Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F10340g8.321ON81881841030.0
TDEL0F044708.321ON80981719430.0
SAKL0H15598g8.321ON78782917550.0
Suva_10.2208.321ON85484717240.0
Smik_12.1908.321ON85085516840.0
YLR127C (APC2)8.321ON85384416770.0
Skud_12.1968.321ON85484216560.0
Kwal_56.239098.321ON77680814520.0
KLTH0G12342g8.321ON77482013691e-177
TPHA0C008308.321ON84283013191e-169
TBLA0A039208.321ON73272812041e-153
CAGL0M04235g8.321ON78379611481e-144
NCAS0C032808.321ON81185111111e-139
Kpol_YGOB_Anc_8.3218.321ON51152010131e-128
KAFR0H022808.321ON81784610231e-126
Ecym_42528.321ON6897289201e-112
KNAG0G024308.321ON7978399131e-110
AGL193W8.321ON7097068731e-105
NDAI0G026008.321ON9119517763e-89
KLLA0D16324g8.321ON6976764982e-52
AEL284C4.192ON479162910.026
Smik_5.1237.154ON1366146790.97
Skud_15.5417.6ON519158752.6
TDEL0H044507.6ON519155752.7
Smik_15.5567.6ON519158743.5
Smik_13.3976.281ON725130734.2
YOR374W (ALD4)7.6ON519158716.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F10340g
         (818 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {...  1585   0.0  
TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {O...   753   0.0  
SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} simi...   680   0.0  
Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {...   668   0.0  
Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {...   653   0.0  
YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON} ...   650   0.0  
Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {...   642   0.0  
Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {...   563   0.0  
KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} simi...   531   e-177
TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.3...   512   e-169
TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {O...   468   e-153
CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa] ...   446   e-144
NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.3...   432   e-139
Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 5...   394   e-128
KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.3...   398   e-126
Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}...   358   e-112
KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {O...   356   e-110
AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic ho...   340   e-105
NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.3...   303   3e-89
KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]...   196   2e-52
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...    40   0.026
Smik_5.123 Chr5 complement(172159..176259) [4101 bp, 1366 aa] {O...    35   0.97 
Skud_15.541 Chr15 (979046..980605) [1560 bp, 519 aa] {ON} YOR374...    33   2.6  
TDEL0H04450 Chr8 (768317..769876) [1560 bp, 519 aa] {ON} Anc_7.6...    33   2.7  
Smik_15.556 Chr15 (985895..987454) [1560 bp, 519 aa] {ON} YOR374...    33   3.5  
Smik_13.397 Chr13 (631479..633656) [2178 bp, 725 aa] {ON} YMR192...    33   4.2  
YOR374W Chr15 (1039840..1041399) [1560 bp, 519 aa] {ON}  ALD4Mit...    32   6.5  

>ZYRO0F10340g Chr6 complement(837799..840255) [2457 bp, 818 aa] {ON}
           similar to uniprot|Q7LGV7 Saccharomyces cerevisiae
           YLR127C
          Length = 818

 Score = 1585 bits (4103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 771/818 (94%), Positives = 771/818 (94%)

Query: 1   MNAVMRAGEDLKRLLVQIQEVALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKN 60
           MNAVMRAGEDLKRLLVQIQEVALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKN
Sbjct: 1   MNAVMRAGEDLKRLLVQIQEVALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKN 60

Query: 61  SIKMLVNQYYNMELREDERDTGYLFIQLVRQFYVYQVRLHFFASLSNLHTFKDVQRLVKY 120
           SIKMLVNQYYNMELREDERDTGYLFIQLVRQFYVYQVRLHFFASLSNLHTFKDVQRLVKY
Sbjct: 61  SIKMLVNQYYNMELREDERDTGYLFIQLVRQFYVYQVRLHFFASLSNLHTFKDVQRLVKY 120

Query: 121 YEFPLKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVMEDDFDLAMDVV 180
           YEFPLKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVMEDDFDLAMDVV
Sbjct: 121 YEFPLKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVMEDDFDLAMDVV 180

Query: 181 KWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLL 240
           KWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLL
Sbjct: 181 KWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLL 240

Query: 241 LACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLVKSKDFTQ 300
           LACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLVKSKDFTQ
Sbjct: 241 LACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLVKSKDFTQ 300

Query: 301 IVVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERND 360
           IVVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERND
Sbjct: 301 IVVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERND 360

Query: 361 LVTVLLYAILELQSEEFEGPARAYLDTNSLNQLSQELKDPEFGIESSFETIPQADLLSRP 420
           LVTVLLYAILELQSEEFEGPARAYLDTNSLNQLSQELKDPEFGIESSFETIPQADLLSRP
Sbjct: 361 LVTVLLYAILELQSEEFEGPARAYLDTNSLNQLSQELKDPEFGIESSFETIPQADLLSRP 420

Query: 421 ASTATTAAMLDPRLPYKSVIKNFLQWTPEPMDTISKNYSKSLSASRNLLDILMDMFESKD 480
           ASTATTAAMLDPRLPYKSVIKNFLQWTPEPMDTISKNYSKSLSASRNLLDILMDMFESKD
Sbjct: 421 ASTATTAAMLDPRLPYKSVIKNFLQWTPEPMDTISKNYSKSLSASRNLLDILMDMFESKD 480

Query: 481 FFVSEFXXXXXXXXXXXXXXXXXXXWSHCLRLLKTKFXXXXXXXXXXXXXXXXXXXXXXX 540
           FFVSEF                   WSHCLRLLKTKF                       
Sbjct: 481 FFVSEFLSLLTRKLLTLKLYTLDRKWSHCLRLLKTKFGPAGAAAVVATGIGGGDGGSIDG 540

Query: 541 XXXXXPSNINNIDVMLRDVRGSSELCKRMHQVAGLDQRIYPKFISPLYWNRDNSSNGWTF 600
                PSNINNIDVMLRDVRGSSELCKRMHQVAGLDQRIYPKFISPLYWNRDNSSNGWTF
Sbjct: 541 VRGGDPSNINNIDVMLRDVRGSSELCKRMHQVAGLDQRIYPKFISPLYWNRDNSSNGWTF 600

Query: 601 QLDPQMALELDKYCQVYSEIKPGRALHLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQ 660
           QLDPQMALELDKYCQVYSEIKPGRALHLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQ
Sbjct: 601 QLDPQMALELDKYCQVYSEIKPGRALHLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQ 660

Query: 661 QFDASTATTTGLTEQMIGARLQMDPARARAALQHWVQEGVLYYDGNAYKTREYLDDQPAE 720
           QFDASTATTTGLTEQMIGARLQMDPARARAALQHWVQEGVLYYDGNAYKTREYLDDQPAE
Sbjct: 661 QFDASTATTTGLTEQMIGARLQMDPARARAALQHWVQEGVLYYDGNAYKTREYLDDQPAE 720

Query: 721 NLPASKDSSASSQARTMSPDRDSRLTSILEQTWPFIQGMLTNLGALKVKKIHSFLKVTTP 780
           NLPASKDSSASSQARTMSPDRDSRLTSILEQTWPFIQGMLTNLGALKVKKIHSFLKVTTP
Sbjct: 721 NLPASKDSSASSQARTMSPDRDSRLTSILEQTWPFIQGMLTNLGALKVKKIHSFLKVTTP 780

Query: 781 KELGFSMVTPSQLESYLHSLVEEERLICTTNDTYKLPK 818
           KELGFSMVTPSQLESYLHSLVEEERLICTTNDTYKLPK
Sbjct: 781 KELGFSMVTPSQLESYLHSLVEEERLICTTNDTYKLPK 818

>TDEL0F04470 Chr6 complement(837936..840365) [2430 bp, 809 aa] {ON}
           Anc_8.321 YLR127C
          Length = 809

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/817 (48%), Positives = 540/817 (66%), Gaps = 26/817 (3%)

Query: 10  DLKRLLVQIQEVALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKMLVNQY 69
           +L  ++  I+EVALR HP CEDDLE+LLTW+NPNE +SNH  +PP LRLK++IK+ VNQY
Sbjct: 8   ELPVIIDSIKEVALRLHPGCEDDLEALLTWLNPNESESNHHMRPPPLRLKDAIKLFVNQY 67

Query: 70  YN---MELREDERDTG--YLFIQLVRQFYVYQVRLHFFASLSNLHTFKDVQRLVKYYEFP 124
           YN   +   + E + G  +     +RQFY+YQVR+HFF S + + TFKD+QRL KYY  P
Sbjct: 68  YNSGYISGSDGEINKGPEFELGNQLRQFYIYQVRIHFFTSFNLIQTFKDIQRLEKYYVSP 127

Query: 125 LKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVMEDDFDLAMDVVKWLN 184
           L Y+++FE+   EWI ERDGL HYLLNR+ +   N+  R++ L M+DDF+   +++ W+ 
Sbjct: 128 LAYIHLFESSGYEWIIERDGLRHYLLNRNMEFHNNMKQRMESLFMQDDFEYVAEMLDWVE 187

Query: 185 ESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLLLACP 244
           ++++++SS D++LDLI+ K+ +FC D M G +   +L+M+TFN+FI  YWS F  LL CP
Sbjct: 188 KAHTSLSSKDILLDLIIAKVKQFCDDHMMGVYGKTYLVMKTFNKFIIKYWSNFAQLLGCP 247

Query: 245 EDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLVKSKDFTQIVVE 304
           +D+H LT VVY  FE+QF+++RT+E+FDI V  +P+SKPT++E+R+++  S DF  IV+ 
Sbjct: 248 QDDHGLTNVVYTCFEKQFIRIRTQEVFDIFVNEFPNSKPTIIEMRKLITHSTDFKTIVIA 307

Query: 305 FLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERNDLVTV 364
           FLS FE+++LNPS++T +ALLAYVK+VKAFLTLDP+GR L SV +FVK  FQER+DLV +
Sbjct: 308 FLSTFEKKVLNPSVTTTDALLAYVKSVKAFLTLDPSGRYLQSVISFVKQTFQERSDLVVI 367

Query: 365 LLYAILELQSEEFEGPARAYLDTNSLNQLSQELKDPEFGIESSFETIPQADLLSRPASTA 424
           LLYAIL+LQ +   G +   +D   L  L+ EL+DPE GIE+  +  P  +L    A+ A
Sbjct: 368 LLYAILDLQLDGLVG-SHIQVDPVCLKALASELRDPELGIEN--DIYPDDNL----ANVA 420

Query: 425 TTAAMLDPR--LPYKSVIKNFLQWTPEPMDTISKNYSKSLSASRNLLDILMDMFESKDFF 482
           T  A L+    LPY+ V++ FL W P+P D   +  SK   +  +LLDILM++FESKDFF
Sbjct: 421 TGMAKLNYEGCLPYEEVMQRFLSWNPDPRDMAPRAISKQSPSHMSLLDILMELFESKDFF 480

Query: 483 VSEFXXXXXXXXXXXXXXXXXXXWSHCLRLLKTKFXXXXXXXXXXXXXXXXXXXXXXXXX 542
           VSEF                   WS CL+LLK K                          
Sbjct: 481 VSEFLKLLTKRLLSLKFYNLDRNWSKCLQLLKKKLARGAPNISLAPTGQQNNSERGDDY- 539

Query: 543 XXXPSNINNIDVMLRDVRGSSELCKRMHQVAGLDQRIYPKFISPLYWNRDNSSNGWTFQL 602
               SNIN+ DVML DV+ S ELCK+MHQV+GLDQRIYPKFIS LYWN    S    F++
Sbjct: 540 ----SNINSNDVMLWDVKLSYELCKQMHQVSGLDQRIYPKFISYLYWNCQLESKN-DFEI 594

Query: 603 DPQMALELDKYCQVYSEIKPGRALHLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQQF 662
              +  E +KY +VYSE+K GRAL L KDQG++ L L F+DGR  +C+ TLEQ +VIQQF
Sbjct: 595 PEPLNSEFEKYSRVYSEVKAGRALKLLKDQGVIELDLEFKDGRVLQCDVTLEQYAVIQQF 654

Query: 663 DASTATTTGLTEQMIGARLQMDPARARAALQHWVQEGVLYYDGNAYKTREYLDDQPAENL 722
           D  +     L  + I   L M+ +R ++ALQ WV++GVLY     Y T+E   D    N+
Sbjct: 655 DEDSYANR-LMAETISLYLNMEISRVKSALQFWVEKGVLYQVDAFYATQESRQDS---NI 710

Query: 723 PASKDSSASS--QARTMSPDRDSRLTSILEQTWPFIQGMLTNLGALKVKKIHSFLKVTTP 780
             +K  S  S  +      + ++ L+  L   WPF+QGMLTNLG+LK  KIHSFLKVT P
Sbjct: 711 KTAKSDSVGSFFEKNETIIEEETTLSKTLNAIWPFVQGMLTNLGSLKAAKIHSFLKVTVP 770

Query: 781 KELGFSMVTPSQLESYLHSLVEEERLICTTNDTYKLP 817
           KE+G+ +VT SQLESYL+SLVEEERL CTT+ +YKLP
Sbjct: 771 KEVGYIVVTQSQLESYLNSLVEEERLACTTSGSYKLP 807

>SAKL0H15598g Chr8 (1357656..1360019) [2364 bp, 787 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 787

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/829 (43%), Positives = 514/829 (62%), Gaps = 57/829 (6%)

Query: 5   MRAGEDLKRLLVQIQEVALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKM 64
           M +  +++ L  Q++E     +PN ED+L+ +LTW+NPNEP SNHQ +PP+LRLKN IK+
Sbjct: 1   MGSNAEIQELNAQLREFVTTYNPNLEDELDGVLTWLNPNEPNSNHQLRPPSLRLKNGIKL 60

Query: 65  LVNQYYNMELREDERDTGYLFIQLVRQFYVYQVRLHFFASLSNLHTFKDVQRLVKYYEFP 124
           +VN            D    F+ L+RQF + Q R+HFF++ +++ +FKD+QRL KYYEFP
Sbjct: 61  VVNN----------EDVPPGFVHLLRQFVLLQTRIHFFSNFNSITSFKDIQRLEKYYEFP 110

Query: 125 LKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVMEDDFDLAMDVVKWLN 184
           LKY+ IF   P+EW  E +G  HYL+++++    N+  R++ L+MEDDFD+A  +  WL 
Sbjct: 111 LKYINIF--TPDEWFIEMNGFRHYLMSKNRIFGDNIKHRVRQLIMEDDFDMAWKIYTWLT 168

Query: 185 ESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLLLACP 244
           E+  +   + L+L+++++KI+ F +  M G W  RFL+METFN FIT YWS F   L CP
Sbjct: 169 ETMGH-QLVSLLLEILMDKIADFSKQNMMGKWTQRFLVMETFNTFITKYWSTFAQALRCP 227

Query: 245 EDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLVKSKDFTQIVVE 304
           ED+HE+TT ++H FE++FVK+RT EI++I V  YP SKP LLELR V+  S D++++++E
Sbjct: 228 EDDHEITTEIFHCFEKEFVKIRTSEIYEICVLEYPHSKPALLELRNVMKTSADYSKLMIE 287

