Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F10384g8.323ON55852918870.0
TDEL0F044908.323ON5101907992e-99
Suva_2.3068.323ON5411757481e-91
Smik_4.3898.323ON5251687462e-91
Skud_4.4048.323ON5351737453e-91
YDR145W (TAF12)8.323ON5391767445e-91
Kpol_543.638.323ON5851797476e-91
KAFR0B057208.323ON4841717266e-89
NCAS0B035708.323ON5191907148e-87
KLTH0G12298g8.323ON5001686832e-82
SAKL0H15554g8.323ON5361686853e-82
TPHA0A015608.323ON5401836792e-81
CAGL0E01397g8.323ON5751846719e-80
Kwal_56.239168.323ON4991686632e-79
AGL195C8.323ON5541966567e-78
KLLA0D16368g8.323ON5111696441e-76
Ecym_42548.323ON5291686433e-76
NDAI0J010208.323ON6381686434e-75
TBLA0A039408.323ON7521756355e-73
KNAG0I008908.323ON5081846003e-70
TBLA0H012808.323ON4051163281e-32
TDEL0H010501.223ON222272960.006
KLLA0E15357g1.223ON222872860.097
KAFR0F020101.223ON221172840.18
KLTH0F05874g1.223ON222072780.91
Kwal_33.140611.223ON222172770.97
TBLA0E044904.297ON14347721.3
Kwal_47.171404.297ON12350701.9
KLTH0D15554g4.297ON12347702.1
ZYRO0A06600g5.400ON94654732.8
SAKL0C06600g1.223ON222072732.9
KNAG0C026901.223ON221272733.4
TDEL0B041208.198ON34764705.2
Ecym_52061.223ON222272707.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F10384g
         (558 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some s...   731   0.0  
TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.3...   312   2e-99
Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa...   292   1e-91
Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W ...   291   2e-91
Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W ...   291   3e-91
YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subun...   291   5e-91
Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON} (145534...   292   6e-91
KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON} Anc_8...   284   6e-89
NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.3...   279   8e-87
KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]...   267   2e-82
SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]...   268   3e-82
TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {O...   266   2e-81
CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {...   263   9e-80
Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145...   259   2e-79
AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON} S...   257   7e-78
KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} simi...   252   1e-76
Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar t...   252   3e-76
NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {...   252   4e-75
TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.3...   249   5e-73
KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {O...   235   3e-70
TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {O...   130   1e-32
TDEL0H01050 Chr8 complement(181351..188019) [6669 bp, 2222 aa] {...    42   0.006
KLLA0E15357g Chr5 (1370741..1377427) [6687 bp, 2228 aa] {ON} hig...    38   0.097
KAFR0F02010 Chr6 complement(390679..397314) [6636 bp, 2211 aa] {...    37   0.18 
KLTH0F05874g Chr6 complement(514124..520786) [6663 bp, 2220 aa] ...    35   0.91 
Kwal_33.14061 s33 complement(506930..513595) [6666 bp, 2221 aa] ...    34   0.97 
TBLA0E04490 Chr5 (1146095..1146526) [432 bp, 143 aa] {ON} Anc_4....    32   1.3  
Kwal_47.17140 s47 complement(269893..270264) [372 bp, 123 aa] {O...    32   1.9  
KLTH0D15554g Chr4 (1284597..1284968) [372 bp, 123 aa] {ON} simil...    32   2.1  
ZYRO0A06600g Chr1 (535933..538773) [2841 bp, 946 aa] {ON} simila...    33   2.8  
SAKL0C06600g Chr3 complement(615551..622213) [6663 bp, 2220 aa] ...    33   2.9  
KNAG0C02690 Chr3 complement(520165..526803) [6639 bp, 2212 aa] {...    33   3.4  
TDEL0B04120 Chr2 (734500..735543) [1044 bp, 347 aa] {ON} Anc_8.1...    32   5.2  
Ecym_5206 Chr5 complement(432376..439044) [6669 bp, 2222 aa] {ON...    32   7.9  

>ZYRO0F10384g Chr6 (841520..843196) [1677 bp, 558 aa] {ON} some
           similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 558

 Score =  731 bits (1887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/529 (72%), Positives = 382/529 (72%)

Query: 30  QGALLQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXX 89
           QGALLQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYS        
Sbjct: 30  QGALLQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSRQRQQAAQ 89

Query: 90  XXXXXXNGAAAGGSTPQSAGSGVSTVPAXXXXXXXXXXXXXXXXXXXXXLANIIKQVLTP 149
                 NGAAAGGSTPQSAGSGVSTVPA                     LANIIKQVLTP
Sbjct: 90  AYEQARNGAAAGGSTPQSAGSGVSTVPAGSQSTGGSSSSGGQSTGGGSQLANIIKQVLTP 149

Query: 150 EQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELLTN 209
           EQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELLTN
Sbjct: 150 EQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELLTN 209

Query: 210 LKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKSTXXXXXXXXXXXXXXXXXXX 269
           LKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKST                   
Sbjct: 210 LKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKSTQQQRMAQQQQQQMQQQVQQ 269

Query: 270 XXXXXXXXXXXXXXXPKTEPGVAKXXXXXXXXXXXXXXXXXXXXXXXXXRGPTSITTQKL 329
                          PKTEPGVAK                         RGPTSITTQKL
Sbjct: 270 QVQQPQQKPVEQVQVPKTEPGVAKPQQQQQQQQQPQQQQQPQQQQPQQQRGPTSITTQKL 329

Query: 330 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIFKQSDPLVPISENVTVKAPS 389
                                                  IFKQSDPLVPISENVTVKAPS
Sbjct: 330 PQQTQPRSQPSSSSVNKSQVTNVNATASMANNNAANKSAIFKQSDPLVPISENVTVKAPS 389

Query: 390 PVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTERVMSKRKLRELVKTVGIDDGDG 449
           PVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTERVMSKRKLRELVKTVGIDDGDG
Sbjct: 390 PVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTERVMSKRKLRELVKTVGIDDGDG 449

Query: 450 ETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYS 509
           ETVI              FVTNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYS
Sbjct: 450 ETVIDGDVEELLLDLADDFVTNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYS 509

Query: 510 ADEIRSTRKWNPSQSYNQKMQSINTDKTNTARNSAAVGGASNKSLSQSK 558
           ADEIRSTRKWNPSQSYNQKMQSINTDKTNTARNSAAVGGASNKSLSQSK
Sbjct: 510 ADEIRSTRKWNPSQSYNQKMQSINTDKTNTARNSAAVGGASNKSLSQSK 558

>TDEL0F04490 Chr6 (841584..843116) [1533 bp, 510 aa] {ON} Anc_8.323
           YDR145W
          Length = 510

 Score =  312 bits (799), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 148/190 (77%), Positives = 159/190 (83%), Gaps = 5/190 (2%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFKQSDPLVPISE VT K PSPV YK+NRPTLTGG AMNA+ LNTP +TKLPPYEVDTER
Sbjct: 326 IFKQSDPLVPISETVTAKTPSPVTYKTNRPTLTGGTAMNAAALNTPTMTKLPPYEVDTER 385

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VMSKRKLRELVKTVGID+GDGETVI              FV+NVTGFACRLAKHRKSDNL
Sbjct: 386 VMSKRKLRELVKTVGIDEGDGETVIDGDVESLLLDLADDFVSNVTGFACRLAKHRKSDNL 445

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDKTNTARNSAAVGG 548
           DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNP  SYNQKMQ+IN+DK  +A+N+     
Sbjct: 446 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPKPSYNQKMQAINSDKATSAKNA----- 500

Query: 549 ASNKSLSQSK 558
           +S KSLSQSK
Sbjct: 501 SSGKSLSQSK 510

 Score =  246 bits (627), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 152/221 (68%), Gaps = 2/221 (0%)

Query: 30  QGALLQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXX 89
           QG   Q RQLLEL TKF+ LV E+K+VGENT RGKELL++ASKIKA+Y NY+        
Sbjct: 18  QGIGGQQRQLLELTTKFRALVNEAKSVGENTPRGKELLIKASKIKAIYDNYNRQRQQAAQ 77

Query: 90  XXXXXXNGAAAGGSTPQSAGSGVSTVPAXXXXXXXXXXXXXXXXXXXXXLANIIKQVLTP 149
                 NG   G + P S+GS   +V A                     LANIIKQVLTP
Sbjct: 78  AFVQGRNGGTPG-ANPASSGS-TGSVGAVNAAGSSSSGSSQQSRSSGSQLANIIKQVLTP 135

