENV-PTDRSDKPRETI-KIVKCGALD 205

>Kpol_520.21 s520 (54060..54614) [555 bp, 184 aa] {ON}
           (54060..54614) [555 nt, 185 aa]
          Length = 184

 Score = 28.9 bits (63), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 4/43 (9%)

Query: 6   VQWLFGYDVHVTFNQADEQPNLIHKIQNIGHVDMSMVPKETIV 48
             WL G   HV F +  +  +++ KI+++G  DMS  PK  IV
Sbjct: 137 CPWLDGK--HVVFGEVTKGMDIVKKIESLG--DMSGAPKAKIV 175

>Skud_4.566 Chr4 complement(1014294..1014971) [678 bp, 225 aa] {ON}
           YDR304C (REAL)
          Length = 225

 Score = 28.1 bits (61), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 6/78 (7%)

Query: 6   VQWLFGYDVHVTFNQADEQPNLIHKIQNIGHVDMSMVPKETIVRILKLQAFEHESTTITE 65
             WL G   HV F +  E  +++H I+N+     +M  KE IV     Q  E E+  ++ 
Sbjct: 150 CPWLDGK--HVVFGEVLEGMDVVHYIENVKTDSRNMPVKEVIVE----QCGELETVPLSH 203

Query: 66  ETVTMLQKYLEVFVREAV 83
           +    LQ  ++V   E  
Sbjct: 204 QDAAKLQDEIKVEASETA 221

>NCAS0E01360 Chr5 complement(263103..264101) [999 bp, 332 aa] {ON}
          Anc_3.29 YNL316C
          Length = 332

 Score = 27.7 bits (60), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 17/33 (51%)

Query: 13 DVHVTFNQADEQPNLIHKIQNIGHVDMSMVPKE 45
          DVHV F      P    K++N   +D S+VP E
Sbjct: 31 DVHVNFVPTQSIPQCFEKLENNLSIDYSVVPLE 63

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,366,167
Number of extensions: 440974
Number of successful extensions: 1561
Number of sequences better than 10.0: 42
Number of HSP's gapped: 1545
Number of HSP's successfully gapped: 42
Length of query: 121
Length of database: 53,481,399
Length adjustment: 90
Effective length of query: 31
Effective length of database: 43,161,459
Effective search space: 1338005229
Effective search space used: 1338005229
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 59 (27.3 bits)