Query: 305 FLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERNDLVTV 364
           FLS FE +++NPS++T   LL+Y++T+K+FLT+DP GR L SV+A++KPY +ER D V  
Sbjct: 288 FLSKFESKLMNPSVTTTEILLSYIRTIKSFLTVDPAGRYLQSVTAYIKPYLRERRDTVVH 347

Query: 365 LLYAILELQSEEFEGPARAYLDTNSLNQLSQELKDPEFGIESSFETIPQADLLSRPASTA 424
           LLYA+LEL   E +  A   L+   L +LS+ELKDP+FGIE        AD  SR     
Sbjct: 348 LLYAMLELDESEIDD-ANVSLNMPILTELSKELKDPDFGIED-------ADSKSRKNKLM 399

Query: 425 TT--AAMLDPRLPY-KSVIKNFLQWTPEPMDTISKNYSKSLSASRNLLDILMDMFESKDF 481
            T  + +     P  + V+  FLQWTPEP D   +  + +   +++LLDIL+D+F+SKD 
Sbjct: 400 VTDSSPVFKVEKPLCEQVLNYFLQWTPEPSDVAHRKPNNTF-VNKSLLDILLDIFDSKDV 458

Query: 482 FVSEFXXXXXXXXXXXXXXXXXXXWSHCLRLLKTKFXXXXXXXXXXXXXXXXXXXXXXXX 541
           F+SEF                   W   LRLLK KF                        
Sbjct: 459 FISEFLSLFTKKLLGLKYYKLETKWIKILRLLKKKFGHTSFPQHQFQDT----------- 507

Query: 542 XXXXPSNINNIDVMLRDVRGSSELCKRMHQVAGLDQRIYPKFISPLYWNRDNSSNGWTFQ 601
                SNINNID+MLRDV+ S EL  +MH+VAGLD R++PKFIS L+WN    +    FQ
Sbjct: 508 -----SNINNIDIMLRDVKTSYELISKMHEVAGLDDRVFPKFISYLFWNSALEAETSDFQ 562

Query: 602 LDPQMALELDKYCQVYSEIKPGRALHLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQQ 661
           L   +  E++KY +VYS++KPGR LHLYKDQG V L L F+DGRK  CE  L + +VI  
Sbjct: 563 LPGWLETEIEKYSEVYSQLKPGRRLHLYKDQGTVELDLEFKDGRKISCEVPLNKAAVISC 622

Query: 662 FDASTATTTGLTEQMIGARLQMDPARARAALQHWVQEGVLYYDG--NAYKTREYLDDQPA 719
           FD  TA   GL  + I   ++M+ A   + LQ W ++  +YYD   N Y+  EY   +P 
Sbjct: 623 FDQDTA-LKGLAVEQIVDNVKMEKALVTSILQFWCKKNAIYYDDRYNTYRVLEYY--EPN 679

Query: 720 ENLPASK-DSSASSQARTMSP--DRDS-------RLTSILEQTWPFIQGMLTNLGALKVK 769
             L AS   SS  +    ++P  D+D+            + + WPFIQGMLTNLG++K +
Sbjct: 680 SALSASTVISSKGNTNGGINPMDDQDNAGDKQQQEFIQSMSKIWPFIQGMLTNLGSMKPE 739

Query: 770 KIHSFLKVTTPKELGFSMVTPSQLESYLHSLVEEERLICTTNDTYKLPK 818
           KIHSFLK+  PK++G++  T +QLESYL+ LV+E++L    N +YKL K
Sbjct: 740 KIHSFLKMAVPKDIGYT-ATVNQLESYLNVLVDEDKLAAVPNGSYKLVK 787

>Suva_10.220 Chr10 complement(404296..406860) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/847 (43%), Positives = 512/847 (60%), Gaps = 46/847 (5%)

Query: 10  DLKRLLVQIQEVALRT-HPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKML--- 65
           DLK +  ++Q ++    H N  DDL SLL W++P++P+SNHQ +PP+LR+KN IK L   
Sbjct: 10  DLKIITDELQTLSSYIFHTNITDDLNSLLIWMSPDDPKSNHQLRPPSLRIKNIIKNLFPN 69

Query: 66  ---VNQYYNMELRE------DERDTG----YLFIQLVRQFYVYQVRLHFFASLSNLHTFK 112
               + Y  M   +      +E +T       FI   +++Y++QVR HFF   S+++  K
Sbjct: 70  NACTSSYGAMNTAQANNSIVNEGNTNKELQLQFISTFKEYYIFQVRYHFFLHFSSINYLK 129

Query: 113 DVQRLVKYYEFPLKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVMEDD 172
           D+QR   YYEFPL+YV IF+     W  E + L HYLLNR+ K + N+ +RL  L+++DD
Sbjct: 130 DIQRWENYYEFPLRYVSIFDLNVNGWTLELNSLRHYLLNRNTKFKNNLRTRLNKLIIDDD 189

Query: 173 FDLAMDVVKWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITS 232
           FDLA ++++WLN +N ++SSMDL+++ + +KIS FC+  M+G WN RF+IMETFN+FI  
Sbjct: 190 FDLASNLIRWLNSANGSLSSMDLIVNALFDKISMFCEINMSGVWNKRFMIMETFNKFINQ 249

Query: 233 YWSQFCLLLACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVL 292
           YWSQF  L+ CPED+HELTT V++ FE  F+++RTKEIFDI V  YP SK TLLEL++++
Sbjct: 250 YWSQFSELIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPGSKITLLELKKIM 309

Query: 293 VKSKDFTQIVVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVK 352
              KD+T IV  FLS+F++ ILNPSI+TV+ALL+YVKT+KAFL LDPTGRCL+S++ FVK
Sbjct: 310 KDFKDYTNIVTTFLSDFKKHILNPSITTVDALLSYVKTIKAFLVLDPTGRCLHSITTFVK 369

Query: 353 PYFQERNDLVTVLLYAILELQSEEFEGPARAYLDTNSLNQLSQELKDPEFG-IESSFETI 411
           PYFQER  LV VLLYAIL+L  EE +      +D  +L  L + L D +   I ++ ++ 
Sbjct: 370 PYFQERKHLVNVLLYAILDLPEEELKEKISFKVDMKALLLLVETLHDSDIDQITNTPKSK 429

Query: 412 PQADLLSRP------------ASTATTAAMLDPRLPYKSVIKNFLQWTPEPMDTISKNYS 459
            +    S P             S++ T +ML     Y+ ++  +L W PEP D I  N  
Sbjct: 430 DKNKGGSFPWNLHVKGKKEKNGSSSITQSML-----YEHILNYYLTWVPEPNDMIPGNI- 483

Query: 460 KSLSASRNLLDILMDMFESKDFFVSEFXXXXXXXXXXXXXXXXXXXWSHCLRLLKTKFXX 519
           KS S   NL ++L+D+FES++FF+SEF                   WS CL+L++ K   
Sbjct: 484 KSSSIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYKLDNKWSRCLKLIREKIVK 543

Query: 520 XXXXXXXXXXXXXXXXXXXXXXXXXXP--SNINNIDVMLRDVRGSSELCKRMHQVAGLDQ 577
                                        SNIN+IDVML D++ S ELC +MH+VAGLD 
Sbjct: 544 STETNQTNYIANGIIGLPQTTAPAADADLSNINSIDVMLWDIKCSEELCLKMHEVAGLDP 603

Query: 578 RIYPKFISPLYWNRD---NSSNGWTFQLDPQMALELDKYCQVYSEIKPGRALHLYKDQGI 634
            IYPKFIS LYW  +   N++N  TF L   +  EL KY  +YS++KPGR L L KDQG 
Sbjct: 604 AIYPKFISLLYWKHNGDTNNANELTFHLPGNLENELQKYSDIYSQLKPGRKLQLCKDQGK 663

Query: 635 VVLTLSFQDGRKKRCEATLEQCSVIQQFDASTATTTGLTEQMIGARLQMDPARARAALQH 694
           + + L F DGRK   + +LEQCSVI QF+++      L+ + +   L + PAR    L  
Sbjct: 664 IEMELDFNDGRKLVLDVSLEQCSVINQFNSTDGEPIYLSLEQLSEPLNIAPARLLDLLNF 723

Query: 695 WVQEGVLYYDGNAYKTREYLD---DQPAENLPASKDSSASSQARTMSPDRDSRLTSILEQ 751
           W+Q GVL  +   Y   EY     +Q     P   +++ +        +R   L  ILE+
Sbjct: 724 WIQRGVLSEENGVYSVIEYSRTDFNQTQIEFPMKNENNNNELRDETEVERKCEL--ILER 781

Query: 752 TWPFIQGMLTNLGALKVKKIHSFLKVTTPKELGFSMVTPSQLESYLHSLVEEERLICTTN 811
           + PFI+GML NLGA+K+ KIHSFLK+T PK  G++ +T  QLE YL+ L +E +L   TN
Sbjct: 782 SLPFIEGMLANLGAMKLNKIHSFLKITVPKNWGYNRITLLQLEKYLNVLADEGKLKYITN 841

Query: 812 DTYKLPK 818
            +Y+L K
Sbjct: 842 GSYELEK 848

>Smik_12.190 Chr12 complement(377110..379662) [2553 bp, 850 aa] {ON}
           YLR127C (REAL)
          Length = 850

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/855 (41%), Positives = 512/855 (59%), Gaps = 48/855 (5%)

Query: 1   MNAVMRAGEDLKRLLVQIQEVALRT-HPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLK 59
           M+  +    DLK +  ++Q ++    H    DDL SLL W +PN+P+SNHQ +PP+LR+K
Sbjct: 1   MSYQIAPTRDLKVITDELQTLSSYIFHTTIADDLNSLLIWTSPNDPKSNHQLRPPSLRIK 60

Query: 60  NSIKML--------------VNQYYNMELREDE--RDTGYLFIQLVRQFYVYQVRLHFFA 103
           N IK+L                Q  N  + E    ++     +  ++++Y++QVR HFF+
Sbjct: 61  NIIKVLFPNSASTSPYSVVNTGQTSNSIVNEGNTNKELQLQLLSTLKEYYIFQVRYHFFS 120

Query: 104 SLSNLHTFKDVQRLVKYYEFPLKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSR 163
              N++  KD+QR   YYEFPL+YV IF+     W  E + L HYLLNR+ K + N+ +R
Sbjct: 121 HFENINYLKDIQRWENYYEFPLRYVPIFDLDINGWSLELNSLRHYLLNRNMKFKNNLRTR 180

Query: 164 LKDLVMEDDFDLAMDVVKWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIM 223
           L  L+M+DDFDLA ++++WLN ++ ++SSM+L+++ +  KI++FC+D M+G WN RF+IM
Sbjct: 181 LDKLIMDDDFDLADNLIQWLNSADGSLSSMELIVNALFNKINKFCEDTMSGVWNKRFMIM 240

Query: 224 ETFNRFITSYWSQFCLLLACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKP 283
           ETFN+FI  YWSQF  L+ CPED+HELTT V++ FE  F+++RTKEIFDI V  YP+SK 
Sbjct: 241 ETFNKFINQYWSQFSKLIGCPEDDHELTTTVFNCFESNFLRIRTKEIFDICVLAYPNSKV 300

Query: 284 TLLELRRVLVKSKDFTQIVVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRC 343
           TLLEL++++   KD+  IV  FLS+F++ ILNPSI+TV+ALL YVKT+KAFL LDPTGRC
Sbjct: 301 TLLELKKIMKDFKDYANIVTTFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRC 360

Query: 344 LNSVSAFVKPYFQERNDLVTVLLYAILELQSEEFEGPARAYLDTNSLNQLSQELKDPEFG 403
           L+S++ FVKPYFQER  LV +LLYA+L+L  EE +      +D  +L  L   L D +  
Sbjct: 361 LHSITTFVKPYFQERKHLVDLLLYAMLDLPEEELKEKITFKVDIKALISLVDTLHDSDI- 419

Query: 404 IESSFETIPQAD------------LLSRPASTATTAAMLDPRLPYKSVIKNFLQWTPEPM 451
             S F  + + +            +  +   + T+  M+     Y+ ++  +L W PEP 
Sbjct: 420 --SQFTNVMKRNKNKKGPFLWNLKVKGKNGPSPTSQTMI-----YQHILNYYLTWVPEPN 472

Query: 452 DTISKNYSKSLSASRNLLDILMDMFESKDFFVSEFXXXXXXXXXXXXXXXXXXXWSHCLR 511
           D I  +  KS     NL ++L+D+FES++FF+SEF                   W+ CL+
Sbjct: 473 DMIPGSV-KSSCIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYKLDDKWTQCLK 531

Query: 512 LLKTKFXXXXXXXXXXXXXXXXXX--XXXXXXXXXXPSNINNIDVMLRDVRGSSELCKRM 569
           L++ K                                SN+N+IDVML D++ S ELC++M
Sbjct: 532 LIREKVVKFRETSHVNYITNGILGLPETTAPSADADQSNLNSIDVMLWDIKCSEELCRKM 591

Query: 570 HQVAGLDQRIYPKFISPLYWNRD---NSSNGWTFQLDPQMALELDKYCQVYSEIKPGRAL 626
           H+VAGLD  I+PKFIS LYW  +    SSN  TF L   +  EL KY  VYS++KPGR L
Sbjct: 592 HEVAGLDPAIFPKFISLLYWKYNCDMQSSNELTFHLPIHLKKELQKYSDVYSQLKPGRKL 651

Query: 627 HLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQQFDASTATTTGLTEQMIGARLQMDPA 686
            L KDQG V + L+F+DGRK   + +LEQCSVI QFD++   +  LT + +   L + P 
Sbjct: 652 QLCKDQGKVEIELNFKDGRKLVLDVSLEQCSVINQFDSTDNKSISLTLEQLSDSLNITPP 711

Query: 687 RARAALQHWVQEGVLYYDGNAYKTREYLD---DQPAENLPASKDSSASSQARTMSPDRDS 743
           R    L  W+Q+GV+  +   Y   E  +   D+  +++P   +++          +R  
Sbjct: 712 RLVHLLDFWIQKGVISKENGVYSVIENCETDFDKVHKDIPMETENNNRGLRNESEAERKC 771

Query: 744 RLTSILEQTWPFIQGMLTNLGALKVKKIHSFLKVTTPKELGFSMVTPSQLESYLHSLVEE 803
            LT  L+++ PFI+GML NLGA+K+ KIHSFLK+T PK+ G++ V+  QLE YL +L +E
Sbjct: 772 ELT--LQRSLPFIEGMLANLGAMKLNKIHSFLKITVPKDWGYNRVSLQQLEQYLSALADE 829

Query: 804 ERLICTTNDTYKLPK 818
            RL    N +Y++ K
Sbjct: 830 GRLKYIANGSYEIVK 844

>YLR127C Chr12 complement(395758..398319) [2562 bp, 853 aa] {ON}
           APC2Subunit of the Anaphase-Promoting Complex/Cyclosome
           (APC/C), which is a ubiquitin-protein ligase required
           for degradation of anaphase inhibitors, including
           mitotic cyclins, during the metaphase/anaphase
           transition; component of the catalytic core of the
           APC/C; has similarity to cullin Cdc53p
          Length = 853