Query: 150 EQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELLTN 209
           EQNQQ++ L Q FQ R N+IRDKH FL+QH+E LNQE++K+T+ +AKKQLE+KK EL  N
Sbjct: 136 EQNQQFEALSQNFQARANSIRDKHTFLKQHIERLNQEVSKQTDASAKKQLEEKKTELANN 195

Query: 210 LKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250
           LK LNMEY  L+QEF NGKKKFYVECARHNPALQRLLQ+ST
Sbjct: 196 LKMLNMEYGALQQEFQNGKKKFYVECARHNPALQRLLQRST 236

>Suva_2.306 Chr2 (542035..542808,542959..543810) [1626 bp, 541 aa]
           {ON} YDR145W (REAL)
          Length = 541

 Score =  292 bits (748), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 151/175 (86%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFKQ++P +PISEN++ KAP+PV Y+SNRPT+TGG+AMNA+ LNTP  TKLPPYE+DT+R
Sbjct: 356 IFKQTEPAIPISENISTKAPAPVPYRSNRPTITGGSAMNATALNTPVTTKLPPYEMDTQR 415

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VMSKRKLRELVKTVGID+GDGETVI              FVTNVT FACRLAKHRKSDNL
Sbjct: 416 VMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAFACRLAKHRKSDNL 475

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDKTNTARNS 543
           + RDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQK+Q+IN+DK  TA+N+
Sbjct: 476 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNINSDKVATAKNN 530

 Score =  192 bits (488), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 104/221 (47%), Positives = 141/221 (63%), Gaps = 6/221 (2%)

Query: 30  QGALLQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXX 89
           Q  +LQ +QLLE+  KF+ LV+E++NVGE T RGKEL+ QA+KIK+VY  ++        
Sbjct: 29  QNMMLQQKQLLEMTVKFKALVSEARNVGETTPRGKELMFQAAKIKSVYDAFNRRRQQAAQ 88

Query: 90  XXXXXXNGAAAGGSTPQSAGSGVSTVPAXXXXXXXXXXXXXXXXXXXXXLANIIKQVLTP 149
                   A+ G +TP +AG+ VS +P                       +N+IKQVLT 
Sbjct: 89  AYK----NASVGNTTP-NAGNPVS-LPTEKPPSLSQQQQQQQARSNSNKFSNMIKQVLTS 142

Query: 150 EQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELLTN 209
           E+NQQY+ L Q FQ R  ++++K  FL+Q+++ L QE+NK+T+ A KKQLEDKK ELL N
Sbjct: 143 EENQQYEKLWQNFQVRATSMKEKDTFLKQNIDRLVQEVNKQTDEATKKQLEDKKNELLNN 202

Query: 210 LKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250
            K L +EY+ L + F N KK FYVECARHNPALQ+ LQ+ST
Sbjct: 203 RKVLGIEYNNLLKGFQNSKKTFYVECARHNPALQKFLQEST 243

>Smik_4.389 Chr4 (707521..709098) [1578 bp, 525 aa] {ON} YDR145W
           (REAL)
          Length = 525

 Score =  291 bits (746), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 147/168 (87%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFKQ++P +PISEN++ KAP+PVAY+SNRPT+TGG+AMNAS LNTPA TKLPPYE+DT+R
Sbjct: 340 IFKQTEPAIPISENISAKAPAPVAYRSNRPTITGGSAMNASALNTPAATKLPPYEMDTQR 399

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VMSKRKLRELVKTVGID+GDGETVI              FVTNVT F+CRLAKHR+SDNL
Sbjct: 400 VMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRRSDNL 459

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDK 536
           + RDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQK+QSI +DK
Sbjct: 460 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQSITSDK 507

 Score =  169 bits (429), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 95/224 (42%), Positives = 133/224 (59%), Gaps = 6/224 (2%)

Query: 30  QGALLQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXX 89
           Q  +LQ RQL E+  KF  L+TE++NVGE T RGKEL+ QA+KIK VY   +        
Sbjct: 29  QNMVLQPRQLQEMTAKFTALLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNKRRQQA 88

Query: 90  XXXXXXNGAAAGGSTPQSAGSGVSTVP---AXXXXXXXXXXXXXXXXXXXXXLANIIKQV 146
                    A+ G+T  ++ + V+      +                      +++IKQV
Sbjct: 89  AQAYRN---ASMGNTNSNSNNPVTMSTEKTSNSSQQHQQQHQQQQTRNNSNKFSSMIKQV 145

Query: 147 LTPEQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMEL 206
           LTPE+NQ+Y+ L Q FQ R  +I++K  FL+Q+++ L QEINK+TE  AK+QL++KK EL
Sbjct: 146 LTPEENQEYEKLWQNFQARHTSIKEKETFLKQNIDRLEQEINKQTEEGAKQQLQEKKNEL 205

Query: 207 LTNLKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250
           L + K L +EY+ L   + N KK FYVECARHNPAL + LQ+ST
Sbjct: 206 LNDWKVLKIEYTKLFNSYQNSKKTFYVECARHNPALHKFLQEST 249

>Skud_4.404 Chr4 (718381..719988) [1608 bp, 535 aa] {ON} YDR145W
           (REAL)
          Length = 535

 Score =  291 bits (745), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 131/173 (75%), Positives = 148/173 (85%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFKQ++P +PISEN++ KAP+PVAY+SNRPT+TGG+AMNAS LNTP  TKLPPYE+DT+R
Sbjct: 350 IFKQTEPAIPISENISTKAPAPVAYRSNRPTVTGGSAMNASALNTPVTTKLPPYEMDTQR 409

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VMSKRKLRELVKTVGID+GDGETVI              FVTNVT FACRLAKHRKSDNL
Sbjct: 410 VMSKRKLRELVKTVGIDEGDGETVIDGDVEDLLLDLADDFVTNVTAFACRLAKHRKSDNL 469

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDKTNTAR 541
           + RDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQK+Q+I +DK   A+
Sbjct: 470 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKLQNITSDKVAAAK 522

 Score =  171 bits (434), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 94/222 (42%), Positives = 130/222 (58%), Gaps = 3/222 (1%)

Query: 30  QGALLQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXX 89
           Q   LQ RQL E+  KF+ L+ E++NVGE T RGKEL+ QA+KIK VY   +        
Sbjct: 29  QNLTLQPRQLQEMTAKFRALLIEARNVGETTPRGKELMFQAAKIKQVYD--ALTLNKRRQ 86

Query: 90  XXXXXXNGAAAGGSTPQSAG-SGVSTVPAXXXXXXXXXXXXXXXXXXXXXLANIIKQVLT 148
                   A+ G + P  +  + + T  A                      +N+IKQVLT
Sbjct: 87  QAAQAYKNASMGNANPNPSNLASLPTDKAPNPSQQQQQQQQQQARNNSNKFSNMIKQVLT 146

Query: 149 PEQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELLT 208
           PE+NQ+Y+ L Q FQ R  +I+++  FL+Q+++ L QEINK+T+   K+QLE+KK ELL 
Sbjct: 147 PEENQEYEKLWQNFQVRHTSIKEREAFLKQNVDRLEQEINKQTDEGTKQQLEEKKNELLN 206

Query: 209 NLKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250
           + K L +EY+ L   + N KK FYVECARHNPAL + LQ+ST
Sbjct: 207 DWKVLKIEYTKLFNSYQNSKKTFYVECARHNPALHKFLQEST 248

>YDR145W Chr4 (746738..748357) [1620 bp, 539 aa] {ON}  TAF12Subunit
           (61/68 kDa) of TFIID and SAGA complexes, involved in RNA
           polymerase II transcription initiation and in chromatin
           modification, similar to histone H2A
          Length = 539

 Score =  291 bits (744), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 150/176 (85%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFKQ++P +PISEN++ K P+PVAY+SNRPT+TGG+AMNAS LNTPA TKLPPYE+DT+R
Sbjct: 354 IFKQTEPAIPISENISTKTPAPVAYRSNRPTITGGSAMNASALNTPATTKLPPYEMDTQR 413

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VMSKRKLRELVKTVGID+GDGETVI              FVTNVT F+CRLAKHRKSDNL
Sbjct: 414 VMSKRKLRELVKTVGIDEGDGETVIDGDVEELLLDLADDFVTNVTAFSCRLAKHRKSDNL 473

