Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F10230g8.318ON58058024880.0
Suva_10.2118.318ON56648511121e-145
YLR120C (YPS1)8.318ON56950310961e-143
ZYRO0F10274gsingletonON57248910891e-141
NCAS0B035608.318ON58650410731e-139
Smik_12.1868.318ON57249110681e-138
SAKL0H15664g8.318ON55652910671e-138
ZYRO0G02904gsingletonON53151610351e-134
YDR144C (MKC7)8.318ON59648410391e-134
Suva_2.3058.318ON59748510391e-134
TDEL0F044508.318ON52450910281e-133
Kwal_26.7254singletonON57052010251e-132
Smik_4.3888.318ON59751010001e-128
Skud_4.4038.318ON5904849911e-127
Kwal_56.239028.318ON6295139351e-118
Kpol_543.618.318ON5883139101e-114
CAGL0M04191g8.318ON6013139081e-114
Skud_12.1928.318ON5693138691e-109
ZYRO0F10252gsingletonON5513148631e-108
KAFR0B057108.318ON5753088611e-107
TBLA0H012908.318ON6673158651e-107
TBLA0E02630singletonON6893158641e-106
TPHA0A015808.318ON6003128421e-104
KAFR0H023008.318ON5213108331e-104
YLR121C (YPS3)8.319ON5083138191e-102
Skud_12.1938.319ON4973148131e-101
Smik_12.1878.319ON5073138051e-100
KNAG0I009108.318ON5693218091e-100
NCAS0C033008.318ON5593148042e-99
NDAI0G026208.318ON5903167932e-97
Suva_10.2128.319ON7453168026e-97
KNAG0G024108.318ON5303167841e-96
ZYRO0E02266gsingletonON5064867723e-95
NDAI0J010308.318ON6523197816e-95
SAKL0C02970gsingletonON5924887741e-94
ZYRO0F10318g8.319ON4863247548e-93
TBLA0D00140singletonON6073277578e-92
KAFR0B06530singletonON5383137501e-91
KLTH0G12386g8.318ON5803127495e-91
KLLA0E04049g8.318ON5893137383e-89
KNAG0E03220singletonON5403137343e-89
TBLA0A039108.318ON5963137393e-89
Ecym_42518.318ON5023187201e-87
AGL192W8.318ON4993177113e-86
CAGL0E01419g8.318ON5913307096e-85
KLTH0F06754gsingletonON7674847137e-84
KAFR0I01700singletonON5523166926e-83
KAFR0E03940singletonON6383126979e-83
Kwal_33.14239singletonON6513166953e-82
Suva_9.13singletonON4643106534e-78
SAKL0F07172g7.182ON5423136569e-78
Suva_16.14singletonON5403116482e-76
CAGL0E01749gsingletonON4823186335e-75
CAGL0E01837gsingletonON5213166331e-74
CAGL0E01793gsingletonON5163186303e-74
CAGL0E01771gsingletonON5193156261e-73
ZYRO0F10296gsingletonON5283116192e-72
YIR039C (YPS6)singletonON5373126174e-72
KNAG0I009008.319ON5313116113e-71
KNAG0I01200singletonON6773196125e-70
Suva_34.1singletonON3872975899e-70
CAGL0E01881gsingletonON5083225753e-66
CAGL0E01815gsingletonON5193225736e-66
Smik_65.1singletonON3422935581e-65
KAFR0B06700singletonON5312955703e-65
KLLA0D15917g7.182ON5113185431e-61
CAGL0E01859gsingletonON5053205421e-61
NCAS0A124607.182ON5403085381e-60
TPHA0C008408.318ON10002995561e-60
Skud_9.1547.182ON5163135133e-57
YIL015W (BAR1)7.182ON5873155131e-56
Smik_9.1757.182ON5933135103e-56
ZYRO0D15554g7.182ON5213064941e-54
NDAI0B017207.182ON5473244845e-53
CAGL0E01727gsingletonON5392944793e-52
Ecym_43947.182ON5183164773e-52
SAKL0E15356gsingletonON5573314794e-52
TDEL0H026507.182ON5523054715e-51
KNAG0H027607.182ON5633084471e-47
Smik_5.7singletonON3042154241e-46
Suva_79.1singletonON2272304092e-45
CAGL0J02288g7.182ON5413004171e-43
AGR240W7.182ON4523183883e-40
SAKL0H00330gsingletonON5783183722e-37
Kpol_1063.227.182ON3362083514e-36
TBLA0D045807.182ON3953323511e-35
Smik_6.3518.677ON4053082593e-23
Skud_16.1288.677ON4053082583e-23
Suva_16.1568.677ON4063082566e-23
YPL154C (PEP4)8.677ON4053082558e-23
NDAI0E021058.677ON4083052531e-22
NCAS0C013608.677ON4063052512e-22
KNAG0J017108.677ON4153052478e-22
TBLA0B038308.677ON4133072415e-21
Kwal_26.88028.677ON4123122399e-21
KLTH0D11264g8.677ON4173122353e-20
SAKL0H06512g8.677ON4043042344e-20
Suva_9.1877.182ON3331522306e-20
TPHA0D012608.677ON4193142292e-19
Suva_9.186singletonOFF5431602312e-19
Kpol_1072.158.677ON3993042282e-19
ZYRO0F07392g8.677ON4183092282e-19
KLLA0D05929g8.677ON4093042239e-19
Kpol_1013.68.677ON4023042184e-18
KAFR0H024208.677ON4162922175e-18
TDEL0A062308.677ON4083082132e-17
ACR144W8.677ON4083162033e-16
AGR407CsingletonON2682991957e-16
CAGL0M02211g8.677ON4153091963e-15
Smik_5.6singletonON123951794e-15
Ecym_23968.677ON4153061928e-15
YDR349C (YPS7)5.401ON5962891893e-14
Ecym_13245.401ON5762971851e-13
KLLA0F22088g5.401ON5583001832e-13
Skud_4.6185.401ON5862851822e-13
Kwal_55.200345.401ON5932091787e-13
Smik_4.6135.401ON5962851761e-12
KLTH0E02596g5.401ON5962021752e-12
Suva_2.5205.401ON5982061644e-11
NDAI0C046105.401ON6092841644e-11
Suva_62.1singletonON252761566e-11
ACR143WsingletonON3933081591e-10
ACR150W5.401ON5532241563e-10
TDEL0E022305.401ON5732281483e-09
YGL258W-AsingletonON77541289e-09
KAFR0E040805.401ON5962861441e-08
ZYRO0A06578g5.401ON7203151431e-08
CAGL0A02431g5.401ON5872631403e-08
Smik_67.1singletonON110691231e-07
TPHA0E019205.401ON6241931322e-07
NCAS0F031505.401ON6452341313e-07
KNAG0C051405.401ON5982221242e-06
SAKL0G07524g5.401ON6321811207e-06
Kpol_1059.335.401ON6623011208e-06
YGL259W (YPS5)singletonON165691129e-06
TBLA0H016805.401ON6091901101e-04
Ecym_4614na 1ON481134830.15
ABL123Cna 1ON494313830.16
SAKL0D01408gna 1ON506126723.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F10230g
         (580 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {...   962   0.0  
Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {...   432   e-145
YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON} ...   426   e-143
ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {...   424   e-141
NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {O...   417   e-139
Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {...   416   e-138
SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} simi...   415   e-138
ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} simila...   403   e-134
YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}  ...   404   e-134
Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON...   404   e-134
TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {O...   400   e-133
Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C...   399   e-132
Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON...   389   e-128
Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON...   386   e-127
Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {...   364   e-118
Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {O...   355   e-114
CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa] ...   354   e-114
Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {...   339   e-109
ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {...   337   e-108
KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa] ...   336   e-107
TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.3...   337   e-107
TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {O...   337   e-106
TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.3...   328   e-104
KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.3...   325   e-104
YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON} ...   320   e-102
Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {...   317   e-101
Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {...   314   e-100
KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON}              316   e-100
NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON}              314   2e-99
NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A   310   2e-97
Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {...   313   6e-97
KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {O...   306   1e-96
ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {...   301   3e-95
NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON}             305   6e-95
SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some s...   302   1e-94
ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {...   295   8e-93
TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON}                296   8e-92
KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON}            293   1e-91
KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} simi...   293   5e-91
KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} simila...   288   3e-89
KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {O...   287   3e-89
TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {O...   289   3e-89
Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}...   281   1e-87
AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic ho...   278   3e-86
CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} simila...   277   6e-85
KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly...   279   7e-84
KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {O...   271   6e-83
KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON}              273   9e-83
Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144...   272   3e-82
Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)   256   4e-78
SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {...   257   9e-78
Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C (...   254   2e-76
CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {...   248   5e-75
CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {...   248   1e-74
CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {...   247   3e-74
CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {...   245   1e-73
ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {...   243   2e-72
YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}  ...   242   4e-72
KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON}              239   3e-71
KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON}              240   5e-70
Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR0...   231   9e-70
CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} simila...   226   3e-66
CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {...   225   6e-66
Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)       219   1e-65
KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa] ...   224   3e-65
KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]...   213   1e-61
CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {...   213   1e-61
NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa] ...   211   1e-60
TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8....   218   1e-60
Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W ...   202   3e-57
YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspart...   202   1e-56
Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W ...   201   3e-56
ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]...   194   1e-54
NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {O...   191   5e-53
CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} simila...   189   3e-52
Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar t...   188   3e-52
SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weak...   189   4e-52
TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.1...   186   5e-51
KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.1...   176   1e-47
Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)       167   1e-46
Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C...   162   2e-45
CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa] ...   165   1e-43
AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic ...   154   3e-40
SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON...   147   2e-37
Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON} (50979....   139   4e-36
TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa] ...   139   1e-35
Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C ...   104   3e-23
Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {...   103   3e-23
Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {...   103   6e-23
YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON} ...   102   8e-23
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}    102   1e-22
NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {O...   101   2e-22
KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8....   100   8e-22
TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {O...    97   5e-21
Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C...    97   9e-21
KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly...    95   3e-20
SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {...    95   4e-20
Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W ...    93   6e-20
TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.6...    93   2e-19
Suva_9.186 Chr9 (310161..310220,310267..310332,310362..310451,31...    94   2e-19
Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {O...    92   2e-19
ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly...    92   2e-19
KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly...    91   9e-19
Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON} (10059.....    89   4e-18
KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {O...    88   5e-18
TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON} Anc_8...    87   2e-17
ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic ho...    83   3e-16
AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON} ...    80   7e-16
CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa] ...    80   3e-15
Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)        74   4e-15
Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}...    79   8e-15
YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}...    77   3e-14
Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}...    76   1e-13
KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weak...    75   2e-13
Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {...    75   2e-13
Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349...    73   7e-13
Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {...    72   1e-12
KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly...    72   2e-12
Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON...    68   4e-11
NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa] ...    68   4e-11
Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C...    65   6e-11
ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic ho...    66   1e-10
ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic ho...    65   3e-10
TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.4...    62   3e-09
YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protei...    54   9e-09
KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.4...    60   1e-08
ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} simila...    60   1e-08
CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {...    59   3e-08
Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)        52   1e-07
TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.4...    55   2e-07
NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {O...    55   3e-07
KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5....    52   2e-06
SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} simila...    51   7e-06
Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON} (70588....    51   8e-06
YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein wit...    48   9e-06
TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.4...    47   1e-04
Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {O...    37   0.15 
ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON} N...    37   0.16 
SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly...    32   3.2  