 Score =  650 bits (1677), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/844 (41%), Positives = 505/844 (59%), Gaps = 41/844 (4%)

Query: 10  DLKRLLVQIQEVALRT-HPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIK----- 63
           DLK +  ++Q ++    H N  DDL SLLTW++PN+ +SNHQ +PP+LR+KN IK     
Sbjct: 10  DLKVITDELQTLSSYIFHTNIVDDLNSLLTWMSPNDAKSNHQLRPPSLRIKNIIKVLFPN 69

Query: 64  --------MLVNQYYNMELREDERDTGYLFIQL---VRQFYVYQVRLHFFASLSNLHTFK 112
                   M+     N  +  +      L +QL   +++FY++QVR HFF   +N++  K
Sbjct: 70  NATTSPYSMINTSQANNSIVNEGNTNKELQLQLFSTLKEFYIFQVRYHFFLHFNNINYLK 129

Query: 113 DVQRLVKYYEFPLKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVMEDD 172
           D+QR   YYEFPL+YV IF+    +W  E + L HYLLNR+ K + N+ +RL  L+M+DD
Sbjct: 130 DIQRWENYYEFPLRYVPIFDVNVNDWALELNSLRHYLLNRNIKFKNNLRTRLDKLIMDDD 189

Query: 173 FDLAMDVVKWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITS 232
           FDLA ++++WL  +N ++SS +L+++ +  KI++FC+D M+  WN RF+IMETFN+FI  
Sbjct: 190 FDLADNLIQWLKSANGSLSSTELIVNALYSKINKFCEDNMSRVWNKRFMIMETFNKFINQ 249

Query: 233 YWSQFCLLLACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVL 292
           YWSQF  L+ CPED+HELTT V++ FE  F+++RT EIFDI V  YPDSK TLLELR+++
Sbjct: 250 YWSQFSKLVGCPEDDHELTTTVFNCFESNFLRIRTNEIFDICVLAYPDSKVTLLELRKIM 309

Query: 293 VKSKDFTQIVVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVK 352
              KD+T IV  FLS+F++ ILNPS++TV+ALL YVKT+KAFL LDPTGRCL+S++ FVK
Sbjct: 310 KDFKDYTNIVTTFLSDFKKYILNPSVTTVDALLRYVKTIKAFLVLDPTGRCLHSITTFVK 369

Query: 353 PYFQERNDLVTVLLYAILELQSEEFEGPARAYLDTNSLNQLSQELKDPEFGIESSFETIP 412
           PYFQER  LV VLLYA+L+L  EE +      +D  +L  L   L D +   +++   I 
Sbjct: 370 PYFQERKHLVNVLLYAMLDLPEEELKEKINFNVDMKALLSLVDTLHDSDINQDTN---IT 426

Query: 413 QADLLSRPAS----TATTAAMLDPRLP------YKSVIKNFLQWTPEPMDTISKNYSKSL 462
           + D   +              L+  LP      Y+ ++  ++ W PEP D I  N  KS 
Sbjct: 427 KRDKNKKSPFLWNLKVKGKRELNKDLPIRHAMLYEHILNYYIAWVPEPNDMIPGNI-KSS 485

Query: 463 SASRNLLDILMDMFESKDFFVSEFXXXXXXXXXXXXXXXXXXXWSHCLRLLKTKFXXXXX 522
               NL ++L+D+FES++FF+SEF                   W+ CL+L++ K      
Sbjct: 486 YIKTNLFEVLLDLFESREFFISEFRNLLTDRLFTLKFYTLDEKWTRCLKLIREKIVKFTE 545

Query: 523 XXXXXXXXXXXXXXXXXXXXXXXP--SNINNIDVMLRDVRGSSELCKRMHQVAGLDQRIY 580
                                     SN+N+IDVML D++ S ELC++MH+VAGLD  I+
Sbjct: 546 TSHSNYITNGILGLLETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPIIF 605

Query: 581 PKFISPLYWNRD---NSSNGWTFQLDPQMALELDKYCQVYSEIKPGRALHLYKDQGIVVL 637
           PKFIS LYW  +     SN   F L   +  EL KY  +YS++KPGR L L KD+G V +
Sbjct: 606 PKFISLLYWKYNCDTQGSNDLAFHLPIDLERELQKYSDIYSQLKPGRKLQLCKDKGKVEI 665

Query: 638 TLSFQDGRKKRCEATLEQCSVIQQFDASTATTTGLTEQMIGARLQMDPARARAALQHWVQ 697
            L+F+DGRK   + +LEQCSVI QFD+       L+ + +   L + P R    L  W+Q
Sbjct: 666 QLAFKDGRKLVLDVSLEQCSVINQFDSPNDEPICLSLEQLSESLNIAPPRLTHLLDFWIQ 725

Query: 698 EGVLYYDGNAYKTREYLD---DQPAENLPASKDSSASSQARTMSPDRDSRLTSILEQTWP 754
           +GVL  +   Y   E+ +   DQ  +  P   ++S          +R   LT  L+++ P
Sbjct: 726 KGVLLKENGTYSVIEHSEMDFDQAQKTAPMEIENSNYELHNDSEIERKYELT--LQRSLP 783

Query: 755 FIQGMLTNLGALKVKKIHSFLKVTTPKELGFSMVTPSQLESYLHSLVEEERLICTTNDTY 814
           FI+GMLTNLGA+K+ KIHSFLK+T PK+ G++ +T  QLE YL++L +E RL    N +Y
Sbjct: 784 FIEGMLTNLGAMKLHKIHSFLKITVPKDWGYNRITLQQLEGYLNTLADEGRLKYIANGSY 843

Query: 815 KLPK 818
           ++ K
Sbjct: 844 EIVK 847

>Skud_12.196 Chr12 complement(378532..381096) [2565 bp, 854 aa] {ON}
           YLR127C (REAL)
          Length = 854

 Score =  642 bits (1656), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/842 (41%), Positives = 510/842 (60%), Gaps = 36/842 (4%)

Query: 10  DLKRLLVQIQEVALRT-HPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKML--- 65
           DLK +  Q+Q ++    H N  DDL SLL W++PN+P+SNHQ +PP+LR+KN IK+L   
Sbjct: 10  DLKVITDQLQTLSSYVFHTNIADDLNSLLIWMSPNDPKSNHQLRPPSLRIKNIIKVLFPN 69

Query: 66  ---------VNQYYNMELREDERDTGY-LFIQLV---RQFYVYQVRLHFFASLSNLHTFK 112
                    +N    +     E +T   L +QL+   +++YV+QVR HFF   +++   K
Sbjct: 70  NVSTSSYGVINSGQTINAVAGEGNTNKELQLQLLSTLKEYYVFQVRYHFFLRFNDIIYLK 129

Query: 113 DVQRLVKYYEFPLKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVMEDD 172
           D+QR   YYEFPL+YV IF+    +W  E + L HY+LNR+ K + N+  RL  L+M+DD
Sbjct: 130 DIQRWENYYEFPLRYVPIFDLSVNDWSLELNSLRHYMLNRNIKFKNNLRVRLNKLIMDDD 189

Query: 173 FDLAMDVVKWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITS 232
           FDLA ++++WLN +N ++SSM+L+++ +  KI +FC+  M+G WN RF+IMETFN+FI  
Sbjct: 190 FDLAGNLIRWLNFANGSLSSMELIVNALFNKIEKFCEANMSGVWNKRFMIMETFNKFINQ 249

Query: 233 YWSQFCLLLACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVL 292
           YWSQFC L+ CPED+HELTT V++ FE  F+++RT+EIFDI V  YPDSK  LLEL++++
Sbjct: 250 YWSQFCELICCPEDDHELTTTVFNCFESNFLRIRTREIFDICVLAYPDSKVALLELKKIM 309

Query: 293 VKSKDFTQIVVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVK 352
              KD+T IV +FLS+F++ ILNPSI+TV+ALL YVKT+KAFL LDPTGRCL+S+  FVK
Sbjct: 310 KDFKDYTNIVTKFLSDFKKYILNPSITTVDALLRYVKTIKAFLVLDPTGRCLHSIITFVK 369

Query: 353 PYFQERNDLVTVLLYAILELQSEEFEGPARAYLDTNSLNQLSQELKDPEFG----IESSF 408
           PYFQER  LV VLLYA+L+L  EE +      +D  +L  L   L D + G       S 
Sbjct: 370 PYFQERKHLVNVLLYAMLDLPEEELKEKITFKVDMKALLSLVDILHDYDIGQNTDAHKSK 429

Query: 409 ETIPQADLLSRPASTATTAAMLDP----RLPYKSVIKNFLQWTPEPMDTISKNYSKSLSA 464
           +   ++  L             DP     + Y+ V+ ++L W PEP D I  +  KS   
Sbjct: 430 DKNKRSPFLWNLKVKGKKETNEDPLARQTMLYEHVLNHYLTWVPEPNDIIPGSV-KSSYI 488

Query: 465 SRNLLDILMDMFESKDFFVSEFXXXXXXXXXXXXXXXXXXXWSHCLRLLKTKFXXXXXXX 524
             NL +IL+D+FES++FF+SEF                   WS CL+L++ +        
Sbjct: 489 KTNLFEILLDLFESREFFISEFRNLLTDRLSSLKFYKLDDKWSQCLKLIRERIVKFTETN 548

Query: 525 XXXXXXXXXXX--XXXXXXXXXXPSNINNIDVMLRDVRGSSELCKRMHQVAGLDQRIYPK 582
                                   SN+N+IDVML D++ S ELC++MH+VAGLD  ++PK
Sbjct: 549 HANYITNGILGLPETTAPAADADQSNLNSIDVMLWDIKCSEELCRKMHEVAGLDPTVFPK 608

Query: 583 FISPLYWNRDNSSNG---WTFQLDPQMALELDKYCQVYSEIKPGRALHLYKDQGIVVLTL 639
           FIS LYW  +  +       F++   +  EL KY  +YS++KPGR L L KDQG V + L
Sbjct: 609 FISLLYWKHNGDTQNPKDSKFRIPADLERELQKYSDIYSQMKPGRRLQLCKDQGKVEMEL 668

Query: 640 SFQDGRKKRCEATLEQCSVIQQFDASTATTTGLTEQMIGARLQMDPARARAALQHWVQEG 699
           SF+DGRK   + +LEQ SV+ QF+++      L+ + +   L +  ++    L  W+Q+G
Sbjct: 669 SFRDGRKLVLDVSLEQYSVMNQFNSTNDEPINLSLKQLSESLNITTSKLLQLLNFWIQKG 728

Query: 700 VLYYDGNAYKTREYLDDQPAENLP--ASKDSSASSQARTMSP-DRDSRLTSILEQTWPFI 756
           VL  +G  Y   EY D   ++       K+ + +++ R  S  ++   LT  L+++ PFI
Sbjct: 729 VLSEEGEVYSVIEYSDTGFSQTQKDVLMKNVNNNNELRDESEVEKKCELT--LQRSLPFI 786

Query: 757 QGMLTNLGALKVKKIHSFLKVTTPKELGFSMVTPSQLESYLHSLVEEERLICTTNDTYKL 816
           +GML NLGA+K+ KIHSFLK+T PK+ G++ +T  QLE YL++L +E +L    N +Y++
Sbjct: 787 EGMLANLGAMKLNKIHSFLKITVPKDWGYNRITLLQLEKYLNTLTDEGKLKYIANGSYEI 846

Query: 817 PK 818
            K
Sbjct: 847 AK 848

>Kwal_56.23909 s56 complement(771248..773578) [2331 bp, 776 aa] {ON}
           YLR127C (APC2) - subunit of the anaphase promoting
           complex (APC) [contig 171] FULL
          Length = 776

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/808 (39%), Positives = 464/808 (57%), Gaps = 53/808 (6%)

Query: 17  QIQEVALRTHP-NCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKMLVNQYYNMELR 75
           Q+ E+ LR H    +DDLES+LTWINPNEP SNHQ +PP+LRLK++IK+L+N        
Sbjct: 13  QLHEL-LRGHDITVDDDLESVLTWINPNEPTSNHQLRPPSLRLKSAIKILIN-------- 63

Query: 76  EDERDTGYLFIQLVRQFYVYQVRLHFFASLSNLHTFKDVQRLVKYYEFPLKYVYIFENCP 135
             E   G     ++RQ+ ++Q R HFFA   +L  FKDVQ+L +YYEFPL++V +F    
Sbjct: 64  --ENGNGPALTDILRQYLIFQTRKHFFAHYYSLCHFKDVQKLERYYEFPLRFVRLFNR-- 119

Query: 136 EEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVMEDDFDLAMDVVKWLNESNSNVSSMDL 195
           EEW  E +GL +YL++++     N   RL+ LV+EDDF++A  + +WL  +   + +  L
Sbjct: 120 EEWAEEINGLRNYLISKNLVFNRNARLRLRQLVLEDDFEMACKLYEWLCRAEGRLLT-HL 178

Query: 196 MLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLLLACPEDNHELTTVVY 255
           ++D ++ K+  F    M   W+ RF+ +E +N FI+ YWS    +L CPED+H++T  +Y
Sbjct: 179 LVDAVLSKVKAFALKHMEEAWSKRFVTVELYNLFISKYWSTLSQMLQCPEDDHDVTNEIY 238

Query: 256 HLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLVKSKDFTQIVVEFLSNFERQILN 315
             FE +F+++RT++ F I V  YP+S+PTLLELR VL     +TQ+V E LS FE ++LN
Sbjct: 239 RCFEEEFIRIRTQQAFKIFVTGYPESEPTLLELRSVLKTPAKYTQLVTELLSQFEARMLN 298

Query: 316 PSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERNDLVTVLLYAILELQSE 375
           PSI+T   LL+YVK +K+ LT+D + R    ++ FV+P+  ER D V   LYA+L L + 
Sbjct: 299 PSITTAEILLSYVKAIKSILTIDVSFRYFQLLTDFVRPFLMERRDTVVTFLYAMLGLDAS 358

Query: 376 EFEGPARAYLDTNSLNQLSQELKDPEFGIESSFETIPQADLLSRPASTATTAAMLDPRLP 435
           E  GP       +  +QLS ELKD       S + I ++ L     S     A ++P+ P
Sbjct: 359 ETRGPKPTGAHASIASQLSAELKD-------SHQPIFRSALDKSAQSPVDDMASVNPKEP 411

Query: 436 -YKSVIKNFLQWTPEPMDTISKNYSKSLSASRNLLDILMDMFESKDFFVSEFXXXXXXXX 494
            Y+ VI  +L WTPEP D+I  N S +L  ++ L DI++++F+SKD  + EF        
Sbjct: 412 VYQQVINFYLHWTPEPSDSIQANNSDTL-MNKGLFDIIVELFDSKDIIIGEFLTLFTDKL 470

Query: 495 XXXXXXXXXXXWSHCLRLLKTKFXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSNINNIDV 554
                      W   L++LK +F                             SNINNIDV
Sbjct: 471 LDLKGYRLEQNWVKSLKILKNRFDFKNYSNAQGV------------------SNINNIDV 512