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDKTNTARNSA 544
           + RDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQ+YNQK+QSI +DK   A+N+ 
Sbjct: 474 EARDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQNYNQKLQSITSDKVAAAKNNG 529

 Score =  167 bits (423), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 95/223 (42%), Positives = 133/223 (59%), Gaps = 10/223 (4%)

Query: 30  QGALLQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXX 89
           Q  +LQ RQL E+  KF+ L+TE++NVGE T RGKEL+ QA+KIK VY   +        
Sbjct: 29  QNMVLQPRQLQEMAAKFRTLLTEARNVGETTPRGKELMFQAAKIKQVYDALTLNRRRQQ- 87

Query: 90  XXXXXXNGAAAGGSTPQSAGSGVSTVPAXX--XXXXXXXXXXXXXXXXXXXLANIIKQVL 147
                   A A  +T  S  S  +++P                         +N+IKQVL
Sbjct: 88  -------AAQAYNNTSNSNSSNPASIPTENVPNSSQQQQQQQQQTRNNSNKFSNMIKQVL 140

Query: 148 TPEQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELL 207
           TPE+NQ+Y+ L Q FQ R  +I++K  +L+Q+++ L QEINK+T+   K+QL++KK+ELL
Sbjct: 141 TPEENQEYEKLWQNFQVRHTSIKEKETYLKQNIDRLEQEINKQTDEGPKQQLQEKKIELL 200

Query: 208 TNLKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250
            + K L +EY+ L   + N KK FYVECARHNPAL + LQ+ST
Sbjct: 201 NDWKVLKIEYTKLFNNYQNSKKTFYVECARHNPALHKFLQEST 243

>Kpol_543.63 s543 (145534..147291) [1758 bp, 585 aa] {ON}
           (145534..147291) [1758 nt, 586 aa]
          Length = 585

 Score =  292 bits (747), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 134/179 (74%), Positives = 150/179 (83%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFKQSDP VPISE++TVKAP  V+Y SNRP+LTGG AMNAS LNTP ITKLPPYE+DTER
Sbjct: 397 IFKQSDPSVPISESITVKAPEAVSYISNRPSLTGGTAMNASVLNTPTITKLPPYEIDTER 456

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VMSKRKLREL+K+VGID+GDGETVI              FVTNVT FACRLAKHRKSD+L
Sbjct: 457 VMSKRKLRELIKSVGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRKSDSL 516

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDKTNTARNSAAVG 547
           + RDIQLHLERNWNIRIPGYS DEIRSTRKW P+QSY+QKMQSIN +K+N A+NS + G
Sbjct: 517 EARDIQLHLERNWNIRIPGYSGDEIRSTRKWIPTQSYSQKMQSINNEKSNIAKNSGSTG 575

 Score =  192 bits (488), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 139/210 (66%), Gaps = 4/210 (1%)

Query: 44  TKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXXXXXXXXNGAAA--G 101
           TKF++LV E+K VG+NTQRGKELL+QAS +KAVY NY+               G++    
Sbjct: 32  TKFKELVNEAKRVGQNTQRGKELLIQASNLKAVYDNYNKQRQALINQQQQQQAGSSQTPA 91

Query: 102 GSTPQSAGSGVSTVPAXXXXXXXXXXXXXXXXXXX--XXLANIIKQVLTPEQNQQYDNLL 159
           G+T  +  +  S+ PA                       LA++IKQVLTPE+NQQYD LL
Sbjct: 92  GTTNNADAASSSSAPAAAGASGANGTRKTAVANASGGSQLADLIKQVLTPEENQQYDKLL 151

Query: 160 QTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELLTNLKSLNMEYSV 219
           Q FQ+R ++I+D+H FL+QH++ L+QEIN++T+ AAKKQLE  + ELLTNL++LN EYS 
Sbjct: 152 QNFQSRASSIKDQHTFLKQHIDRLSQEINQQTDEAAKKQLEVNRAELLTNLRTLNTEYSN 211

Query: 220 LRQEFTNGKKKFYVECARHNPALQRLLQKS 249
           L ++  N KK FYVECAR NP LQRLLQKS
Sbjct: 212 LYEDIKNKKKAFYVECARQNPELQRLLQKS 241

>KAFR0B05720 Chr2 (1180414..1181868) [1455 bp, 484 aa] {ON}
           Anc_8.323 YDR145W
          Length = 484

 Score =  284 bits (726), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 128/171 (74%), Positives = 145/171 (84%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFKQSDP VPISE+++ K P PV Y+ NRPT++GG+AMNA+ LNTP +TKLPPYE+DTER
Sbjct: 298 IFKQSDPAVPISESISSKTPIPVPYRVNRPTISGGSAMNAAALNTPIMTKLPPYELDTER 357

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VMSKRKLRELVKT+GID+GDGETVI              FVTNVT FAC+LAKHRKSDNL
Sbjct: 358 VMSKRKLRELVKTIGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACKLAKHRKSDNL 417

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDKTNT 539
           +T+DIQLHLERNWNIRIPGYSADEIRSTRKWNP+QSYNQK+QSIN DK  T
Sbjct: 418 ETKDIQLHLERNWNIRIPGYSADEIRSTRKWNPTQSYNQKLQSINIDKNGT 468

 Score =  192 bits (487), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 101/221 (45%), Positives = 139/221 (62%), Gaps = 14/221 (6%)

Query: 30  QGALLQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXX 89
           +G  LQ +QL+EL  +F+ LV E+K VGE T  GKEL++QASK+KA+Y NY+        
Sbjct: 20  RGITLQ-KQLMELSARFKSLVQEAKKVGETTPEGKELIMQASKLKALYDNYNKQKQE--- 75

Query: 90  XXXXXXNGAAAGGSTPQSAGSGVSTVPAXXXXXXXXXXXXXXXXXXXXXLANIIKQVLTP 149
                     A         +  +                          A +I+Q LTP
Sbjct: 76  ----------AMAQAQARNNNANTANVNSSSSANSTEANTSGRSGSSAQFATLIRQALTP 125

Query: 150 EQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELLTN 209
           EQNQQYD L+Q FQTR NNI+DKH FL+Q+++ L QEI K+T+ AAKKQL++K++EL+TN
Sbjct: 126 EQNQQYDKLVQNFQTRANNIKDKHTFLKQNIDRLVQEIEKQTDAAAKKQLDEKRIELMTN 185

Query: 210 LKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250
           LK++++EY+ L+Q++ NGKK FY+ECA+ NP LQRLLQKST
Sbjct: 186 LKAISVEYTNLQQQYNNGKKAFYIECAKKNPDLQRLLQKST 226

>NCAS0B03570 Chr2 (633284..634843) [1560 bp, 519 aa] {ON} Anc_8.323
           YDR145W
          Length = 519

 Score =  279 bits (714), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 128/190 (67%), Positives = 152/190 (80%), Gaps = 5/190 (2%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFKQSDP+VP+S+ ++ K P  V Y+SNRPT+TGG+AM+AS LNTP +TKLPPYE+DTER
Sbjct: 335 IFKQSDPMVPVSDTISTKQPIAVPYRSNRPTMTGGSAMSASALNTPVMTKLPPYELDTER 394

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VMSKRKLRELVK++GID+GDGETVI              F+TNVT FACRLAKHRKSDNL
Sbjct: 395 VMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDMADDFITNVTSFACRLAKHRKSDNL 454

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDKTNTARNSAAVGG 548
           + RDIQLHLERNW+IRIPGYSADEIRS RKWNP+Q+YNQK+Q IN DK     N+AA G 
Sbjct: 455 EARDIQLHLERNWDIRIPGYSADEIRSIRKWNPAQTYNQKLQQINNDK-----NNAASGN 509

Query: 549 ASNKSLSQSK 558
           ++  S  +SK
Sbjct: 510 STTASSKKSK 519

 Score =  181 bits (460), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 102/219 (46%), Positives = 137/219 (62%), Gaps = 6/219 (2%)

Query: 33  LLQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXXXXX 92
           +LQ  Q+ EL  KF+ LV E+K VGENTQRGKELL+QASK+KA+Y NY+           
Sbjct: 20  ILQPNQIRELTAKFKALVNEAKEVGENTQRGKELLIQASKLKAMYDNYNRQRQQQLQQQQ 79