>ZYRO0F10230g Chr6 complement(826246..827988) [1743 bp, 580 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  962 bits (2488), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/580 (83%), Positives = 487/580 (83%)

Query: 1   MKWNQILKCTLLANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVK 60
           MKWNQILKCTLLANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVK
Sbjct: 1   MKWNQILKCTLLANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVK 60

Query: 61  RDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKK 120
           RDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKK
Sbjct: 61  RDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKK 120

Query: 121 RDIGDNSLDDIFSDITAGGSGAIYKTLTLTXXXXXXXXXXXXXIDVSXXXXXXXXXXXXX 180
           RDIGDNSLDDIFSDITAGGSGAIYKTLTLT             IDVS             
Sbjct: 121 RDIGDNSLDDIFSDITAGGSGAIYKTLTLTGGSMPSSFGSFGSIDVSTGGIEPTETISGG 180

Query: 181 XXXXXXXXXXXXXXXXQSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDH 240
                           QSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDH
Sbjct: 181 GGGSGGSPTGSSSSGGQSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDH 240

Query: 241 IELGSLNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKE 300
           IELGSLNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKE
Sbjct: 241 IELGSLNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKE 300

Query: 301 RGITKKNVYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVT 360
           RGITKKNVYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVT
Sbjct: 301 RGITKKNVYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVT 360

Query: 361 LQGLGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDC 420
           LQGLGLSNQ         KIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDC
Sbjct: 361 LQGLGLSNQTSTTTLSTTKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDC 420

Query: 421 PSKHDETKIVFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVY 480
           PSKHDETKIVFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVY
Sbjct: 421 PSKHDETKIVFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVY 480

Query: 481 DLEDFEISMAQANFDVNHEDIEVVSSSIPQXXXXXXXXXXXXXXXXXXXXXNIFXXXXXX 540
           DLEDFEISMAQANFDVNHEDIEVVSSSIPQ                     NIF      
Sbjct: 481 DLEDFEISMAQANFDVNHEDIEVVSSSIPQATAAAGYSSTYSSSKSITSGGNIFSSGTLS 540

Query: 541 XXXXXXXXXXXXXXXMAAAPVQIAPTSLLATIFFAISMFF 580
                          MAAAPVQIAPTSLLATIFFAISMFF
Sbjct: 541 GSASNTASGNNKSKNMAAAPVQIAPTSLLATIFFAISMFF 580

>Suva_10.211 Chr10 complement(394404..396104) [1701 bp, 566 aa] {ON}
           YLR120C (REAL)
          Length = 566

 Score =  432 bits (1112), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 228/485 (47%), Positives = 314/485 (64%), Gaps = 36/485 (7%)

Query: 31  KIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKI 90
           K VKLSFDK +G++ + +   K+  +   KR DG  E+ + N+Q+FYSVDLEVG+P+Q I
Sbjct: 38  KFVKLSFDKLYGDSLDTAGRDKKPEVRLSKRADGYEEIIITNQQSFYSVDLEVGTPAQNI 97

Query: 91  TVLLDTGSSDLWITGSDNPYCKSNSHSS---KKRDIGDNSLDDIFSDITAGGSGAIYKTL 147
           TVL+DTGSSDLWI GS NPYC S+  S    +KRD   +S  D+ +DI     G + +T 
Sbjct: 98  TVLVDTGSSDLWIMGSSNPYCSSDDSSKYVLRKRDTSSSS-GDLVNDINP--FGWLTETG 154

Query: 148 TLTXXXXXXXXXXXXXIDVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSIDCSRYGTF 207
           ++T               V                               ++DC  YGTF
Sbjct: 155 SVTGATATATGSGTATQSVPASE--------------------------ATMDCEEYGTF 188

Query: 208 DKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLG 267
             + SST+KSNNTAFEISYGDG+FA+G +G D + L  LN++ +S AVAN+TNST+GVLG
Sbjct: 189 TSSDSSTFKSNNTAFEISYGDGTFAAGTFGTDVLNLSDLNVTGLSFAVANETNSTMGVLG 248

Query: 268 IGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSILFGA 327
           IGLP LE TYS   +   G  + Y NFP+VLK  G  K N YSLYLN  DA +G+ILFG 
Sbjct: 249 IGLPSLEVTYSGSSASNGGKSYKYDNFPIVLKNSGAIKSNAYSLYLNDSDAKHGTILFGG 308