Query: 555 MLRDVRGSSELCKRMHQVAGLDQRIYPKFISPLYWNRDN--SSNGWTFQLDPQMALELDK 612
           MLRDV+ S ELC +MH V  + + + P FIS L+WN  +  S+     +L  Q+  E+ K
Sbjct: 513 MLRDVKHSEELCAQMHSVPEISREVIPMFISYLFWNAGSKFSTLPKDCRLPSQLESEIRK 572

Query: 613 YCQVYSEIKPGRALHLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQQFDASTATTTGL 672
           Y  +Y++IKPGR L L+++Q  VVL L F D R    E ++++ SV+    A  A TTG+
Sbjct: 573 YKDMYAQIKPGRKLRLHQEQSTVVLQLHFADKRVMDFEVSMDKSSVL----ACVAETTGI 628

Query: 673 TEQMIGARLQMDPARARAALQHWVQEGVLYYDGNA--YKTREYLDDQPAENLPASKDSSA 730
           +   I     ++ A+    L+ W+   VL +D     Y + E  D   A    A     A
Sbjct: 629 SRDKIVEATGLEKAQVDQNLRFWLDASVLRFDSKTSLYSSLERQDTDNASEREAQM--RA 686

Query: 731 SSQARTMSPDRDSRLTSILEQTWPFIQGMLTNLGALKVKKIHSFLKVTTPKELGFSMVTP 790
             QAR+    +  +    +E+ WPFI+GMLTNLG LKV+KIHSFLKV  PKE+GF+  T 
Sbjct: 687 EDQARSAFDSQQQQFVESMEKVWPFIRGMLTNLGTLKVEKIHSFLKVAVPKEIGFNATT- 745

Query: 791 SQLESYLHSLVEEERLICTTNDTYKLPK 818
           +QLE+YL  LV+E +L+C+ N+ +KL K
Sbjct: 746 AQLEAYLRLLVDENKLVCSANNAFKLVK 773

>KLTH0G12342g Chr7 (1048457..1050781) [2325 bp, 774 aa] {ON} similar
           to uniprot|Q7LGV7 Saccharomyces cerevisiae YLR127C
          Length = 774

 Score =  531 bits (1369), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 299/820 (36%), Positives = 461/820 (56%), Gaps = 52/820 (6%)

Query: 5   MRAGEDLKRLLVQIQEVALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKM 64
           M   ++ + L  Q+  +      + EDDLE +LTW+NPNEP SNHQ +PP+LR+K++IK 
Sbjct: 1   MTLSDEGRELSEQLHSLLHDVDSSLEDDLEGILTWVNPNEPGSNHQMRPPSLRVKSAIKS 60

Query: 65  LVNQYYNMELREDERDTGYLFIQLVRQFYVYQVRLHFFASLSNLHTFKDVQRLVKYYEFP 124
           L+N     E           FI L+ ++ ++Q R HFF +  +L  FKDVQ+L +YYEFP
Sbjct: 61  LLNGVVTSES----------FIDLLGKYMIFQTRKHFFLNYQSLLYFKDVQKLERYYEFP 110

Query: 125 LKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVMEDDFDLAMDVVKWLN 184
            +YV IF +  EEW  E  GL +YL+ ++  L+ N+  RL+ LV EDDFD+A  + +WL 
Sbjct: 111 TRYVNIFSS--EEWCDEMSGLRNYLIRQNSGLKNNIQLRLEQLVHEDDFDMACKIYEWLC 168

Query: 185 ESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLLLACP 244
           ++   +   ++++D+++ K+  F    M   W  RF IME +N F+T+YWS FC +L C 
Sbjct: 169 QAEGRLLP-EILVDVLLSKVKLFASKNMNSAWTQRFTIMEAYNLFVTNYWSVFCRMLQCM 227

Query: 245 EDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLVKSKDFTQIVVE 304
           ED+HE+T  +Y  FE +F+++RT ++FDI V  +P +KPTLLELR VL  S  +T+++ E
Sbjct: 228 EDDHEITNEIYRCFEEEFIRIRTSQVFDIFVTGFPTTKPTLLELRSVLKTSVKYTELITE 287

Query: 305 FLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERNDLVTV 364
           FL  FE ++LNPSI+T   LL+YV+ +K+ L +D + R    ++ FV+PY  ER+D V  
Sbjct: 288 FLYQFESKMLNPSITTAEILLSYVRAIKSILIVDVSFRYFQLLTNFVRPYLMERHDTVAT 347

Query: 365 LLYAILELQSEEFEGPARAYLDTNSLNQLSQELKDPEFGIESSFETIPQADLLSRPASTA 424
            LYA+L L + +           +  +QLS EL+     I SS  T  + +L        
Sbjct: 348 FLYAMLGLDASDLSSKNSTSTHMSIASQLSAELRGSHQPISSS--TAERGNL-----PHG 400

Query: 425 TTAAMLDPRLP-YKSVIKNFLQWTPEPMDTISKNYSKSLSASRNLLDILMDMFESKDFFV 483
             A  ++P  P Y+ +I  +L W PEP D+I  N  ++L  S+ L DI++++F+SKD  V
Sbjct: 401 KHALSMNPYEPAYQQIIDYYLHWNPEPADSIQANNDQAL-ISKELFDIIVELFDSKDVIV 459

Query: 484 SEFXXXXXXXXXXXXXXXXXXXWSHCLRLLKTKFXXXXXXXXXXXXXXXXXXXXXXXXXX 543
            EF                   W   L+++K K                           
Sbjct: 460 REFLGLFTRKLLGLRGYKLESNWVQSLKVVKKKLDFKTYSSAQEF--------------- 504

Query: 544 XXPSNINNIDVMLRDVRGSSELCKRMHQVAGLDQRIYPKFISPLYWN--RDNSSNGWTFQ 601
              SNINNIDVMLRDV+ S ELC  MH+  GL  RI PKF+S L+WN   D S+      
Sbjct: 505 ---SNINNIDVMLRDVKHSEELCSLMHEKLGLSDRIIPKFVSYLFWNAHSDFSALPKDHP 561

Query: 602 LDPQMALELDKYCQVYSEIKPGRALHLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQQ 661
           L  ++  +++ Y + Y+ +K GR L L+ +Q IV L L   DGR    E TL++  V+  
Sbjct: 562 LPKELEADINNYKKAYTNVKKGRKLRLHPEQSIVELQLRLADGRDLNYEVTLDEALVLSY 621

Query: 662 FDASTATTTGLTEQMIGARLQMDPARARAALQHWVQEGVLYYDGNAYKTREYLDDQPAEN 721
               ++   G  E+++  +  +D ++   +L+ WV+  +L Y      +R  ++++   +
Sbjct: 622 L---SSNGDGTVEEIV-KQTNLDISQVEKSLKFWVKSSILRYSTET--SRYSVEERQNVD 675

Query: 722 LPASKDSSASSQARTMSPDRD---SRLTSILEQTWPFIQGMLTNLGALKVKKIHSFLKVT 778
           +  + +  +SS+    +   D    +    +++  PFI+GMLTNLG+LK  KIHSFLK+ 
Sbjct: 676 VKHAVERQSSSEIVNATDSVDLQQQQFIDSMQKVLPFIKGMLTNLGSLKADKIHSFLKMA 735

Query: 779 TPKELGFSMVTPSQLESYLHSLVEEERLICTTNDTYKLPK 818
            PKE+G+S  TPSQL+ YL++LVEE +L+ T N  ++L K
Sbjct: 736 VPKEIGYS-ATPSQLQLYLNALVEESKLVKTPNGAFRLAK 774

>TPHA0C00830 Chr3 (163528..166056) [2529 bp, 842 aa] {ON} Anc_8.321
           YLR127C
          Length = 842

 Score =  512 bits (1319), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 296/830 (35%), Positives = 453/830 (54%), Gaps = 55/830 (6%)

Query: 31  DDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKMLVNQYYNMELREDERDTGYLFIQLVR 90
           DD++SLL W+NPN+P+SNHQ KPPT+RLK  IK ++     +     + D+      L+R
Sbjct: 26  DDIDSLLDWLNPNDPKSNHQLKPPTIRLKKVIKKILLDVNTL----GDYDSIETLNSLLR 81

Query: 91  QFYVYQVRLHFFASLSNLHTFKDVQRLVKYYEFPLKYVYIFENCPEEWIGERDGLMHYLL 150
            +Y++QVRL+FF++L ++  FKD+ +L KYYEFP+ +V IF N    W  E + + HYLL
Sbjct: 82  YYYIFQVRLNFFSNLQSITYFKDIIKLEKYYEFPILHVPIFLNNNYIWETELNKIRHYLL 141

Query: 151 NRHKKLRINVVSRLKDLVMEDDFDLAMDVVKWLNESN-SNVSSMDLMLDLIVEKISRFCQ 209
             +   R N+++RLK LV EDDFDLA +++KW NE+N S +SS  ++L+ +++KI+ +  
Sbjct: 142 RTNLTFRSNLINRLKKLVKEDDFDLAQEIIKWSNEANFSLLSSKQIILNALLDKITMYAD 201

Query: 210 DQMTGTWNNRFLIMETFNRFITSYWSQFCLLLACPEDNHELTTVVYHLFERQFVKLRTKE 269
            Q T  W+ RF+IMET+N+FI  YWS F +LL C ED+HE+T V+Y  FE+QF+++R++E
Sbjct: 202 KQFTNAWSQRFIIMETYNKFINKYWSNFAVLLNCAEDDHEITKVLYKYFEKQFLRIRSEE 261

Query: 270 IFDIVVGVYPDSKPTLLELRRVLVKSKDFTQIVVEFLSNFERQILNPSISTVNALLAYVK 329
           IFDI V  YPDSKPT++ELR +L +SK  T I++  LS F+ ++LN SI T   L+AY+K
Sbjct: 262 IFDICVISYPDSKPTIMELRGLLTQSKISTNILIRLLSEFQLKVLNLSIPTCTILIAYIK 321

Query: 330 TVKAFLTLDPTGRCLNSVSAFVKPYFQERNDLVTVLLYAILELQSEEFEGPARAYLDTNS 389
           TVK+ L LDPT R L S ++F  PY Q+++D++ +LL+AIL+L++++ +      +D N 
Sbjct: 322 TVKSLLILDPTSRYLQSFTSFTNPYLQQKSDIIYILLFAILDLRTDDIKTNPIVKVDQNL 381

Query: 390 LNQLSQELKDPEFGIESSFETIPQADLLSRPA-----STATTAAMLDPRLPYKSVIKNFL 444
           L  LS+EL++  FGI  +F  +  +D L         S    A     +L Y  ++   L
Sbjct: 382 LKLLSEELRESHFGINLNFSDVDISDNLENGNNNKNISQLDYAGQESSQLLYSQILNRAL 441

Query: 445 QWTPEPMDTISKNYSKSLSASRNLLDILMDMFESKDFFVSEFXXXXXXXXXXXXXXXXXX 504
            W PE    +S N S  +   +NLLDIL  +F+  + F+  F                  
Sbjct: 442 TWLPES-KLVSPNKSIKMMRKKNLLDILFAIFDDHELFLKRFVELLKQKLFVIKGYNLEE 500

Query: 505 XWSHCLRLLKTKFXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSNINNIDVMLRDVRGSSE 564
            W  CLRL KTKF                               + NIDVML D+RGS +
Sbjct: 501 SWVQCLRLFKTKFSPNSLDDAPTSTNLETLTGNNDSMY------MTNIDVMLWDMRGSKK 554

Query: 565 LCKRMHQVAGLDQRIYPKFISPLYWNRDNSSN------GWTFQLDPQMALELDKYCQVYS 618
           L ++MH +  LD RI  K IS LYW  D  +       G   ++D  +  +LDKY ++YS
Sbjct: 555 LTEQMHLIDELDNRINLKIISSLYWQYDMKNEKRKTYYGLLNKMDQTLFNQLDKYSKLYS 614

Query: 619 EIKPGRALHLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQQFDASTATTTGLTEQMIG 678
            +KPGR L+L  DQ  + +  +F+D R   CE T E    I  F  +  T++   E++  
Sbjct: 615 RLKPGRVLNLLTDQSTIEIDFNFEDNRTVTCECTFENYMSICPFLENEGTSSYTLEEL-S 673

Query: 679 ARLQMDPARARAALQHWVQEGVLYYDGNAYKTREYLD------DQPAENLPASK------ 726
                     + +L+ W+ + +LY+DG  Y+  EYLD      + P  N   S       
Sbjct: 674 IITSFGLEDLKISLKFWLDQKILYFDGKTYRPLEYLDRSEIIIESPESNNVNSVMSITNN 733

Query: 727 ---------------DSSASSQARTMSPDRDSRLTSI---LEQTWPFIQGMLTNLGALKV 768
                          D  +       +PD D    +    + +   ++  +LTNLG   +
Sbjct: 734 PLNGFAILGKGNDTIDRPSQENITKCTPDHDKTFNATSQEVSKIKEYVLSILTNLGEQNI 793

Query: 769 KKIHSFLKVTTPKELGFSMVTPSQLESYLHSLVEEERLICTTNDTYKLPK 818
           +K+++ L+ TT  +     V+   LE+ +  LVE  +++C  N  Y+LP+
Sbjct: 794 EKLYNVLQ-TTSHDTAIKKVSSVTLENIVTELVENGQILCLPNGLYQLPE 842

>TBLA0A03920 Chr1 complement(980348..982546) [2199 bp, 732 aa] {ON}
           Anc_8.321 YLR127C
          Length = 732

 Score =  468 bits (1204), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 261/728 (35%), Positives = 413/728 (56%), Gaps = 56/728 (7%)

Query: 23  LRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKMLVNQYYNMELREDERDTG 82
           L  + +  D+LE+LL W++PN+P SNH   PPTL+LK  IK +     + ++ +D  ++ 
Sbjct: 23  LSPYKDISDELETLLIWLDPNDPNSNHHLHPPTLQLKTIIKQITP---SSDIYKDPSNSI 79

Query: 83  YLFIQ-LVRQFYVYQVRLHFFASLSNLHTFKDVQRLVKYYEFPLKYVYIFENCPEEWIGE 141
              IQ  ++ FYVYQVR +FF  + N+  +KD+ +L KYY+FPL+++ +F    +EW  E
Sbjct: 80  KNNIQNWLKLFYVYQVRTYFFKKIDNIRQYKDMIKLEKYYQFPLQFIPLF--TFQEWCFE 137

Query: 142 RDGLMHYLLNRHKKLRINVVSRLKDLVMEDDFDLAMDVVKWLNESNSNVSSMDLMLDLIV 201
              L HY+L+++K+    ++  L+ L+ E+DF+ ++D+V W+ E +SN+ S + +LD+++
Sbjct: 138 LLSLRHYILHQNKEFTQKIILELRQLIKEEDFETSLDIVTWIREVDSNLLSENFILDILL 197

Query: 202 EKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLLLACPEDNHELTTVVYHLFERQ 261
           EKI+ +C+  M G W  R+L+MET+N F+ +YW  F  LL C EDNH++T +++  FE+Q
Sbjct: 198 EKITLYCEQTMKGNWTRRYLVMETYNTFMMNYWLNFTQLLNCKEDNHKITNILFKYFEKQ 257