Query: 93  XXXNGAAAGGSTPQSAGSGVSTVPAXXXXXXXXXXXXXXXXXXXXXLANIIKQVLTPEQN 152
              N        P S    V+T  +                     LANI++QVLT EQN
Sbjct: 80  AVNNKV----QNP-SNNDNVTTNNSFASPSSPPTSGSTISNSSSTQLANIMRQVLTDEQN 134

Query: 153 QQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPA-AKKQLEDKKMELLTNLK 211
             +D L QTF++R + ++DKH FL+Q++E L QEINK+ +   A+KQLE+K+ ELL NLK
Sbjct: 135 ANFDKLDQTFRSRASALKDKHTFLKQNIERLTQEINKQADNVNARKQLEEKRGELLRNLK 194

Query: 212 SLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250
           ++ ME++ L Q++ NGKK FY+ECA+ NP LQ+LLQKST
Sbjct: 195 AITMEHNTLYQKYQNGKKAFYIECAKTNPDLQKLLQKST 233

>KLTH0G12298g Chr7 complement(1045663..1047165) [1503 bp, 500 aa]
           {ON} similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145W
          Length = 500

 Score =  267 bits (683), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 119/168 (70%), Positives = 138/168 (82%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFKQ +P VP+SE +T + P+PV ++SNRPT+TGG+AMNA+ L TP +TKLPPYEVD ER
Sbjct: 305 IFKQPNPSVPVSETITQRMPTPVVHRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNER 364

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VMSKRKLRELVK+VGID+GDGET I              F+TNVT FACRLAKHRKSDNL
Sbjct: 365 VMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 424

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDK 536
           D RDIQLHLERNWNIRIPGY+ADE+RSTRKWNP+ SYNQK+Q IN+ K
Sbjct: 425 DVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTTSYNQKLQGINSAK 472

 Score =  112 bits (281), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 107/213 (50%), Gaps = 19/213 (8%)

Query: 39  LLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXXXXXXXXNGA 98
           L ++  KF Q   E+K VG  T +G+ELL QAS+IKA+Y  Y                G 
Sbjct: 30  LQQMAYKFSQCFNEAKRVGLQTPQGQELLKQASRIKAMYDAY--------RQRQQSAQGF 81

Query: 99  AAGGSTPQSAGSGVSTVPAXXXXXXXXXXXXXXXXXXXXXLANIIKQVLTPEQNQQYDNL 158
             GG+T  + G   +  P                      +++ I+ +LTP+QN+ Y  L
Sbjct: 82  EQGGAT-SNTGDNTAGTPTNARSPNGTPNNN---------MSSNIQNLLTPQQNEAYGRL 131

Query: 159 LQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKT-EPAAKKQLEDKKMELLTNLKSLNMEY 217
           +QT       I+ ++ +L++ +E L+ EI K+  +PA  KQLE  K E+L  L+  +  Y
Sbjct: 132 IQTSNENGEKIKGEYTYLKKQIEILDGEIKKRQGDPATVKQLETNKTEILNKLRGFSASY 191

Query: 218 SVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250
             L Q+    KKKFY+ECA  NP L+R LQ ST
Sbjct: 192 LALNQKLREDKKKFYIECAATNPNLKRFLQAST 224

>SAKL0H15554g Chr8 complement(1354739..1356349) [1611 bp, 536 aa]
           {ON} some similarities with uniprot|Q03761 Saccharomyces
           cerevisiae YDR145W
          Length = 536

 Score =  268 bits (685), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 139/168 (82%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFKQ +P +P+SENVT K P+ VAY+SNRPT+TGG+AMNA+ LNTP +TKLPPYEVD+ER
Sbjct: 328 IFKQPNPSLPVSENVTPKNPTAVAYRSNRPTITGGSAMNAAALNTPVMTKLPPYEVDSER 387

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VMSKRKLRELVK+VG+D+GDGET I              F++NVTGFACRLAKHRKSDNL
Sbjct: 388 VMSKRKLRELVKSVGVDEGDGETTIDGDVEELLLDLADDFISNVTGFACRLAKHRKSDNL 447

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDK 536
           D RDIQLHLERNWNIRIPGYSADEIRSTRKWN + +Y QK+Q IN  K
Sbjct: 448 DVRDIQLHLERNWNIRIPGYSADEIRSTRKWNSTTNYTQKLQGINAAK 495

 Score =  113 bits (283), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 109/213 (51%), Gaps = 15/213 (7%)

Query: 39  LLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXXXXXXXXNGA 98
           + +L  +F  L  E+  +G NT  G+ELL QA+KIKA+Y  Y+                A
Sbjct: 30  IQQLALRFTALFKEATRIGVNTSEGEELLKQAAKIKAIYDAYNKQKQQ----------AA 79

Query: 99  AAGGSTPQSAGSGVSTVPAXXXXXXXXXXXXXXXXXXXXXLANIIKQVLTPEQNQQYDNL 158
            A G T     +      A                      ++ I+ +LTPEQ++ Y+ L
Sbjct: 80  QAFGQT----NNRPPAPAAGNPPQVAQNTQQRQNSNSANNPSSNIRTLLTPEQSEAYNKL 135

Query: 159 LQTFQTRTNNIRDKHNFLEQHLEGLNQEI-NKKTEPAAKKQLEDKKMELLTNLKSLNMEY 217
            +TF     NIR +  +L +++E L+ EI N+++EP A ++LE  K EL+T L+ L+  +
Sbjct: 136 TKTFGDSAKNIRGESEYLRKNIEVLDTEIKNRESEPLAVERLESTKAELVTKLRGLDASF 195

Query: 218 SVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250
             L Q+F   KKKFY+ECA  NP L+R LQ ST
Sbjct: 196 QALPQKFHEAKKKFYIECAASNPNLKRFLQAST 228

>TPHA0A01560 Chr1 complement(311613..313235) [1623 bp, 540 aa] {ON}
           Anc_8.323 YDR145W
          Length = 540

 Score =  266 bits (679), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 124/183 (67%), Positives = 147/183 (80%), Gaps = 7/183 (3%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFKQSDP VPIS+NVT++    + YKSNRP+LTGGAAM+A+ LN P +T LPPYE+DTER
Sbjct: 354 IFKQSDPTVPISDNVTLEPTELIPYKSNRPSLTGGAAMSAAALNVPPLTTLPPYEIDTER 413

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VM+KRKLREL+K VGID+GDGETVI              FVTNVT FACRLAKHRKS+NL
Sbjct: 414 VMAKRKLRELIKNVGIDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRKSENL 473

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDKTN-------TAR 541
           ++RDIQLHLERNWNIRIPGYS DEIRSTRKW P+Q+++QK+QSIN DK+N       TA+
Sbjct: 474 ESRDIQLHLERNWNIRIPGYSGDEIRSTRKWLPTQAFSQKLQSINNDKSNPSNTSKTTAK 533

Query: 542 NSA 544
           NS+
Sbjct: 534 NSS 536

 Score =  164 bits (415), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 98/234 (41%), Positives = 129/234 (55%), Gaps = 21/234 (8%)

Query: 34  LQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXXXXXX 93
           LQ +QL+EL  KF+QLV E+K VGENT RGKELL+QASK+KA+Y N++            
Sbjct: 25  LQQKQLIELTNKFKQLVNEAKAVGENTPRGKELLIQASKLKAIYENFTKQRQAQIQQLQQ 84

Query: 94  XXNGAAAGGST---------PQSAGSGVST---------VPAXXXXXXXXXXXXXXXXXX 135
                               P +  S VS          V A                  
Sbjct: 85  QQLQQQQLQQQQQQTQNAIRPNTNASNVSNANIVNQSTPVGATPVSTTSSTPNTNTSSNS 144

Query: 136 XXXLANIIKQVLTPEQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAA 195
              +ANIIKQ+LT EQNQQYDNL++ F  +  +I+DKH FL+Q+++ L QEIN  +    
Sbjct: 145 STQIANIIKQILTAEQNQQYDNLVKNFLAKRTSIKDKHAFLKQNIDKLTQEINNNSNNND 204

Query: 196 KKQ---LEDKKMELLTNLKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLL 246
                 LE K+ EL+TNLK L++E+S + +EF N KK FYVECA+ NPALQ+LL
Sbjct: 205 VNVKKNLEIKRNELITNLKQLSLEFSKIHEEFKNDKKTFYVECAKQNPALQKLL 258

>CAGL0E01397g Chr5 complement(129962..131689) [1728 bp, 575 aa] {ON}
           similar to uniprot|Q03761 Saccharomyces cerevisiae
           YDR145w TAF61
          Length = 575