Query: 328 VDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLG-LSNQXXXXXXXXXKIPALLDS 386
           VD +K+ G+LYT+ ++N     G + PIQFD+TL GLG + +          KIP LLDS
Sbjct: 309 VDHNKYSGTLYTVALVNTLS--GFTSPIQFDITLNGLGIIDDNGDEKTLTTTKIPVLLDS 366

Query: 387 GSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNLTTYT 446
           G+TL YLP +++E++A+ +GA++S  + YY+M+CPS  + T+IVF+FGGF+I  +L+++ 
Sbjct: 367 GTTLTYLPVEMVELIAENVGAQYSSRIGYYVMECPSSDNSTEIVFDFGGFHINASLSSFI 426

Query: 447 TPISSDTCVLRILPSGDSS-AILGDAFLVHAYVVYDLEDFEISMAQANFDVNHEDIEVVS 505
              S +TC+L I+P+ DS+ +ILGD+FL +AYVVYDLE+ EISMAQA ++V  EDIEV+S
Sbjct: 427 LSTSGNTCLLGIIPTSDSTGSILGDSFLTNAYVVYDLENLEISMAQAKYNVTSEDIEVIS 486

Query: 506 SSIPQ 510
           +S+P 
Sbjct: 487 TSVPN 491

>YLR120C Chr12 complement(386511..388220) [1710 bp, 569 aa] {ON}
           YPS1Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 569

 Score =  426 bits (1096), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 234/503 (46%), Positives = 315/503 (62%), Gaps = 47/503 (9%)

Query: 20  AFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSV 79
           A ++  ++   K VKL F K +G++ E     K+  +  +KR DG  E+ + N+Q+FYSV
Sbjct: 26  AANKRDDDSNSKFVKLPFHKLYGDSLENVGSDKKPEVRLLKRADGYEEIIITNQQSFYSV 85

Query: 80  DLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKKRDI---------GDNSLDD 130
           DLEVG+P Q +TVL+DTGSSDLWI GSDNPYC SNS  S +R +         G + ++D
Sbjct: 86  DLEVGTPPQNVTVLVDTGSSDLWIMGSDNPYCSSNSMGSSRRRVIDKRDDSSSGGSLIND 145

Query: 131 I--FSDITAGGSGAIYKTLTLTXXXXXXXXXXXXXIDVSXXXXXXXXXXXXXXXXXXXXX 188
           I  F  +T  GS AI  T T                                        
Sbjct: 146 INPFGWLTGTGS-AIGPTAT-------------------------------GLGGGSGTA 173

Query: 189 XXXXXXXXQSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNI 248
                    ++DC +YGTF  + SST++SNNT F ISYGDG+FASG +G D ++L  LN+
Sbjct: 174 TQSVPASEATMDCQQYGTFSTSGSSTFRSNNTYFSISYGDGTFASGTFGTDVLDLSDLNV 233

Query: 249 SDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNV 308
           + +S AVAN+TNST+GVLGIGLP LE TYS   +  SG  + Y NFP+VLK  G  K N 
Sbjct: 234 TGLSFAVANETNSTMGVLGIGLPELEVTYSGSTASHSGKAYKYDNFPIVLKNSGAIKSNT 293

Query: 309 YSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSN 368
           YSLYLN  DA +G+ILFGAVD SK+ G+LYTIPI+N   + G S PIQFDVT+ G+G+S+
Sbjct: 294 YSLYLNDSDAMHGTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGISD 353

Query: 369 Q-XXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDET 427
                      KIPALLDSG+TL YLP+ ++ M+A  LGA++S  + YY++DCPS  D  
Sbjct: 354 SGSSNKTLTTTKIPALLDSGTTLTYLPQTVVSMIATELGAQYSSRIGYYVLDCPSD-DSM 412

Query: 428 KIVFNFGGFNIETNLTTYTTPISSDTCVLRILP-SGDSSAILGDAFLVHAYVVYDLEDFE 486
           +IVF+FGGF+I   L+++     + TC+L I+P S D+  ILGD+FL +AYVVYDLE+ E
Sbjct: 413 EIVFDFGGFHINAPLSSFILSTGT-TCLLGIIPTSDDTGTILGDSFLTNAYVVYDLENLE 471