Query: 262 FVKLRTKEIFDIVVGVYPDSKPTLLELRRVLVKSKDFTQIVVEFLSNFERQILNPSISTV 321
           F+K+R +EIF I +  YPD+KPTLLELR +LV    F ++VV FLS FER +L P+I+T+
Sbjct: 258 FIKIRIQEIFKICILSYPDTKPTLLELRNLLVTYNFFQKLVVNFLSAFERIVLTPTINTI 317

Query: 322 NALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERNDLVTVLLYAILELQSEEFEGPA 381
           + LLAY++TVK+F  LDP+GR L S++ ++ P+F+ER  L  +LL+AIL L   + E   
Sbjct: 318 DCLLAYIRTVKSFQILDPSGRYLYSITNYINPHFRERKMLAPILLHAILALPKIDLENAI 377

Query: 382 RAY-LDTNSLNQLSQELKDPEFGIE------------------------SSFETIPQADL 416
               + + SL  +  EL+DPE GIE                        +S E +P  DL
Sbjct: 378 YPIKVSSISLKLIINELEDPELGIENTSTKKNSIKKFNEILSPKRFNNHNSSEYLP--DL 435

Query: 417 LSRPASTATTAAMLDPRLPYKSVIKNFLQWTPEPMDTISKNYSKSLSASRNLLDILMDMF 476
           L   +S  + + +L      + V+K FL W P P D I+ N +K L +S NLLDIL+++F
Sbjct: 436 LQNTSSEDSNSTLL-----VQKVVKQFLTWVPIPND-IATNDTKKLYSSTNLLDILLNIF 489

Query: 477 ESKDFFVSEFXXXXXXXXXXXXXXXXXXXWSHCLRLLKTKFXXXXXXXXXXXXXXXXXXX 536
           ESK+F ++EF                   W  CL+LL+ +F                   
Sbjct: 490 ESKEFLLTEFSKLLSKRLLITKNYKLEGKWGACLQLLRKRFSSGSDNYTNTNLADTDNLV 549

Query: 537 XXXXXXXXXPSNINNIDVMLRDVRGSSELCKRMHQVAGLDQRIYPKFISPLYW---NRDN 593
                       I N++VML D+  SSELCK  H   G++ R+YPKFIS  YW   + +N
Sbjct: 550 NGENLK------ITNMNVMLSDLNYSSELCKIFHHANGVNTRVYPKFISSHYWVDLDDEN 603

Query: 594 SSNGWT-----FQLDPQMALELDKYCQVYSEIKPGRALHLYKDQGIVVLTLSFQDGRKKR 648
            SNG       FQ+ P +    ++Y ++Y ++  GR + ++ ++G++ + LSF+DGR   
Sbjct: 604 VSNGPNEETNHFQIPPSLLGYFEEYAKLYEDLNEGRKVDIWPNEGVIEIKLSFEDGRVLE 663

Query: 649 CEATLEQCSV---IQQFDASTATTTGLTEQMIGARLQMDPARARAALQHWVQEGVLYYDG 705
            +ATL Q ++   IQ+ +A      G T   +   L +        +  W+++ VL    
Sbjct: 664 IDATLPQYALLQYIQEKNAIMQNNQGFTVNELSVPLNLSLQNVTELVDFWLKKNVLKKVD 723

Query: 706 NAYKTREY 713
           + Y   EY
Sbjct: 724 DKYSILEY 731

>CAGL0M04235g Chr13 complement(464973..467324) [2352 bp, 783 aa]
           {ON} similar to uniprot|Q12440 Saccharomyces cerevisiae
           YLR127c APC2 component of the anaphase promoting complex
          Length = 783

 Score =  446 bits (1148), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 272/796 (34%), Positives = 420/796 (52%), Gaps = 60/796 (7%)

Query: 36  LLTWINPNEPQSNHQCKPPTLRLKNSI-KMLVNQYYNMELREDERDTGYLFIQLVRQFYV 94
           LL W++P   + NHQ KPP L +K  I K+L+                Y  +  ++ +Y 
Sbjct: 33  LLQWLDP-AGKKNHQLKPPNLLVKTMIEKLLLGS------------NDYQLLSNIQDYYC 79

Query: 95  YQVRLHFFASLSNLHTFKDVQRLVKYYEFPLKYVYIFENCPEEWIGERDGLMHYLLNRHK 154
           +Q R++F+     + T  +++R+ ++  FPLKY+ IFE        E     +YLL  +K
Sbjct: 80  WQCRVYFYNEYKRIETLNELKRIERHVLFPLKYIPIFEG-NNRVENEVRLFGNYLLKTNK 138

Query: 155 KLRINVVSRLKDLVMEDDFDLAMDVVKWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTG 214
           K+    V RL++ ++EDDF+LA ++V + +   ++ +S  ++LD+I++KI +FCQ   T 
Sbjct: 139 KVMSRAVERLRNRMLEDDFELATEIVDYFDYCQTDSTS--IVLDIILDKIEQFCQLHYTR 196

Query: 215 TWNNRFLIMETFNRFITSYWSQFCLLLACPEDNHELTTVVYHLFERQFVKLRTKEIFDIV 274
            WN R+LIMETFN+FI+ YW Q   LL C EDNH +T  +Y  FE+QF+ +RT EIFDI 
Sbjct: 197 KWNKRYLIMETFNQFISQYWDQLSSLLFCQEDNHTITNTLYKYFEKQFISIRTNEIFDIC 256

Query: 275 VGVYPDSKPTLLELRRVLVKSKDFTQIVVEFLSNFERQILNPSISTVNALLAYVKTVKAF 334
           +      +PTLLELR+ +    DF  +VVE LS F  +++NPSI T +AL  Y++T+K F
Sbjct: 257 ISNPASVQPTLLELRKEISTVNDFNCVVVELLSKFNLKVINPSIVTADALFLYIRTIKTF 316

Query: 335 LTLDPTGRCLNSVSAFVKPYFQERNDLVTVLLYAILELQSEEFEGPARAYLDTNSLNQLS 394
             LDP+GR L ++S++VKP+F++R DLV +LL+++L L   +      + +    L  L+
Sbjct: 317 SILDPSGRYLQTISSYVKPHFRQRKDLVHLLLFSMLGLDETDQLNTMPSQVSEEKLTALT 376

Query: 395 QELKDPE---FGIESSFETIPQADLLSRPASTATTAAMLDPRLPYKSVIKNFLQWTPEPM 451
            ELKD E   +  ES     P     S+   +          +  + VIK +++W PE  
Sbjct: 377 NELKDTEICSYTEESDDVVDPMIGSFSKEEDS----------MVLEQVIKRYMEWIPE-- 424

Query: 452 DTISKNYSKSLSASR--NLLDILMDMFESKDFFVSEFXXXXXXXXXXXXXXXXXXXWSHC 509
             +  ++ K + +    +L DIL+++ ESK+  V EF                   WS  
Sbjct: 425 --VPTSFGKGILSDHKLDLFDILLELLESKETLVIEFKNLLTKKLLDLRGYTLDKKWSKF 482

Query: 510 LRLLKTKFXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSNINNIDVMLRDVRGSSELCKRM 569
           L LLK +F                             +NIN ID+MLRD+  S ++   M
Sbjct: 483 LSLLKKRFDNRSTETMDEEDL----------------NNINTIDIMLRDIYKSRQIATDM 526

Query: 570 H-QVAGLDQRIYPKFISPLYW--NRDNSSNGWTFQLDPQMALELDKYCQVYSEIKPGRAL 626
              +   + ++YPK +S LYW  N D  S    F++D ++   L+ Y + YS+ + G+ L
Sbjct: 527 QLDLHNTNVKVYPKIVSALYWSNNSDTQSKAGDFEMDGELEHLLELYSRFYSQKQIGQKL 586

Query: 627 HLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQQFDA----STATTTGLTEQMIGARLQ 682
            L +D G V L LSF DGR   C+A+L Q SV+  F +    S   T GLT   + AR  
Sbjct: 587 ELRRDNGSVSLNLSFLDGRTVHCKASLRQYSVLTLFKSPKHDSNFPTEGLTISELCARSG 646

Query: 683 MDPARARAALQHWVQEGVLYYDGNAYKTREYLDDQPAENLPASKDSSASSQARTMSPDRD 742
           M   +    L++WV + VLY+    Y+T E+L  +      A  D    S     S   D
Sbjct: 647 MQSKQMADILRYWVSKDVLYFSDGKYRTLEFLRWKGDSTYAAIPDVLEESVVERSSQHED 706

Query: 743 SRLTSILEQTWPFIQGMLTNLGALKVKKIHSFLKVTTPKELGFSMVTPSQLESYLHSLVE 802
            +   + E+  P+I+ +L NLG LK+ K+H+ L+   PK+  +S V   QL+ YL +LVE
Sbjct: 707 KQENHV-ERALPYIKDILLNLGTLKIDKLHALLQSAMPKDSHYSTVNQKQLQDYLDTLVE 765

Query: 803 EERLICTTNDTYKLPK 818
           E  L   +ND+YKLP+
Sbjct: 766 EGVLSSASNDSYKLPQ 781

>NCAS0C03280 Chr3 (644169..646604) [2436 bp, 811 aa] {ON} Anc_8.321
           YLR127C
          Length = 811

 Score =  432 bits (1111), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 280/851 (32%), Positives = 442/851 (51%), Gaps = 82/851 (9%)

Query: 5   MRAGEDLKRLLVQIQE-VALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIK 63
           M    DL  ++  ++E V  + HP     LESLL W++PN  +   Q KPPTL LK+ I 
Sbjct: 1   MSLDADLPTIITSLREQVERQFHPQ----LESLLLWLDPNSSKGTRQNKPPTLELKDCIN 56

Query: 64  MLVNQYYNMELREDERDTGYLFIQLVRQFYVYQVRLHFFASLSNLHTFKDVQRLVKYYEF 123
           +L   Y      +DE+     F   +R++Y+Y V+ HF  ++  +   KD + L   Y +
Sbjct: 57  LLRAGY-----SQDEK-----FKMWLREYYLYVVKFHFMKNVDEISVLKDFKLLEMIYIY 106

Query: 124 PLKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVM-------EDDFDLA 176
           PL+++ + ++     + +     HYL++++   R N++++ KD  +       E +F   
Sbjct: 107 PLQFMDLVDSTDISNLVK--SFKHYLIDKNVTFRKNLITKFKDCFLVGNQFEFEYEFANI 164

Query: 177 MDVVKWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQ 236
           ++++ W+ +S   +S+ DL+LD  + KI  F ++QM G  N +F++METFN+FI  YW  
Sbjct: 165 VEIIHWIQDSEGVLSATDLILDASLTKIEIFAREQMIGKLNQKFIVMETFNKFIDIYWKN 224

Query: 237 FCLLLACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLVKSK 296
              L+   ED+H+LT ++Y  FERQF+K+R +EI  I+V  YP +KPT+LEL+ +L K  
Sbjct: 225 LTQLIGNIEDDHDLTNLIYQFFERQFIKIRIEEILTIMVQDYPQTKPTILELKSILSKQN 284

Query: 297 DFT---------------QIVVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTG 341
             T               +++ +FL  F+R+ LNP I T++ L AYVK  K+FL LDP+G
Sbjct: 285 SSTAGARKRGRRKDEWSKKLLKQFLVTFKREFLNPCIPTIDVLNAYVKATKSFLLLDPSG 344

Query: 342 RCLNSVSAFVKPYFQERN-DLVTVLLYAILELQSEEF--EGPARAYLDTNSLNQLSQELK 398
             LNS+  FVKPY +    ++V +LLYA+L L+S++       +   D  S+  LS+EL 
Sbjct: 345 SLLNSIVIFVKPYLRSNEVEMVDILLYALLNLKSKDLIELNCEKTTYDMRSIELLSKEL- 403

Query: 399 DPEFGIESSFETIPQADLLSRPASTATTAAMLDPRLPYKSVIKNFLQWTPE--PMDTISK 456
                  S+  +    D+  +  S   T    +  LPY+ V  +FL W P   P+   S 
Sbjct: 404 -------SNDHSKHAGDVDYKKFSPEGTNEFENSTLPYEQVYTDFLNWKPSITPISE-SS 455

Query: 457 NYSKSLSASRNL--LDILMDMFESKDFFVSEFXXXXXXXXXXXXXXXXXXXWSHCLRLLK 514
           N  +  S  +N+  +D + +  ESKD  +SEF                   W  CL++L+
Sbjct: 456 NDDEFASLGKNITPIDYVFNALESKDKLISEFLKLLTIKLLHMKGYEVEDRWQKCLKILQ 515

Query: 515 TKFXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSNINNIDVMLRDVRGSSELC-KRMHQVA 573
            K                              S+IN I +ML D+  S E   +++ +  
Sbjct: 516 DKVTSDKNIVNDESIT----------------SDINTILIMLHDISISKESSNEKISEFQ 559

Query: 574 GLDQ-RIYPKFISPLYWNRDNSSNGWTFQLDPQMALELDKYCQVYSEIKPGRALHLYKDQ 632
              + +++PKFIS LYW     S  + F LD ++  +L KY + Y    PG  L L    
Sbjct: 560 NSSEMQLFPKFISKLYWKFKRQSE-YQFPLDSKLRKKLSKYMKSYHHSHPGMKLKLVNGT 618

Query: 633 GIVVLTLSFQDGRKKRCEATLEQCSVIQQF-DASTATTTGLTEQMIGARLQMDPARARAA 691
           GI  L L+F+DGRK   +AT EQ +V+  F +    ++  L+   +   L+MDP R RA 
Sbjct: 619 GICSLNLTFKDGRKLSVDATFEQYTVLSAFHNDKDDSSQVLSINQLSTMLKMDPERVRAH 678

Query: 692 LQHWVQEGVLYYDGNAYKTREYLDDQPAENLPASKDSSASSQARTMSPDRDSRLTS---- 747
           LQ W+ + VL +  + Y  +EYL++Q   + P    SS    ++   P + S  T+    
Sbjct: 679 LQFWINKKVLCHQNDYYTIQEYLNNQELSSGPTVITSSILPLSQERMPFKRSVPTNVLND 738

Query: 748 ---ILEQTWPFIQGMLTNLGALKVKKIHSFLKVTTPKELGFSMVTPSQLESYLHSLVEEE 804
              IL + +P+I  M TNLG+LKV KIHSFL ++ P+ L +S VT +QLE+YL  LVEEE
Sbjct: 739 PKEILHRVYPYINDMFTNLGSLKVDKIHSFLNMSVPRGLHYSKVTVTQLEAYLDQLVEEE 798

Query: 805 RLICTTNDTYK 815
           +LI   + ++K
Sbjct: 799 QLIVLPDGSFK 809

>Kpol_YGOB_Anc_8.321 s1036 complement(185463..186998) [1536 bp, 511
           aa] {ON} ANNOTATED BY YGOB -
          Length = 511

 Score =  394 bits (1013), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 215/520 (41%), Positives = 307/520 (59%), Gaps = 30/520 (5%)