 Score =  263 bits (671), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 144/184 (78%), Gaps = 2/184 (1%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFK SDP VPI++ V+VK P P+A++SNRPT++ G+AMNA+ LNTP +T LPPYE+DT+R
Sbjct: 386 IFKPSDPTVPIADTVSVKPPEPIAFRSNRPTISDGSAMNAAALNTPVMTTLPPYEIDTDR 445

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VMSKRKLRELVK++GID+GDGETVI              FVTNVTGFACRLAKHRKSDNL
Sbjct: 446 VMSKRKLRELVKSIGIDEGDGETVIDGDVEELLLDLADDFVTNVTGFACRLAKHRKSDNL 505

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDKTNTARNSAAVGG 548
           +  DIQLHLERNWNIRIPGYSADEIRS  KWN S +Y QK+ SIN DK   A ++A+   
Sbjct: 506 EPTDIQLHLERNWNIRIPGYSADEIRSVHKWNASPAYAQKLTSINADK--QAISTASANA 563

Query: 549 ASNK 552
            SNK
Sbjct: 564 VSNK 567

 Score =  195 bits (495), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 107/217 (49%), Positives = 139/217 (64%), Gaps = 2/217 (0%)

Query: 34  LQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXXXXXX 93
           +Q +Q+ EL  +F+QLVTE+K VGE T RGKELLLQA+K+KAVY NY+            
Sbjct: 30  IQQKQIQELTARFKQLVTEAKKVGETTPRGKELLLQAAKLKAVYENYTRRQQALARAQQL 89

Query: 94  XXNGAAAGGSTPQSAGSGVSTVPAXXXXXXXXXXXXXXXXXXXXXLANIIKQVLTPEQNQ 153
              G+    +   S+GS  +                         LANIIKQVLTPEQNQ
Sbjct: 90  QQQGS--NTNAAASSGSSTTGTTGTANSSGSASTSGNNSSNSSAQLANIIKQVLTPEQNQ 147

Query: 154 QYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELLTNLKSL 213
           QY+ LLQ FQ R + I+DKH F++Q+++ L  EINK+T+  AKKQL +KK ELL N+K++
Sbjct: 148 QYEQLLQNFQVRASAIKDKHTFIKQNIDRLVVEINKQTDEEAKKQLNEKKTELLRNIKAI 207

Query: 214 NMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250
            +E+  L+QE  NGKK FY+ECAR NPALQRLLQ+ST
Sbjct: 208 RLEHQALQQELQNGKKNFYLECARQNPALQRLLQRST 244

>Kwal_56.23916 s56 (774901..776400) [1500 bp, 499 aa] {ON} YDR145W
           (TAF12) - TFIID subunit [contig 171] FULL
          Length = 499

 Score =  259 bits (663), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 117/168 (69%), Positives = 136/168 (80%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFKQ +P VP+SE +T K P+ +  +SNRPT+TGG+AMNA+ L TP +TKLPPYEVD ER
Sbjct: 305 IFKQPNPSVPVSETITQKMPTLMVNRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDNER 364

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VMSKRKLRELVK+VGID+GDGET I              F+TNVT FACRLAKHRKSDNL
Sbjct: 365 VMSKRKLRELVKSVGIDEGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 424

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDK 536
           D RDIQLHLERNWNIRIPGY+ADE+RSTRKWNP+ SYNQK+Q IN+ +
Sbjct: 425 DVRDIQLHLERNWNIRIPGYAADEVRSTRKWNPTASYNQKLQGINSAR 472

 Score =  104 bits (260), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 70/213 (32%), Positives = 103/213 (48%), Gaps = 19/213 (8%)

Query: 39  LLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXXXXXXXXNGA 98
           + ++  KF Q   E+K +G  T +G+ELL QAS IKAVY  Y               N  
Sbjct: 30  MQQMAYKFTQCFNEAKRIGLQTPQGQELLKQASHIKAVYDAY---RQRQQAAQGFDQNAP 86

Query: 99  AAGGSTPQSAGSGVSTVPAXXXXXXXXXXXXXXXXXXXXXLANIIKQVLTPEQNQQYDNL 158
            A  +   S     +  P                      +++ I+ +LTP+QN+ Y  L
Sbjct: 87  GASSAGSTSGSPATARAP---------------NGTATNTISSNIQNLLTPQQNEAYGRL 131

Query: 159 LQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKT-EPAAKKQLEDKKMELLTNLKSLNMEY 217
           +Q+       I+ ++ +L++ +E L+ EI K+  +PA  KQLE  K E+L  LK  +  Y
Sbjct: 132 IQSSNENGEKIKGEYTYLKRQIEILDGEIKKREGDPATVKQLEANKAEILNKLKGFSASY 191

Query: 218 SVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250
             L Q+    KKKFY+ECA  NP L+R LQ ST
Sbjct: 192 VALNQKLREDKKKFYIECAATNPNLKRFLQAST 224

>AGL195C Chr7 complement(331850..333514) [1665 bp, 554 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR145W
           (TAF12)
          Length = 554

 Score =  257 bits (656), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 122/196 (62%), Positives = 145/196 (73%), Gaps = 12/196 (6%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFKQ +P +PI EN+T    + V+Y+SNRPT+T G+AMNAS L  P +TKLPPYEVD+ER
Sbjct: 358 IFKQPNPSIPIPENITPLTTTSVSYRSNRPTITSGSAMNASALTMPVMTKLPPYEVDSER 417

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VMSKRKLRELVKTVGIDDGDGET +              F+TNVT FACRLAKHRKSDNL
Sbjct: 418 VMSKRKLRELVKTVGIDDGDGETTVDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 477

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDK------------ 536
           D RDIQLHLERNWNIRIPGY+ADEIRST+KWNP+ +Y+QK+Q I++ +            
Sbjct: 478 DVRDIQLHLERNWNIRIPGYAADEIRSTKKWNPTPAYSQKLQGISSARAAKLAPATTANV 537

Query: 537 TNTARNSAAVGGASNK 552
           T  + N+AAV   SNK
Sbjct: 538 TTGSANAAAVATESNK 553

 Score =  112 bits (280), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 76/213 (35%), Positives = 109/213 (51%), Gaps = 23/213 (10%)

Query: 39  LLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXXXXXXXXNGA 98
           + +L  KF+ LV+E++ VG  T  G ELL +AS IKA+Y  Y               N A
Sbjct: 80  MRQLAYKFRTLVSEAQQVGVRTPEGLELLKKASNIKAIYETY---HRQQAQQAFQVRNPA 136

Query: 99  AAGGSTPQSAGSGVSTVPAXXXXXXXXXXXXXXXXXXXXXLANIIKQVLTPEQNQQYDNL 158
            AG       G   +  P                      +A+ IK +LTP+Q + Y+ L
Sbjct: 137 PAGQLAAAGTGQATAPRPTSS-------------------VASNIKMLLTPQQREAYEKL 177

Query: 159 LQTFQTRTNNIRDKHNFLEQHLEGLNQEI-NKKTEPAAKKQLEDKKMELLTNLKSLNMEY 217
            QTF     NI  ++ FL++++E L+ EI N++ EP   KQLE KK ELLT L  LN ++
Sbjct: 178 TQTFNESVKNITGEYEFLKKNIEVLDTEIKNRQGEPMTVKQLETKKNELLTKLTGLNTQF 237

Query: 218 SVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250
             L ++F   KKKFY+ECA  N  L++ LQ ++
Sbjct: 238 QALPKKFQEDKKKFYIECAATNVNLKKFLQATS 270

>KLLA0D16368g Chr4 (1376929..1378464) [1536 bp, 511 aa] {ON} similar
           to uniprot|Q03761 Saccharomyces cerevisiae YDR145W,
          Length = 511

 Score =  252 bits (644), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 134/169 (79%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFKQ +P +PISENVT      V+Y+SNRPT+TGG+ MNA  L TP +TKLPPYEVDTER
Sbjct: 335 IFKQPNPSIPISENVTASPTVSVSYRSNRPTITGGSGMNAPALTTPVMTKLPPYEVDTER 394

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VMSKRKLRELVKTVGID+GDGET I              F+TNVT FAC+LAKHRKSD+L
Sbjct: 395 VMSKRKLRELVKTVGIDEGDGETTIDGDVEELLLDLADDFITNVTNFACKLAKHRKSDSL 454