Query: 314 LNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERNDLVTVLLYAILELQ 373
           +NPSI+TV+AL+AYVKTVK+FLTLDP+G+ L+S+S FV PY QERNDLV+VLLYAIL+LQ
Sbjct: 1   MNPSITTVDALIAYVKTVKSFLTLDPSGKYLHSISTFVNPYLQERNDLVSVLLYAILDLQ 60

Query: 374 SEEFEGPARAYLDTNSLNQLSQELKDPEFGIESSFET-IPQADLLSRPASTATTAAMLDP 432
           SE F+  A+  LD +SL  LS EL+DPEFGIE      + + +L  +P++ +  +++L  
Sbjct: 61  SENFQEEAQNILDADSLVILSDELRDPEFGIEGELNIDLDKNELTGQPSNKSGDSSLL-- 118

Query: 433 RLPYKSVIKNFLQWTPEPMDTISKNYSKSLSASRNLLDILMDMFESKDFFVSEFXXXXXX 492
              Y+ VI   L W PE     SK   K +   +NLLDIL+++FE+ + F++EF      
Sbjct: 119 ---YRQVITQMLNWVPESSKIDSKR-QKMIGLRKNLLDILLEIFENNEVFIAEFLKLLTK 174

Query: 493 XXXXXXXXXXXXXWSHCLRLLKTKFXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSNINNI 552
                        WS CL+LLK KF                               INNI
Sbjct: 175 KLLKLKYYKLDSRWSKCLKLLKEKFKGNSAGTTSISTNIGNVTGSDLVY-------INNI 227

Query: 553 DVMLRDVRGSSELCKRMHQVAGLDQRIYPKFISPLYWN-----RDNSSNGWTFQLDPQMA 607
           DVML D++ S +L  RMHQ+ GLD+RI PKFIS LYW+     +   +N    Q+DP ++
Sbjct: 228 DVMLWDLKTSGDLTSRMHQIEGLDRRIQPKFISSLYWDQAKESKSKGNNAKQTQIDPLLS 287

Query: 608 LELDKYCQVYSEIKPGRALHLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQQFDASTA 667
            +L+KY +VYSE+KPGR LHL KD G V L  +F+DGR   C+ATLEQ ++I  F +   
Sbjct: 288 TQLEKYIRVYSELKPGRTLHLLKDHGTVELEFTFEDGRTISCDATLEQSNIINYF-SEAV 346

Query: 668 TTTGLTEQMIGARLQMDPARARAALQHWVQEGVLYYDGNAYKTREYLDDQPAENLPASKD 727
           +  GL+ + +     ++    +  LQ WV E VLY+DG  Y+  EYLD         +  
Sbjct: 347 SENGLSLEQLHILSGIESTGLKKILQFWVDEKVLYFDGQLYRILEYLDQPEIIVQSLTHT 406

Query: 728 SSASSQARTMSP----------DRDSRLTSILEQTWPFIQGMLTNLGALKVKKIHSFLKV 777
                + + ++P          D+ +++   L   WP+I+GMLTNLG+LK++KIHSFL+ 
Sbjct: 407 GEVLKEEQKLNPLSSSSITSDIDQMNKIHETLNNVWPYIKGMLTNLGSLKLEKIHSFLRA 466

Query: 778 TTPKELGFSMVTPSQLESYLHSLVEEERLICTTNDTYKLP 817
           T PK++ ++ +T S LE YL+SLVE++ L    + +Y+LP
Sbjct: 467 TVPKDVNYNSITVSSLEVYLNSLVEDDVLELLASGSYRLP 506

>KAFR0H02280 Chr8 (435246..437699) [2454 bp, 817 aa] {ON} Anc_8.321
           YLR127C
          Length = 817

 Score =  398 bits (1023), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 267/846 (31%), Positives = 425/846 (50%), Gaps = 100/846 (11%)

Query: 27  PNCE--DDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKMLVNQYYNMELREDERDTGYL 84
           PN +  +DL+ LL W++P E    HQCKPP+LR+K SI+ +   +   +L  D       
Sbjct: 12  PNAKFAEDLDRLLLWLSPAE----HQCKPPSLRIKKSIQRIRECF---QLSSD------- 57

Query: 85  FIQLVRQFYVYQVRLHFFASL---SNLHTFKDVQRLVKYYEFPLKYVYIFENCPE---EW 138
           F   + + Y+  +R  F + +   +N   F DV +L    E P  ++      PE   E+
Sbjct: 58  FTNCLVKLYIDLIRFEFISYMKENANCLKFNDVLKLENRIEHPRLFI------PELEFEY 111

Query: 139 IGERDGLMHYLLNRHKKLRINVVSRLKDLVMEDDFDLAMDVVKWLNESNS-NVSSMDLML 197
                 L HYLL+  K  +  + + +++L+MEDDF  A  ++ W++ + S ++S  DL+L
Sbjct: 112 FKNLHMLRHYLLDSDKSFKTALCTSIENLIMEDDFYSATIILDWIDSAYSIDLSPKDLVL 171

Query: 198 DLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLLLACPEDNHELTTVVYHL 257
           D++V+KI+  C   + G+W  RF+++ETFN FI  YWS F  LL CPE++HELT  V+  
Sbjct: 172 DMLVKKIAGICSGSIRGSWTRRFIVIETFNDFIEVYWSHFAQLLKCPENDHELTKTVFKC 231

Query: 258 FERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLVKSKDFTQIVVEFLSNFERQILNPS 317
           FER+F+ +R  EIF+I    YP+SKPT+LELR+V+   KD  ++   FL  F+ ++LNP 
Sbjct: 232 FEREFINIRINEIFEIFTSAYPESKPTILELRKVMKAPKDLQRLTYTFLDTFKDEMLNPC 291

Query: 318 ISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERNDLVTVLLYAILELQSEEF 377
           ++T++AL +Y+K +K FL LDP GR LN V+ FVKPYFQ+++DL+ +LLYAIL+L+ ++F
Sbjct: 292 VTTIDALTSYLKAIKGFLLLDPAGRYLNLVTTFVKPYFQDKSDLINILLYAILDLKPKDF 351

Query: 378 EGPARAYLDTNSLNQLSQELK-DPEFGIESSFETIPQADLLSR--PASTATTAAMLDPR- 433
           E    +Y+    LN+LS +++ DPEF IE+     P  +   R  P   +  A  L  + 
Sbjct: 352 EDLNISYIP--GLNKLSLDMREDPEFSIEN---VEPNDNNYKRTVPNLESIGANSLHDKG 406

Query: 434 -LPYKSVIKNFLQWTPEP-MDTISKNYS---------------KSLSASRNLLDILMDMF 476
            L    ++K F+ W PEP M+ +  ++                 S+  + NLLDIL+D+F
Sbjct: 407 TLIQDHIMKQFMMWVPEPNMNNLENDHDNGNDFEEDNNDVTAVNSIFYNVNLLDILLDLF 466

Query: 477 ESKDFFVSEFXXXXXXXXXXXXXXXXXXXWSHCLRLLKTKFXXXXXXXXXXXXXXXXXXX 536
           ESK+ F+ +F                   W  CL L+ +KF                   
Sbjct: 467 ESKEIFIGKFVNLLTIKFFKLQNYRVDPNWQKCLELINSKFNSSNISMDEKMEEDVAIGT 526

Query: 537 X-------XXXXXXXXPSN--------INNIDVMLRDVRGSSELCKRM------HQVAGL 575
                            SN        +N I+VML D+R S +   ++      + +   
Sbjct: 527 VNPTNENYVDEKRKTNASNDMEEIQISLNKIEVMLNDIRHSEKFSFQISSELNRYGLRSN 586

Query: 576 DQRIYPKFISPLYWNRDNSSNGWTFQL-----DPQMALELDKYCQVYSEIKPGRALHLYK 630
           +  I PKFISPLYW+ +++  G    L     D +    + +Y   Y  I  G ALH  K
Sbjct: 587 NVGIKPKFISPLYWDYEDNELGVNNFLKENVFDEECTKAILQYASEYCSINKGFALHYCK 646

Query: 631 DQGIVVLTLSFQDGRKKRCEATLEQCSVIQQFDASTATTTGLTEQMIGARLQMDPARARA 690
            + ++ + +SF DG  K       Q  V+  FD      T +   +     +        
Sbjct: 647 GKEMIEVEISFNDGAIKGFLVNASQYYVLTLFDTGNEKLT-IESILTAGEAKRSKNEIID 705

Query: 691 ALQHWVQEGVLYYDGNAYKTREYLDDQPAENLPASKDSSASSQARTMSPDRDSRLTSILE 750
           AL+ WV++ VL Y+G  Y +R+         L + ++S  ++  RT     D  L   ++
Sbjct: 706 ALKFWVEKNVLVYEGGYYYSRD---------LHSIENSKGNTTTRT-----DDLL---VK 748

Query: 751 QTWPFIQGMLTNLGALKVKKIHSFLKVTTPKELGFSMVTPSQLESYLHSLVEEERLICTT 810
           +  P+I+ ML + G L   +I +FLK T P       +  + + S L +LV +  L   +
Sbjct: 749 EALPYIKTMLESFGNLSASRIQNFLKATLPAAQDSDHII-TDIHSVLDTLVSDGILFKNS 807

Query: 811 NDTYKL 816
           + +YKL
Sbjct: 808 SGSYKL 813

>Ecym_4252 Chr4 complement(523632..525701) [2070 bp, 689 aa] {ON}
           similar to Ashbya gossypii AGL193W
          Length = 689

 Score =  358 bits (920), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 236/728 (32%), Positives = 382/728 (52%), Gaps = 59/728 (8%)

Query: 5   MRAGEDLKRLLVQIQEVALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKM 64
           M   E+L+   +Q+            DDLE+LLTWINPN+  +NHQ + P+LR+KNSIK+
Sbjct: 1   MTYAEELENYHLQLISALPENDEALRDDLENLLTWINPNDDHNNHQMRLPSLRIKNSIKL 60

Query: 65  LVNQYYNMELREDERDTGYLFIQLVRQFYVYQVRLHFFASLSNLHTFKDVQRLVKYYEFP 124
           L         + D+ +  +L +QL+RQ+ + Q+R HFF +  +L  +KD+ RL +YYEFP
Sbjct: 61  L---------KLDDAEQVFL-LQLLRQWTLSQLRYHFFHNWESLMQYKDMLRLERYYEFP 110

Query: 125 LKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVME-DDFDLAMDVVKWL 183
           LKYV +F    EE   E  GL  YLLNR+   R N+ SR++ L++E DDF+++  + KW+
Sbjct: 111 LKYVGLF--TAEELSNELIGLRKYLLNRNSTFRNNMESRIRVLILEEDDFEMSSKLYKWM 168

Query: 184 NESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLLLAC 243
            +   +   +  ++DL+  KI  FC+ +M G  + + +I E FN FI   W+QF  LL  
Sbjct: 169 VQGLGH-PMVKFVIDLLTNKIELFCKSRMEGNVDQKHVIEEVFNAFIDKCWNQFIQLLQF 227

Query: 244 P-EDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLV-KSKDFTQI 301
           P ED+ EL  ++Y  FE +F++++TKE+FD ++  +P SKP+LLE++ V+   +++  ++
Sbjct: 228 PNEDDQELNNLIYRCFENKFIEMKTKELFDEIIPKFPLSKPSLLEMKSVIKGATEELDRL 287

Query: 302 VVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERNDL 361
           V +  ++F  ++L PS++T+  LL YVK +K  + +DPTGR +N  +  +KP  +ER+DL
Sbjct: 288 VAQICNDFHSELLIPSVTTIEILLYYVKAIKCLMVVDPTGRSMNRFTFKLKPKIKERSDL 347

Query: 362 VTVLLYAILELQSEEF-EGPARAYLDTNS--LNQLSQELKDPEFGIESSFETIPQADLLS 418
           +T +L AILEL  +E  E  ++  L  N   L+QLS+ELK+       S  TI      S
Sbjct: 348 ITTVLCAILELTKDEIHEVISKNTLTENPQLLDQLSKELKNSTALNFHSVTTIK-----S 402

Query: 419 RPASTATTAAMLDPRLPYKSVIKNFLQWTPEPM---DTISK-------NYSKSLSASRNL 468
           + A  +      +P      ++K FL+WTPEP    + ISK       + +++L   +++
Sbjct: 403 KAAIYSVAQERQNP------LVKQFLEWTPEPGPFNEDISKLGNNDTDDTTETLELPKDV 456

Query: 469 LDILMDMFESKDFFVSEFXXXXXXXXXXXXXXXXXXXWSHCLRLLKTKFXXXXXXXXXXX 528
           L+++  +F+S +  ++EF                   WS  L+ L  K+           
Sbjct: 457 LEVVFQVFDSPEILINEFIKLITNHMLQMEGYILSAKWSQLLKTLMKKYFKNNKQVLKSI 516

Query: 529 XXXXXXXXXXXXXXXXXPSNINNIDVMLRDVRGSSELCKRMHQVAGLDQRIYPKFISPLY 588
                             SN+ N+ VM  D+  S+       ++  +   +YPK IS LY
Sbjct: 517 CEE---------------SNLVNVFVMWSDLEKSASFQNWSTKLQLIPSNVYPKIISYLY 561

Query: 589 WNRDNSSNGWTFQLDPQMALELDKYCQVYSEIKPGRALHLYKDQGIVVLTLSFQDGRKKR 648
           W     S    +++   +A+   +  + +    PGR L    DQG V + L+F DGR   
Sbjct: 562 WKISRKSLYGDYRISSALAIIFQQMEKAFEMKSPGRKLRFQNDQGTVEIALTFDDGRHWS 621

Query: 649 CEATLEQCSVIQQFDASTATTTGLTEQMIGARLQMDPARARAALQHWVQEGVLYYDG-NA 707
            + +L + +VI+ F        GL    I  +  M      A +Q+W QE VLY  G + 
Sbjct: 622 NKVSLPKYTVIELFQ---KVPRGLRTADIVQQTDMAQHHVEAIVQYWCQEHVLYSTGDDC 678

Query: 708 YKTREYLD 715
           Y+  E  D
Sbjct: 679 YRILERAD 686

>KNAG0G02430 Chr7 complement(553644..556037) [2394 bp, 797 aa] {ON}
           Anc_8.321 YLR127C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 797

 Score =  356 bits (913), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 252/839 (30%), Positives = 422/839 (50%), Gaps = 75/839 (8%)

Query: 5   MRAGEDLKRLLVQIQEVALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKM 64
           M +   LKR L   QE         +DDLE ++ WI+P      H C PP+LR+K +I+ 
Sbjct: 6   MSSRHHLKRYLATEQE---------QDDLERVMGWIHPQA----HACHPPSLRMKKAIRS 52

Query: 65  LVNQYYNMELREDERDTGYLFIQLVRQFYVY-QVRLHFFASLSNLHTFKDVQRLVKYYEF 123
           ++ +       E +R     +I +++Q Y+  QV+            FK +Q L     +
Sbjct: 53  VLGK-----ASELDRQFKIYYIDVIKQEYLCDQVK----------REFKHIQVLESKLVY 97

Query: 124 PLKYVYIFENCPEEWIGERD--GLMHYLLNRHKKLRINVVSRLKDLVMEDDFDLAMDVVK 181
           P+ Y+  F +  ++   E+    L HYL++    LR ++V+  + L+ +DDF+    +++
Sbjct: 98  PVTYL-PFLSISDQLAIEQTICSLRHYLVDNDDNLRNSLVAEFETLMQDDDFESGYQIIE 156

Query: 182 WLNESNSNV-SSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLL 240
           WL  +N+ +    +L LD IV KIS  C ++M   W  +FL+M TFN+FI  YWS     
Sbjct: 157 WLYTANAKLLRPWNLALDTIVSKISTLCDNEMRRNWEAKFLVMNTFNKFINLYWSHLAKF 216

Query: 241 LACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLVKSKDFTQ 300
           L   EDNH+ T V+Y  FE++FV++RT+EIF+IVV  Y  +K T+LELR  +   +  ++
Sbjct: 217 LHLSEDNHDFTKVLYKCFEKEFVRIRTEEIFEIVVESYQAAKTTILELRTFMSGYERLSK 276

Query: 301 IVVEFLSNFERQILNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERND 360
           +V +FL  F+ ++LNPS++TV AL+A++++VK F+ LDP  R +++++ FVKP+F +R D
Sbjct: 277 LVNQFLKQFKIKVLNPSVNTVEALVAFIRSVKCFVILDPRARHMHTITNFVKPFFHQRGD 336

Query: 361 LVTVLLYAILELQSEEFEGPARAYLDTNSLNQLSQELK-DPEFGIESSFET-IPQADLLS 418
            V ++LYAIL+L+  +FE    +      L++LS EL+ DP   I +  +T  P    +S
Sbjct: 337 AVQIILYAILDLRDVDFEKMGVS--PVKGLSELSHELREDPYVNINAKCQTPTPSPSKIS 394

Query: 419 RPASTATTAAMLDPRLP-------YKSVIKNFL-----QWTPEPMDTISKNYSKSLSASR 466
            P    +++  +D +L        YK V+  F      +      D +  N   S  ++R
Sbjct: 395 SPHLNDSSSMDVDDKLDDGTTDLVYKQVLNQFXXRGHHETNQGTRDYVGVNVKFSQRSNR 454

Query: 467 -NLLDILMDMFESKDFFVSEFXXXXXXXXXXXXXXXXXXXWSHCLRLLKTKFXXXXXXXX 525
            NLLD L ++F+ KD  +S F                   W+ C +L+K K         
Sbjct: 455 TNLLDPLFELFDKKDELLSCFLKLLTLKLFKLSGYTLEPNWNECYQLIKRKVTKGDVGDG 514

Query: 526 XXXXXXXXXXXXXXXXXXXXPSNINNIDVMLRDVRGSSELCKRMHQVAGLDQRIYPKFIS 585
                                S +N IDVML D+R ++++ +R+H+ + L+  ++PKFIS
Sbjct: 515 GPLSRDTADAPVSSNNEQVLLS-LNKIDVMLHDLRENAKITRRLHRTSMLNGNVFPKFIS 573

Query: 586 PLYWN-RDN----SSNGWTFQLDPQMALELDKYCQVYSEIKPGRALHLYKDQGIVVLTLS 640
             YW+ RD+    + N    ++DP +  ++ +Y   + E+K GR + L K++ I  + L+
Sbjct: 574 SQYWSYRDDTFTKAGNRDQIKIDPVLETDILQYGGRFCELKYGRMVRLCKEKTIFEIELT 633

Query: 641 FQDGRKKRC-EATLEQCSVIQQFDASTATTTGLTEQMIGARLQMDPARARAALQHWVQEG 699
             DG   +  +    + SVI+++ A+     G T   +     MD A  + +L +WV  G
Sbjct: 634 VNDGEVPQVFKVDAMKYSVIEKY-ATGGPRAGYTPTELCELCGMDIADVQTSLTYWVNAG 692

Query: 700 VLYYDGNAYKTREYLDDQPAENLPASKDSSASSQARTMSPDRDSRLTSILEQTWPFIQGM 759
           +L    +      Y +       P ++ +   +  R         L  ++   W FI+GM
Sbjct: 693 LLRLSSSG-----YYESTSETGPPPNRGTPLEASTREF-------LDGVV---WTFIRGM 737

Query: 760 LTNLGALKVKKIHSFLKVTTPKELGF-SMVTPSQLESYLHSLVEEERLICTTNDT-YKL 816
           L +LG L   +IH +L  T P  + +   VT  QL+ YL   V+   L+  T +  YKL
Sbjct: 738 LESLGTLSCAEIHEYLAATVPATIRYQETVTMLQLQGYLDYNVQSTHLLQQTPEGEYKL 796

>AGL193W Chr7 (334823..336952) [2130 bp, 709 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR127C (APC2)
          Length = 709

 Score =  340 bits (873), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 217/706 (30%), Positives = 370/706 (52%), Gaps = 59/706 (8%)

Query: 17  QIQEVALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKMLVNQYYNMELRE 76
           Q+ +      P+ +D++E++L W++PN+  +NHQ +PP+LR+KNSI++L         R 
Sbjct: 13  QVVDAVCTWDPSLKDEIEAVLEWMDPNDDHNNHQMRPPSLRIKNSIRLL---------RL 63

Query: 77  DERDTGYLFIQLVRQFYVYQVRLHFFASLSNLHTFKDVQRLVKYYEFPLKYVYIFENCPE 136
            E+  G   + L+RQ  V Q+R HFF     L  + D+ +L +YYEFPL+YV +F    +
Sbjct: 64  GEQAPGTT-VGLLRQCAVSQMRQHFFRHWERLEQYTDMVKLERYYEFPLRYVAVFTE--D 120

Query: 137 EWIGERDGLMHYLLNRHKKLRINVVSRLKDLVMEDD-FDLAMDVVKWLNESNSNVSSMDL 195
           E   E  GL  YLLN +   R N+ +R++ L+++DD F+ A  + KW+ +   +   +  
Sbjct: 121 EVAAELVGLRKYLLNGNPGFRANMEARIRALILQDDDFETAARLYKWIVQGLGH-PMVKF 179

Query: 196 MLDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLLLACP-EDNHELTTVV 254
           +++++ +KI+ FC+++M G  + R+LIME FN FI   W+QF  LL  P  D+ EL  ++
Sbjct: 180 VIEVLTQKIALFCRNRMDGNVDQRYLIMEVFNSFIARCWAQFIQLLQFPTADDPELNNLI 239

Query: 255 YHLFERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLVK-SKDFTQIVVEFLSNFERQI 313
           Y  FE++F++L+T+E+F  ++  +P SKP LLE++ V+   + +  ++V +  ++F +++
Sbjct: 240 YRCFEKKFIELKTQELFHQIIPKFPMSKPALLEMKSVIKGDTAELDRLVAQIYNDFHKEL 299

Query: 314 LNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERNDLVTVLLYAILELQ 373
           L PS++TV  LL YVKT+K  + +DPTGR +N  ++ +KP  +ER+DL+  +L AILEL 
Sbjct: 300 LVPSVTTVEILLYYVKTIKCLMVVDPTGRSMNRFTSKLKPKIKERSDLIISVLCAILELD 359

Query: 374 SEEF-EGPARAYLDTNS--LNQLSQELKDPEFGIESSFETIPQADLLSRPASTATTAAML 430
           S+E  E  ++  L  N   L+QLS+ELK+       +F ++         +++   AA+ 
Sbjct: 360 SDEIHEVISKNTLTENPQLLSQLSKELKN---STALTFHSM---------STSKGKAAIY 407

Query: 431 DPRLPYK-SVIKNFLQWTPEPMDTISKNY---------SKSLSASRNLLDILMDMFESKD 480
                 +  ++K FL+WTPEP    + +          +++L   +++L+++  +F+S +
Sbjct: 408 SVAFERQDQLVKQFLEWTPEPGPFTADDAKALNSDDDGAETLELPKDVLEVVFQVFDSPE 467

Query: 481 FFVSEFXXXXXXXXXXXXXXXXXXXWSHCLRLLKTKFXXXXXXXXXXXXXXXXXXXXXXX 540
             ++EF                   WS  L+ +  K+                       
Sbjct: 468 VLINEFIQLVTNHMLQMDGYVLNAKWSQLLKTVMKKYFKNNKQVLKSMCEE--------- 518

Query: 541 XXXXXPSNINNIDVMLRDVRGSSELCKRMHQVAGLDQRIYPKFISPLYWNRDNSSNGWTF 600
                 SN+ N+ VM  D+  S+       ++  +   +YPK IS LYW     S    +
Sbjct: 519 ------SNLVNVFVMWSDLEKSATFQTWSTKLQLVPPNVYPKIISYLYWKIGRRSPYGDY 572

Query: 601 QLDPQMALELDKYCQVYSEIKPGRALHLYKDQGIVVLTLSFQDGRKKRCEATLEQCSVIQ 660
            + P +A   D+  + +    PGR L   KDQG V L L F+DGR      +L + +VI 
Sbjct: 573 AVAPGLAAIFDQMEKAFETRSPGRKLRFQKDQGSVDLQLVFEDGRHWSSRVSLPKYTVID 632

Query: 661 QFDASTATTTGLTEQMIGARLQMDPARARAALQHWVQEGVLYYDGN 706
            F    A    +T+  I A   M P      +Q W  E VL+ + N
Sbjct: 633 LFQ-RQACPLSVTD--IAAHTNMSPRLVEDIIQFWCHEHVLHLNKN 675

>NDAI0G02600 Chr7 (595394..598129) [2736 bp, 911 aa] {ON} Anc_8.321
           YLR127C
          Length = 911

 Score =  303 bits (776), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 275/951 (28%), Positives = 439/951 (46%), Gaps = 173/951 (18%)

Query: 1   MNAVMRAGEDLKRLLVQIQEVALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKN 60
           M  ++    DL R+    + + +   P     L+++L W+NPNE  +       T+ LKN
Sbjct: 1   MTPLLDTDVDLSRI---TESIFVSIDPQYHPQLQTMLLWLNPNETTT-QSATTMTIDLKN 56

Query: 61  SIKMLVNQYYNMELREDERDTGYLFIQLV-RQFYVYQVRLHFFAS--LSNLHTFKDVQRL 117
            I ++V+ Y     ++D+       I+L+ +++Y + ++LHF       N+ + ++  +L
Sbjct: 57  CINIIVSTYG----KDDQ-------IRLLFKKYYSFVIKLHFMKDNRPKNMTSIREFHKL 105

Query: 118 VKYYEFPLKYVY--IFENCPEEWIGERDGLMHYLLNRHKKLRINVVSRLKDLVM-EDDFD 174
              Y  PL++ Y  I  N  +  I   +    YL+N +   R NV+  ++ L + ED F+
Sbjct: 106 ENLYLTPLRFTYDLIDTNEMQSLI---NIFKRYLINNNFTFRKNVLHSMETLFLTEDQFE 162

Query: 175 LAM------DVVKWLNESNSNVSSMDLMLDLIVEKISRFCQDQMTGTWNNRFLIMETFNR 228
                    ++V WLN++N NVS +DL+LDL++ KI +FCQ +M G WN RF+IME FN 
Sbjct: 163 FQYNMNSLNEIVIWLNDANGNVSPIDLLLDLLLRKIEKFCQREMAGLWNGRFIIMEKFNL 222

Query: 229 FITSYWSQFCLLL-------ACPEDNHELTTVVYHLFERQFVKLRTKEIFDIVVGVYPDS 281
           FI  YW     L           E++H LT ++Y+ F +QF+K+R  E   I+V  +P S
Sbjct: 223 FINQYWKLISKLFHHQQFDYGDVENDHALTNLIYYFFTQQFIKIRINESLKIMVSNFPIS 282

Query: 282 KPTLLELRRVLVK---------------------SKDFTQIVV-EFLSNFERQILNPSIS 319
            PT++EL+ VL+                      S+++ ++ V +FL +F+R+ LNP I 
Sbjct: 283 TPTIIELKNVLITSSMPRENVSTTATTTFRDTNLSEEYLKLFVKKFLKDFQRKFLNPCIP 342

Query: 320 TVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQER-NDLVTVLLYAILELQSEEFE 378
           T+  + A VK   +FL LDP G+ L ++   +KP  Q R  D+V +LLYA+L L   E  
Sbjct: 343 TIPLIRALVKMTNSFLILDPRGQLLTTIILTLKPLIQRRTTDIVNILLYAMLNLNEMELH 402

Query: 379 G-PARAYLDTNSLNQLSQEL------------KDPEF--------GIESSFETIPQADLL 417
                   D  S N L  EL             +P          G   S E I   D+ 
Sbjct: 403 KLGCNIDFDIESFNILVSELYPTIIKSMNQNQNNPSVVPYTTAGTGTTCSNERITNDDIP 462

Query: 418 ---SRPASTATTAAMLDPR----LPYKSVIKNFLQWTPEPMDTISKNYSK---------S 461
               +  + A T   L  R     P+  + K +L+W P PM+ I  + SK         S
Sbjct: 463 YQNVKDMANANTMEYLARRKPETKPFFDLFKQYLEWVP-PMNKIYDSTSKNTVVDDEETS 521

Query: 462 LSASRNLLDILMDMFESKDFFVSEFXXXXXXX-XXXXXXXXXXXXWSHCLRLLKTKFXXX 520
              SR+ +D L   F+S D  +SE+                    W  CL LLK K    
Sbjct: 522 RIRSRHAIDYLFRFFDSIDLLLSEYLKLLTEKFIHSKNYYTLDNNWLWCLNLLKEK---- 577

Query: 521 XXXXXXXXXXXXXXXXXXXXXXXXXPSNINNIDVMLRDVRGSSELCK-----RMHQVAGL 575
                                     S IN ID+ML D++ S+   K     + + +   
Sbjct: 578 --------------SNSSNVPDENVKSTINTIDIMLNDMKRSASYGKDKKHTKENNMVQG 623

Query: 576 DQRIYPKFISPLYWNRDNSSN---------GWTFQL-------DPQMALELDKYCQVYSE 619
           D   YPK +S LYW + NS+N         G  F L       +P   +++ K  + ++E
Sbjct: 624 DIGFYPKEVSKLYW-KINSTNIAKWRMNMKGDFFHLLKYSKTAEPNHTMDI-KLNRFFNE 681

Query: 620 I-KPGRALHLYKDQGIVVLTLSFQDGRKKRCE-ATLEQCSVIQQFDASTATTTGLTEQM- 676
           + + G+ + LYKD+ ++ + +SF DGR+   +  T+EQ  V+  F         L +   
Sbjct: 682 LGRKGKKMELYKDKSLMEMKISFDDGRELFFDNITIEQYDVLSLFTVEKGAAFTLEKAYD 741

Query: 677 IGARLQMDPARARAALQHWVQEGVLYYDGN--AYKTREYLD--DQPAENLPASKDSSASS 732
             + L+    +    +Q WV + VLY D +   YK  E L   D+  +     +++   S
Sbjct: 742 FFSGLKRGKQKLEECIQFWVDKKVLYLDDDDGCYKVLERLTFLDEIKQRKKMQEETVIKS 801