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDKT 537
           D RDIQ+HLERNWNIRIPG++ DEIRST+KWNP+ SYNQ + +IN +KT
Sbjct: 455 DVRDIQMHLERNWNIRIPGFANDEIRSTKKWNPTPSYNQMVNAINNNKT 503

 Score =  101 bits (251), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 108/209 (51%), Gaps = 10/209 (4%)

Query: 39  LLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXXXXXXXXNGA 98
           + +L  + + LV E+K +G +T+ GKELL QA++IKA+Y  YS                 
Sbjct: 18  MQQLADRLKSLVNEAKRIGVDTKEGKELLRQAARIKALYEAYSKQRQQQAQAQAGAQGAV 77

Query: 99  AAGGSTPQSAGSGVSTVPAXXXXXXXXXXXXXXXXXXXXXLANIIKQVLTPEQNQQYDNL 158
               +  +S                               + N IK +LTP+Q + Y+ L
Sbjct: 78  NNNATNVKSMDQQQQQ---------QQQQQQQQATASSNNVTNNIKVLLTPQQREAYNRL 128

Query: 159 LQTFQTRTNNIRDKHNFLEQHLEGLNQEI-NKKTEPAAKKQLEDKKMELLTNLKSLNMEY 217
           +Q ++    NI+ + NFL++++  L+QEI N++    + +QLE  + ELL  +++L+ +Y
Sbjct: 129 VQKYEDDGQNIKGEFNFLKRNISVLDQEIRNRRGNSLSVQQLEVNRNELLMKIRALSAQY 188

Query: 218 SVLRQEFTNGKKKFYVECARHNPALQRLL 246
           S L+Q++   ++KFY+EC++ N  L+R L
Sbjct: 189 STLQQKYQEDRRKFYIECSQTNADLRRYL 217

>Ecym_4254 Chr4 (527580..529169) [1590 bp, 529 aa] {ON} similar to
           Ashbya gossypii AGL195C
          Length = 529

 Score =  252 bits (643), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 134/168 (79%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFKQ +P +PI E+V+  + + V+Y+SNRPT+TGG+AMNA+ L TP +TKLPPYEVD+ER
Sbjct: 329 IFKQPNPSIPIPESVSPISTTSVSYRSNRPTITGGSAMNAAALTTPVMTKLPPYEVDSER 388

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VMSKRKLRELVK+VGIDDGDGET I              F+TNVT FACRLAKHRKSDNL
Sbjct: 389 VMSKRKLRELVKSVGIDDGDGETTIDGDVEELLLDLADDFITNVTSFACRLAKHRKSDNL 448

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDK 536
           D RDIQLHLERNWNIR PGYSADEIRST+KWN + +Y QKMQ I + K
Sbjct: 449 DVRDIQLHLERNWNIRTPGYSADEIRSTKKWNSTPAYGQKMQVITSAK 496

 Score = 96.7 bits (239), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 75/113 (66%), Gaps = 1/113 (0%)

Query: 139 LANIIKQVLTPEQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEI-NKKTEPAAKK 197
           +A+ IK +L P+Q + Y+ L QTF     NI+ ++ FL++++E L+ EI N+++EP   +
Sbjct: 129 VASNIKMLLNPQQREAYERLTQTFNESAKNIKGEYEFLKKNIEVLDTEIKNRQSEPITVR 188

Query: 198 QLEDKKMELLTNLKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250
           QLE KK ELL  L SLN ++  L ++F   KKKFY+ECA  N  L++ LQ ++
Sbjct: 189 QLESKKNELLMKLTSLNTQFQTLPKKFQEDKKKFYIECAATNMNLKKFLQATS 241

 Score = 41.2 bits (95), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 27/42 (64%)

Query: 39 LLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNY 80
          L +L  KF  LV E++ VG  T  G ELL +ASK+KA+Y  Y
Sbjct: 20 LQQLAYKFTTLVDEAQRVGVQTPEGLELLKKASKVKAIYETY 61

>NDAI0J01020 Chr10 complement(231968..233884) [1917 bp, 638 aa] {ON}
           Anc_8.323 YDR145W
          Length = 638

 Score =  252 bits (643), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 114/168 (67%), Positives = 135/168 (80%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           +FK ++P+V IS+ ++ K P  V Y+SNRP+LTGG+AMNAS L TP  TKLPPYE+DTER
Sbjct: 439 MFKPAEPIVNISDTISTKQPISVPYRSNRPSLTGGSAMNASALTTPVATKLPPYEIDTER 498

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VMSKRKLRELVK++G+D+GDGETVI              FVTNVT FACRLAKHR SD+L
Sbjct: 499 VMSKRKLRELVKSIGVDEGDGETVIDGDVEELLLDLADDFVTNVTSFACRLAKHRNSDSL 558

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDK 536
           + RDIQLHLE+NWNIRIPGYSADEIRS RKW+P Q+YNQK+Q IN DK
Sbjct: 559 EPRDIQLHLEKNWNIRIPGYSADEIRSIRKWHPIQNYNQKLQHINNDK 606

 Score =  163 bits (413), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 135/238 (56%), Gaps = 23/238 (9%)

Query: 34  LQHRQLLELRTKFQQLVTESKNVG-ENTQRGKELLLQASKIKAVYTNYSXXXXXXXXXXX 92
           LQ  Q++EL  KF+ LV E+K +G +N+QRGKELL+QASKIKA+Y  Y+           
Sbjct: 36  LQPNQVIELSNKFKALVNEAKQLGGDNSQRGKELLIQASKIKAIYDTYNRQRQAAAAAAA 95

Query: 93  XXXNGAAAG---------------------GSTPQSAGSGVSTVPAXXXXXXXXXXXXXX 131
                 A                       G+TP +     +++P               
Sbjct: 96  AQARVQAQVQVQSSDVNKELPTSTANNNNIGATPSANTPTPNSIPISNSNTPSSLNANNG 155

Query: 132 XXXXXXXLANIIKQVLTPEQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKT 191
                  LA+I+KQVLTPEQNQ+YD L+ TFQTR   I++KH+F++Q++E L+QE+NK  
Sbjct: 156 NRLSSNQLASIMKQVLTPEQNQEYDKLVSTFQTRAAAIKEKHSFVKQNIERLSQELNKPN 215

Query: 192 -EPAAKKQLEDKKMELLTNLKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQK 248
            +P  K QLE+KK EL   ++++ +E++ L Q+F  G+K FYVECA++NPALQ   +K
Sbjct: 216 LDPNLKTQLENKKTELFNTIRAITVEHNTLHQQFQTGQKTFYVECAKNNPALQNCYKK 273

>TBLA0A03940 Chr1 (984062..986320) [2259 bp, 752 aa] {ON} Anc_8.323
           YDR145W
          Length = 752

 Score =  249 bits (635), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 110/175 (62%), Positives = 139/175 (79%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFKQ++PL+PISE++T K P  + Y++NRPTLTGG AMN S LNTP +TKLPPYE+DT+R
Sbjct: 566 IFKQTEPLLPISEHLTTKIPEAIPYRNNRPTLTGGTAMNTSVLNTPVLTKLPPYEIDTQR 625

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           VM KRKL+E+V++VG+DDGDGETVI              FVT+VT FAC++AKHRKSD+L
Sbjct: 626 VMLKRKLKEVVRSVGVDDGDGETVIGGDVEEALLDLADNFVTSVTTFACKIAKHRKSDSL 685

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDKTNTARNS 543
           D  DIQLHLE+NWNIRIP YS D IRS+RKWNP+ SYNQK+ S+N  K ++ ++S
Sbjct: 686 DVGDIQLHLEKNWNIRIPSYSMDVIRSSRKWNPTASYNQKLNSLNPGKGSSGKHS 740

 Score =  139 bits (349), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 64/113 (56%), Positives = 87/113 (76%), Gaps = 1/113 (0%)

Query: 139 LANIIKQVLTPEQNQQYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKK- 197
           LAN IKQ+LTPEQN+QYD L+  FQ R  NI++KH+FL+QH+     E+NK   PA  + 
Sbjct: 230 LANYIKQLLTPEQNKQYDQLVTNFQLRATNIKEKHDFLKQHISRYTAELNKPNIPALDRV 289

Query: 198 QLEDKKMELLTNLKSLNMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKST 250
           +LE KK+EL++NLK+++++Y+ L QEF NGKK FY+ CAR NP LQRLLQK++
Sbjct: 290 KLEKKKVELMSNLKAISIQYTTLYQEFQNGKKSFYIACARQNPNLQRLLQKTS 342

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 32/51 (62%), Positives = 40/51 (78%)

Query: 30  QGALLQHRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNY 80
           Q A+LQ +QL+EL  KF+ LV E+K VGENT RGKELL+QA KIK +Y N+
Sbjct: 52  QSAMLQQKQLMELVAKFKLLVNEAKKVGENTARGKELLMQAGKIKQIYDNF 102

>KNAG0I00890 Chr9 complement(166573..168099) [1527 bp, 508 aa] {ON}
           Anc_8.323 YDR145W
          Length = 508

 Score =  235 bits (600), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 108/184 (58%), Positives = 137/184 (74%), Gaps = 2/184 (1%)

Query: 369 IFKQSDPLVPISENVTVKAPSPVAYKSNRPTLTGGAAMNASPLNTPAITKLPPYEVDTER 428
           IFK+S+P VPI E++    P+ VAYK NRPT+TGG+ MNA  LNTP   K+P YE DT+R
Sbjct: 323 IFKESEPSVPIPESIDTVQPAQVAYKVNRPTITGGSGMNAPALNTPVNVKIPVYEADTDR 382

Query: 429 VMSKRKLRELVKTVGIDDGDGETVIXXXXXXXXXXXXXXFVTNVTGFACRLAKHRKSDNL 488
           V+SKRKLRELV+TVG+D+GDGETV+              FV++VT FACRLAKHR SD+L
Sbjct: 383 VLSKRKLRELVRTVGVDEGDGETVMDGDVEQLLLDLADDFVSDVTAFACRLAKHRGSDSL 442

Query: 489 DTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDKTNTARNSAAVGG 548
           + RD+QLHLERNWNIR+PGY+ DEIRSTRKWN + +Y+QK+ +I  D+T  A   +A GG
Sbjct: 443 EARDVQLHLERNWNIRLPGYATDEIRSTRKWNGTSAYHQKLNAIAQDRTAAA--GSATGG 500

Query: 549 ASNK 552
           +  K
Sbjct: 501 SVTK 504

 Score =  137 bits (345), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 77/214 (35%), Positives = 117/214 (54%), Gaps = 15/214 (7%)

Query: 36  HRQLLELRTKFQQLVTESKNVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXXXXXXXX 95
            +QL+EL  +F+  V E+K VGE T+ GK+LL++A+KIKAVY +                
Sbjct: 27  QQQLVELAQRFKLFVGEAKRVGETTEAGKQLLVRAAKIKAVYDSVRGASAGAAAQSQQRT 86

Query: 96  NGAAAGGSTPQSAGSGVSTVPAXXXXXXXXXXXXXXXXXXXXXLANIIKQVLTPEQNQQY 155
              A G                                     LA  ++Q LTPEQ QQY
Sbjct: 87  ADGATGN---------------VATAPAAAGGGGGAGNTAATQLAMAMRQALTPEQVQQY 131

Query: 156 DNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELLTNLKSLNM 215
           D +   FQ +  +IRDKHN+L+Q+++ L  EINK+ + +AK+QL +K+ ELL +++ L +
Sbjct: 132 DKIATNFQNKAKSIRDKHNYLKQNIDKLTAEINKQQDRSAKQQLAEKRNELLRSVRQLTV 191

Query: 216 EYSVLRQEFTNGKKKFYVECARHNPALQRLLQKS 249
           E++ L+  F   +K FYVECA+ NP LQ++LQ++
Sbjct: 192 EHNSLKVNFQLSRKNFYVECAKLNPKLQQILQRT 225

>TBLA0H01280 Chr8 complement(287810..289027) [1218 bp, 405 aa] {ON}
           Anc_8.323 YDR145W
          Length = 405

 Score =  130 bits (328), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 82/116 (70%), Gaps = 1/116 (0%)

Query: 422 YEVDTERVMSKRKLRELVKTVGIDDGDGETV-IXXXXXXXXXXXXXXFVTNVTGFACRLA 480
           YE+++ERV+SKRKLRELV++V ID+ D + + I              FV+N+T F+CRL+
Sbjct: 274 YELNSERVLSKRKLRELVRSVSIDEHDEKDLSIDGDVEELLLDMADEFVSNITSFSCRLS 333

Query: 481 KHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRKWNPSQSYNQKMQSINTDK 536
           +HR S+ ++ RDIQLH+ERNWNIR+PG++ADEI+S +KW  S  Y   + S+N  K
Sbjct: 334 RHRNSNMVNKRDIQLHVERNWNIRVPGFNADEIKSAKKWQSSNVYMHYLNSVNLAK 389

 Score = 95.1 bits (235), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 115/216 (53%), Gaps = 12/216 (5%)

Query: 35  QHRQLLELRTKFQQLVTESK-NVGENTQRGKELLLQASKIKAVYTNYSXXXXXXXXXXXX 93
           Q +QL EL   F+ L+ ++K N G+ T++GKELL++A+K+K ++T  S            
Sbjct: 11  QQKQLNELAENFKNLIKDAKLNGGDTTEKGKELLIKATKVKKLFTQLSNKYKN------- 63

Query: 94  XXNGAAAGGSTPQSAGSGVSTVPAXXXXXXXXXXXXXXXXXXXXXLANIIKQVLTPEQNQ 153
             + ++   +  +S  +                            L+ +IK  LTPEQN+
Sbjct: 64  --DSSSNDSTLSRSNSNSSLKNMNTPPSTSSNNSSSTPMVRSNSNLSMMIKNALTPEQNE 121

Query: 154 QYDNLLQTFQTRTNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELLTNLKSL 213
            Y+ LL+ FQ R   I+ +H+ +++ ++ +++ +N KT    ++ L  K+ E L  LK L
Sbjct: 122 SYETLLKDFQIRAAKIKREHSDVKEKIDNISKLLNSKTNN--QEALTAKRNEYLFQLKKL 179

Query: 214 NMEYSVLRQEFTNGKKKFYVECARHNPALQRLLQKS 249
           + +Y+ L Q+F N KK FY++ A+ N  LQ++LQ+S
Sbjct: 180 SKDYTELHQQFQNEKKNFYLKSAKQNSELQKVLQES 215

>TDEL0H01050 Chr8 complement(181351..188019) [6669 bp, 2222 aa] {ON}
            Anc_1.223 YJL130C
          Length = 2222

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 144  KQVLTPEQNQQYDNLLQTFQTR-TNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDK 202
            KQ L P   + Y+   + F T  T +   +H    Q+LE LNQE N+K+E +  + L + 
Sbjct: 1373 KQELLPSVKKLYNMGFKLFATAGTADFISEHGIPVQYLEVLNQEDNEKSEYSLTQHLANN 1432

Query: 203  KMELLTNLKSLN 214
            K++L  NL S N
Sbjct: 1433 KIDLYINLPSAN 1444

>KLLA0E15357g Chr5 (1370741..1377427) [6687 bp, 2228 aa] {ON} highly
            similar to uniprot|P07259 Saccharomyces cerevisiae
            YJL130C URA2 Multifunctional carbamoylphosphate
            synthetase (CPSase)-aspartate transcarbamylase (ATCase)
            that catalyzes the two first reactions of the pyrimidine
            pathway; carbamoyl-phophate synthetase, aspartate
            transcarbamylase, and glutamine amidotransferase
          Length = 2228

 Score = 37.7 bits (86), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)

Query: 144  KQVLTPEQNQQYDNLLQTFQTR-TNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDK 202
            KQ L P   + Y+   + F T  T +   +H    Q+LE LN+E ++K+E +  + L + 
Sbjct: 1371 KQELLPGVKKLYNMGYKLFATAGTADFISEHGIPVQYLEVLNEEDDEKSEYSLTQHLANN 1430

Query: 203  KMELLTNLKSLN 214
            K++L  NL S N
Sbjct: 1431 KIDLYINLPSAN 1442

>KAFR0F02010 Chr6 complement(390679..397314) [6636 bp, 2211 aa] {ON}
            Anc_1.223 YJL130C
          Length = 2211

 Score = 37.0 bits (84), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 144  KQVLTPEQNQQYDNLLQTFQTR-TNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDK 202
            KQ L P   + Y+   + F T  T +   +H    Q+LE LN E N+K+E +  + L + 
Sbjct: 1373 KQELLPSIQKLYNMGYKLFATAGTADFITEHGMAVQYLEVLNSEDNEKSEYSLTQHLANN 1432