Query: 733 QARTMSPDRD-------------------------SRLTSILEQTWPFIQGMLTNLGALK 767
            AR M  D D                           + +IL++ +PFI GML NLG++K
Sbjct: 802 DAR-MGIDHDYVQEAAEDDDIAGFETHKDVISRANDEIKNILDRIFPFINGMLENLGSMK 860

Query: 768 VKKIHSFLKVTTPKELGFSMVTPSQLESYLHSLVEEERLICTTNDTYKLPK 818
           ++KIHSFLK+T P++  ++ +   QLE+YL+ LVE+E+L  TT+  +K PK
Sbjct: 861 LEKIHSFLKMTVPRDFEYNRIAIHQLENYLNGLVEDEKLETTTDGAFKKPK 911

>KLLA0D16324g Chr4 complement(1373445..1375538) [2094 bp, 697 aa]
           {ON} weakly similar to uniprot|Q7LGV7 Saccharomyces
           cerevisiae YLR127C
          Length = 697

 Score =  196 bits (498), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 170/676 (25%), Positives = 302/676 (44%), Gaps = 83/676 (12%)

Query: 19  QEVALRTHPNCEDDLESLLTWINPNEPQSNHQCKPPTLRLKNSIKMLVNQYYNMELREDE 78
           +++ L    N E++++ +L W+NP       Q + PTLR+K  +K+++ Q        DE
Sbjct: 13  EKILLNLASNLEEEVDMVLAWLNPT-----FQPQIPTLRIKQCLKVVLEQ-------SDE 60

Query: 79  RDTGYLFIQLVRQFYVYQVRLHFFASLSNLHTFKDVQRLVKYYEFPLKYVYIFENCPEEW 138
           R T +L    + Q+Y+  +R HFF    ++  +KD+ +L K Y   +++++        W
Sbjct: 61  R-TRFL----IEQYYLTLIRTHFFLQFDDIVNWKDMIKLEKLYISKVEFMF---GTSVYW 112

Query: 139 IGER-DGLMHYLLNRHKKLRINVVSRLKDLVMEDDFDLAMDVVKWLNESNSNVSSMDLML 197
           I E        L+ ++ + R  + ++L+  ++++D      + +WL  +      ++  +
Sbjct: 113 IKEEMISFKRLLMKKNNEFRKQLHAKLESHILDNDLVRFDQMYQWLAPAFDG-QEIEFNV 171

Query: 198 DLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLLLACPEDNHELTTVVYHL 257
            +I  K+ +  Q  M    ++R+L+M T+N FI  +WS+F  LL   ED+HELT ++Y  
Sbjct: 172 RIINLKVDQMSQKLMKNKIDDRYLVMNTYNHFIKDFWSKFSKLLII-EDDHELTAIIYQS 230

Query: 258 FERQFVKLRTKEIFDIVVGVYPDSKPTLLELRRVLVKSKDF----TQIVVEFLSNFERQI 313
           FE+ ++K +  E +  +V  +P S+  LLELR +L  +KD     T+++      F  + 
Sbjct: 231 FEKNYIKYKCDEFYTDIVPKFPASRKCLLELRSIL--NKDIKTVGTKVLETLYHGFVSRF 288

Query: 314 LNPSISTVNALLAYVKTVKAFLTLDPTGRCLNSVSAFVKPYFQERNDLVTVLLYAILELQ 373
           L  S+ T   L  Y+KTVK    +DP G CL S+S  V+ Y   R D++  LL  I   Q
Sbjct: 289 LTSSLLTCEILYYYIKTVKCLKIIDPMGICLRSLSKAVRVYLNPRPDIIKTLLLGIFPFQ 348

Query: 374 SEEFEGPARAY----LDTNSLNQLSQELKDPEFGIESSFETIPQA-DLLSRPASTATTAA 428
           + E    A +     +    L Q S+E+ D   G E     +P A    ++P        
Sbjct: 349 NNERFKIASSTDGSSVHLEKLEQFSREVGDFSMGPE-----LPTALPWFNQPHL------ 397

Query: 429 MLDPRLPYKS---VIKNFLQWTPEP------MDTISKNYSKSLSASRNLLDILMDMFESK 479
              PR  Y     ++K +L W PEP      ++  + N  K +    +L+ +L+D+ ESK
Sbjct: 398 ---PRCTYDGDDQLLKQYLNWVPEPPRIKLDVEDFADNDGKYVPPV-DLIHVLLDVLESK 453

Query: 480 DFFVSEFXXXXXXXXXXXXXXXXXXXWSHCLRLLKTKFXXXXXXXXXXXXXXXXXXXXXX 539
              V +                    W   + ++                          
Sbjct: 454 RTLVDDLLGVVSGKFIESEEYSLDPEWQRIMDIILNHLEGTRKGTVTSEEADL------- 506

Query: 540 XXXXXXPSNINNIDVMLRDVRGSSELCKRMHQVAGLDQRIYP--KFISPLYWNRDNSSNG 597
                  +++N++D+ML D+R SS+   ++          +P  K +S LYW    + NG
Sbjct: 507 -------THLNDVDIMLEDLRLSSQFRNQVAHKNNSHFENFPHIKILSKLYWRHYQNLNG 559

Query: 598 ----WTFQLDPQMALELDKYCQVYSEIKPGRALHLYKDQGI---VVLTLSFQDGRKKRCE 650
                 ++ D +M   + K  +VY  +  GR L    D G    V + +  + G ++  +
Sbjct: 560 RLVTTKYKWDSEMEPLIQKLTKVYERLNTGRTLKF--DTGSSSRVSINIVTKSGERRFFK 617

Query: 651 ATLEQCSVIQQFDAST 666
            T+EQ  VI  F   T
Sbjct: 618 VTMEQYLVISHFQNET 633

>AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR052W
           (FMP48)
          Length = 479

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 70/162 (43%), Gaps = 31/162 (19%)

Query: 102 FASLSNLHTFKDVQRLVKYYEFPLKYVYIFENCPEEWIGERDGLMHYLLNRHKKLRINVV 161
           +A L  L T +++ +L+ +YE    YV++ E C     G+    +  +  R   +RIN  
Sbjct: 59  YAILRRLGTHRNICQLLDFYEDADTYVFVLEYCA---YGDLYDFIKAIRER-PTMRINFH 114

Query: 162 SRLKDLVMEDDFDLAMDVVKWLNESNSNVSSMDLML---------DLIVEKISRFCQDQM 212
           S L  L     +  + DV      S+ ++   ++++         D  + +I    +D  
Sbjct: 115 SFLFQLCSAISYCHSKDV------SHRDIKPENVLMDDRGQVKLTDFGLSQIGSVSKDYC 168

Query: 213 TGTWNNRFLIMETF-----NRFITSYWSQ----FCLLLA-CP 244
            GT   ++L  ETF     N F T YWS     FCL+   CP
Sbjct: 169 IGT--EKYLAPETFLREYHNTFATDYWSLGITIFCLMFGSCP 208

>Smik_5.123 Chr5 complement(172159..176259) [4101 bp, 1366 aa] {ON}
            YER008C (REAL)
          Length = 1366

 Score = 35.0 bits (79), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 67/146 (45%), Gaps = 10/146 (6%)

Query: 197  LDLIVEKISRFCQDQMTGTWNNRFLIMETFNRFITSYWSQFCLLLACPEDNHELTTVVYH 256
            +D+  +++S+   +Q+   WN  F      N     +  +F LL  C +   +   +VY 
Sbjct: 914  IDVNHDRMSKLSLNQLLQQWNT-FRKERKINDANPVFKEKFSLLTECIQVIRQ-ECIVYQ 971

Query: 257  LFERQFVKLRTKEIFDIVVGVY--PDSKPTLLELRRVLVKSKDFTQIVVEFLSNFERQIL 314
             F   F  + +K  F+  +  +  PD+ P LL+  RV+   ++   I  + +S    +I 
Sbjct: 972  NFVEVFFHISSKHNFETYIKHFNDPDTPPILLDAVRVMQSDREAAVIETQLVS----RIF 1027

Query: 315  NPSISTVNALLAYVKTVKAFLTLDPT 340
             P ++ +++   +V+ VK   T+ P 
Sbjct: 1028 QPIVTRLSSY--FVELVKTEPTVAPA 1051

>Skud_15.541 Chr15 (979046..980605) [1560 bp, 519 aa] {ON} YOR374W
           (REAL)
          Length = 519

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 61/158 (38%), Gaps = 24/158 (15%)

Query: 268 KEIFDIVVGVYPDSKPTLLELRRVLVKSKDFTQIVVEFLSNFER------------QILN 315
           K + +I++G+Y +S        RV V+   + + + EF +  E             Q   
Sbjct: 307 KAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKTASESIKVGDPFDESTFQGAQ 366

Query: 316 PSISTVNALLAYVKTVKA-FLTLDPTGRCLNSVSAFVKP--YFQERNDLVTVLLYAILEL 372
            S   +N +L YV   K+   TL   G  L S   FVKP  +   + D+  V        
Sbjct: 367 TSQMQLNKILKYVDIGKSEGATLVTGGERLGSKGYFVKPTVFGDVKEDMRIV-------- 418

Query: 373 QSEEFEGPARAYLDTNSLNQLSQELKDPEFGIESSFET 410
             EE  GP        S +++     D E+G+ +   T
Sbjct: 419 -KEEIFGPVVTVTKFKSTDEVISMANDSEYGLAAGIHT 455

>TDEL0H04450 Chr8 (768317..769876) [1560 bp, 519 aa] {ON} Anc_7.6
           YOR374W
          Length = 519

 Score = 33.5 bits (75), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 34/155 (21%), Positives = 68/155 (43%), Gaps = 24/155 (15%)

Query: 272 DIVVGVYPDSKPTLLELRRVLVKSKDFTQIVVEF-LSNFERQILNP-----------SIS 319
           +I++G+Y +S        RV V+   + +++ +F +++   ++ +P           S +
Sbjct: 312 NIILGIYYNSGEVCCAGSRVYVEQSAYDELIKQFKVASEAVKVGDPFDENTFQGAQTSQN 371

Query: 320 TVNALLAYVKTVK-AFLTLDPTGRCLNSVSAFVKP--YFQERNDLVTVLLYAILELQSEE 376
            +N +L+YV+  K    TL   G  +     FVKP  +   + D+  V          EE
Sbjct: 372 QLNKILSYVEIGKDEGATLITGGERIGDKGYFVKPTVFGDVKEDMRIV---------KEE 422

Query: 377 FEGPARAYLDTNSLNQLSQELKDPEFGIESSFETI 411
             GP        SL+++ +   D E+G+ +   T+
Sbjct: 423 IFGPVVTVTKFKSLDEVVEMANDSEYGLAAGIHTL 457

>Smik_15.556 Chr15 (985895..987454) [1560 bp, 519 aa] {ON} YOR374W
           (REAL)
          Length = 519

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 60/158 (37%), Gaps = 24/158 (15%)

Query: 268 KEIFDIVVGVYPDSKPTLLELRRVLVKSKDFTQIVVEFLSNFER------------QILN 315
           K + +I++G+Y +S        RV V+   + + + EF +  E             Q   
Sbjct: 307 KAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASESIKVGDPFDESTFQGAQ 366

Query: 316 PSISTVNALLAYVKTVKA-FLTLDPTGRCLNSVSAFVKP--YFQERNDLVTVLLYAILEL 372
            S   +N +L YV   K    TL   G  L S   F+KP  +   + D+  V        
Sbjct: 367 TSQMQLNKILKYVDIGKGEGATLITGGERLGSKGYFIKPTVFGDVKEDMRIV-------- 418

Query: 373 QSEEFEGPARAYLDTNSLNQLSQELKDPEFGIESSFET 410
             EE  GP        S +++     D E+G+ +   T
Sbjct: 419 -KEEIFGPVVTVTKFKSTDEVINMANDSEYGLAAGIHT 455

>Smik_13.397 Chr13 (631479..633656) [2178 bp, 725 aa] {ON} YMR192W
           (REAL)
          Length = 725

 Score = 32.7 bits (73), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 61/130 (46%), Gaps = 13/130 (10%)

Query: 76  EDERDTGYLFIQLVRQFYVYQVRLHFFASLSNLHTF-KDVQRLVKYYEFPLKYVYIFENC 134
           E+E +   LF++L++   VY +RL F  S S +        RLV+ +     Y  I+ N 
Sbjct: 392 ENEANAFGLFVRLMK---VYGLRLLFLPSASEVDILCYKFDRLVEEF-----YPDIYSNM 443

Query: 135 PEEWIGERDGLMHYLLNR-HKKLRINVVSRLKDLVMEDDFDLAMDV-VKWLNESNSNVSS 192
            E+ +     L  +L     KKL I +  R+ D++  +  D  M + V  L  S   +S 
Sbjct: 444 VEKGVRSSMFLPGFLTTLFQKKLPIEIQPRIGDMIFLESLDSTMRILVTLLCNSRDELSK 503

Query: 193 MDL--MLDLI 200
           MD   ML+L+
Sbjct: 504 MDFDDMLELL 513

>YOR374W Chr15 (1039840..1041399) [1560 bp, 519 aa] {ON}
           ALD4Mitochondrial aldehyde dehydrogenase, required for
           growth on ethanol and conversion of acetaldehyde to
           acetate; phosphorylated; activity is K+ dependent;
           utilizes NADP+ or NAD+ equally as coenzymes; expression
           is glucose repressed
          Length = 519

 Score = 32.0 bits (71), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 37/158 (23%), Positives = 60/158 (37%), Gaps = 24/158 (15%)

Query: 268 KEIFDIVVGVYPDSKPTLLELRRVLVKSKDFTQIVVEFLSNFER------------QILN 315
           K + +I++G+Y +S        RV V+   + + + EF +  E             Q   
Sbjct: 307 KAVQNIILGIYYNSGEVCCAGSRVYVEESIYDKFIEEFKAASESIKVGDPFDESTFQGAQ 366

Query: 316 PSISTVNALLAYVKTVK-AFLTLDPTGRCLNSVSAFVKP--YFQERNDLVTVLLYAILEL 372
            S   +N +L YV   K    TL   G  L S   F+KP  +   + D+  V        
Sbjct: 367 TSQMQLNKILKYVDIGKNEGATLITGGERLGSKGYFIKPTVFGDVKEDMRIV-------- 418

Query: 373 QSEEFEGPARAYLDTNSLNQLSQELKDPEFGIESSFET 410
             EE  GP        S +++     D E+G+ +   T
Sbjct: 419 -KEEIFGPVVTVTKFKSADEVINMANDSEYGLAAGIHT 455

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.135    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 81,444,444
Number of extensions: 3493098
Number of successful extensions: 10886
Number of sequences better than 10.0: 41
Number of HSP's gapped: 11072
Number of HSP's successfully gapped: 58
Length of query: 818
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 700
Effective length of database: 39,950,811
Effective search space: 27965567700
Effective search space used: 27965567700
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 70 (31.6 bits)