Query: 203  KMELLTNLKSLN 214
             ++L  NL S N
Sbjct: 1433 NIDLYINLPSAN 1444

>KLTH0F05874g Chr6 complement(514124..520786) [6663 bp, 2220 aa] {ON}
            highly similar to uniprot|P07259 Saccharomyces cerevisiae
            YJL130C URA2 Multifunctional carbamoylphosphate
            synthetase (CPSase)-aspartate transcarbamylase (ATCase)
            that catalyzes the two first reactions of the pyrimidine
            pathway; carbamoyl-phophate synthetase, aspartate
            transcarbamylase, and glutamine amidotransferase
          Length = 2220

 Score = 34.7 bits (78), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 144  KQVLTPEQNQQYDNLLQTFQTR-TNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDK 202
            KQ + P   + Y+   + F T  T +   +H    Q+LE LN+  ++K+E +  + L + 
Sbjct: 1373 KQEMLPSVKKLYNMGYKLFATAGTADFISEHGIPVQYLEVLNEGDDEKSEYSLTQHLANN 1432

Query: 203  KMELLTNLKSLN 214
            K++L  NL S N
Sbjct: 1433 KIDLYINLPSAN 1444

>Kwal_33.14061 s33 complement(506930..513595) [6666 bp, 2221 aa] {ON}
            YJL130C (URA2) - carbamoyl-phophate synthetase, aspartate
            transcarbamylase, and glutamine amidotransferase [contig
            105] FULL
          Length = 2221

 Score = 34.3 bits (77), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 144  KQVLTPEQNQQYDNLLQTFQTR-TNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDK 202
            KQ + P   + Y+   + F T  T +   +H    Q+LE LN+  ++K+E +  + L + 
Sbjct: 1373 KQEMLPSVKKLYNMGFKLFATAGTADFITEHGIPVQYLEVLNEGDDEKSEYSLTQHLANN 1432

Query: 203  KMELLTNLKSLN 214
            K++L  NL S N
Sbjct: 1433 KIDLYINLPSSN 1444

>TBLA0E04490 Chr5 (1146095..1146526) [432 bp, 143 aa] {ON} Anc_4.297
           YKL192C
          Length = 143

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 28/47 (59%), Gaps = 4/47 (8%)

Query: 469 VTNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRS 515
           VTN T FA    K    D+LDT ++ + +E  ++I IP   AD+++S
Sbjct: 86  VTNETQFA----KDLSLDSLDTVELLVAIEEEFDIEIPDNVADDLKS 128

>Kwal_47.17140 s47 complement(269893..270264) [372 bp, 123 aa] {ON}
           YKL192C (ACP1) - mitochondrial acyl carrier protein
           [contig 212] FULL
          Length = 123

 Score = 31.6 bits (70), Expect = 1.9,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 4/50 (8%)

Query: 469 VTNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRSTRK 518
           +TN T FA    K    D+LDT ++ + +E  ++I IP   ADEI+S ++
Sbjct: 66  ITNDTHFA----KDLGLDSLDTVELLVAIEEEFDIEIPDKVADEIKSVKE 111

>KLTH0D15554g Chr4 (1284597..1284968) [372 bp, 123 aa] {ON} similar
           to uniprot|P32463 Saccharomyces cerevisiae YKL192C ACP1
           Mitochondrial matrix acyl carrier protein involved in
           biosynthesis of octanoate which is a precursor to lipoic
           acid activated by phosphopantetheinylation catalyzed by
           Ppt2p
          Length = 123

 Score = 31.6 bits (70), Expect = 2.1,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 28/47 (59%), Gaps = 4/47 (8%)

Query: 469 VTNVTGFACRLAKHRKSDNLDTRDIQLHLERNWNIRIPGYSADEIRS 515
           +TN T FA    K    D+LDT ++ + +E  ++I IP   ADEI+S
Sbjct: 66  ITNDTHFA----KDLGLDSLDTVELLVAIEEEFDIEIPDKVADEIKS 108

>ZYRO0A06600g Chr1 (535933..538773) [2841 bp, 946 aa] {ON} similar
           to uniprot|P38810 Saccharomyces cerevisiae YHR098C SFB3
           Member of the Sec24p family forms a complex with Sec23p
           that is involved in sorting of Pma1p into COPII vesicles
           peripheral ER membrane protein potential Cdc28p
           substrate
          Length = 946

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 17/54 (31%), Positives = 31/54 (57%), Gaps = 6/54 (11%)

Query: 166 TNNIRDKHNFLEQH------LEGLNQEINKKTEPAAKKQLEDKKMELLTNLKSL 213
           ++NIR+   FL Q+      ++ + Q +     PA +K ++DK +E+LT  K+L
Sbjct: 635 SDNIREVFKFLNQNVAQRIMIKDVVQHLGDCDFPAIRKTIDDKMVEILTQYKAL 688

>SAKL0C06600g Chr3 complement(615551..622213) [6663 bp, 2220 aa] {ON}
            highly similar to uniprot|P07259 Saccharomyces cerevisiae
            YJL130C URA2 Multifunctional carbamoylphosphate
            synthetase (CPSase)-aspartate transcarbamylase (ATCase)
            that catalyzes the two first reactions of the pyrimidine
            pathway; carbamoyl-phophate synthetase, aspartate
            transcarbamylase, and glutamine amidotransferase and
            gnl|GLV|KLLA0E15444g Kluyveromyces lactis
          Length = 2220

 Score = 32.7 bits (73), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 144  KQVLTPEQNQQYDNLLQTFQTR-TNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDK 202
            KQ L P   + Y+   + F T  T +   +H    Q+LE L++   +K+E +  + L + 
Sbjct: 1373 KQELLPSVKKLYNMGYKLFATAGTADFISEHGVPVQYLEVLSENDEQKSEYSLTQHLANN 1432

Query: 203  KMELLTNLKSLN 214
            K++L  NL S N
Sbjct: 1433 KIDLYINLPSAN 1444

>KNAG0C02690 Chr3 complement(520165..526803) [6639 bp, 2212 aa] {ON}
            Anc_1.223 YJL130C
          Length = 2212

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 144  KQVLTPEQNQQYDNLLQTFQTR-TNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDK 202
            KQ L P   + ++   + F T  T +   +HN   Q+LE LN+  ++K+E +  + L + 
Sbjct: 1372 KQELLPSIEKLHNMGYKLFATAGTADFISEHNMPVQYLEVLNKGDDEKSEYSLTQHLANN 1431

Query: 203  KMELLTNLKSLN 214
             ++L  NL S N
Sbjct: 1432 NIDLYINLPSAN 1443

>TDEL0B04120 Chr2 (734500..735543) [1044 bp, 347 aa] {ON} Anc_8.198
           YER149C
          Length = 347

 Score = 31.6 bits (70), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 7/64 (10%)

Query: 168 NIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDKKMELLTNLKSLNMEYSVLRQEFTNG 227
           N+ D   FL+   E ++   N K +P  K QLE       T  K L + +S L ++F N 
Sbjct: 170 NMDDSVEFLKAAFETISTSSNDKQDPMQKDQLE-------TAFKDLQLAHSFLTKQFEND 222

Query: 228 KKKF 231
           + ++
Sbjct: 223 RNEY 226

>Ecym_5206 Chr5 complement(432376..439044) [6669 bp, 2222 aa] {ON}
            similar to Ashbya gossypii ACR263C
          Length = 2222

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 21/72 (29%), Positives = 37/72 (51%), Gaps = 1/72 (1%)

Query: 144  KQVLTPEQNQQYDNLLQTFQTR-TNNIRDKHNFLEQHLEGLNQEINKKTEPAAKKQLEDK 202
            KQ + P   + Y+   + F T  T +   +H    Q+L  LN+  ++K+E +  + L + 
Sbjct: 1369 KQEMLPSVKKLYNMGYKLFATAGTADFIVEHGIPVQYLAFLNEGDDEKSEYSLTQHLANN 1428

Query: 203  KMELLTNLKSLN 214
            K++L  NL S N
Sbjct: 1429 KIDLYINLPSAN 1440

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.126    0.348 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,214,817
Number of extensions: 1407914
Number of successful extensions: 5748
Number of sequences better than 10.0: 83
Number of HSP's gapped: 5979
Number of HSP's successfully gapped: 111
Length of query: 558
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 443
Effective length of database: 40,294,809
Effective search space: 17850600387
Effective search space used: 17850600387
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)