Query: 487 ISMAQANFDVNHEDIEVVSSSIP 509
           ISMAQA ++   E+IE+++SS+P
Sbjct: 472 ISMAQARYNTTSENIEIITSSVP 494

>ZYRO0F10274g Chr6 complement(831057..832775) [1719 bp, 572 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 572

 Score =  424 bits (1089), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 230/489 (47%), Positives = 311/489 (63%), Gaps = 24/489 (4%)

Query: 25  VEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVG 84
           +E+ +  +VKLSF+K HG  YEES L +R       R++ E+   + N+QNFYSVDL VG
Sbjct: 22  IEQTSSPMVKLSFNKWHGPTYEESSLERRS---LETRNNKEFNFIVENQQNFYSVDLLVG 78

Query: 85  SPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKKRDIGDNSLDDIFSDITAGGSGAIY 144
           +P Q ITVLLDTGSSDLW+T  +NPYCKSN+ S+ K++  D  L+D       G + +I 
Sbjct: 79  TPGQNITVLLDTGSSDLWLTAKNNPYCKSNAGSNDKKE--DYRLED-------GDNQSIV 129

Query: 145 KTLTLTXXXXXXXXXXXXXIDVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSIDCSRY 204
             LT +               +S                              ++DCS+Y
Sbjct: 130 SMLTASGTGTNPIGGSGIPTAISGSAQLTGTYTSGTGTGPSGSSPE------PTMDCSQY 183

Query: 205 GTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVG 264
           GTFD N+S +++SN T F ISYGDGSFASG WG D +   ++N+  VS AVAN+TNSTVG
Sbjct: 184 GTFDVNKSKSFRSNKTEFYISYGDGSFASGYWGTDSVNFANMNLEGVSFAVANETNSTVG 243

Query: 265 VLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSIL 324
           V GIGLP  E TY+ D S+     + Y NFP VLK +G   K  YSL+LNS DA +G IL
Sbjct: 244 VFGIGLPENEATYTPDPSLNDFHPYEYQNFPQVLKSKGAINKAAYSLFLNSLDASSGDIL 303

Query: 325 FGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXXKIPALL 384
           FGAVD+SK+ G LYT+P+LN   ++    P++FDVTLQG+G +N          KIPALL
Sbjct: 304 FGAVDRSKYKGDLYTLPLLNSDPTK-YKNPMEFDVTLQGVGFTNGSSKTTFTTTKIPALL 362

Query: 385 DSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNLTT 444
           DSG++L YLP+ L + +A  LG  ++E++ YY++ CPS++D++++VF+FGGF I+ NL+ 
Sbjct: 363 DSGTSLIYLPDALAKGIAHKLGGSYNEDIGYYVIGCPSENDDSQLVFDFGGFTIKNNLSN 422

Query: 445 YT--TPISSD--TCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNHED 500
           Y   +P   D   CVL ILPS D  AILGD FL  AYVVYDL+D+E+S+AQA+FD + ED
Sbjct: 423 YLLGSPDDGDDSQCVLGILPS-DVQAILGDVFLADAYVVYDLDDYEVSLAQASFDNSKED 481

Query: 501 IEVVSSSIP 509
           I+++S SIP
Sbjct: 482 IQIISDSIP 490

>NCAS0B03560 Chr2 complement(629374..631134) [1761 bp, 586 aa] {ON} 
          Length = 586

 Score =  417 bits (1073), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 225/504 (44%), Positives = 309/504 (61%), Gaps = 20/504 (3%)

Query: 11  LLANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYE-LS 69
           L  N+  S     E  +Q+ K V L F+K  G++YE++   K+     VKRD G YE ++
Sbjct: 15  LFTNILASTIPEHETTDQSSKYVILPFNKLVGDSYEDATPDKKPHFALVKRD-GSYENVA 73

Query: 70  LRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKKRDIGDNSLD 129
           ++N Q+FYSV+L +G+PSQKITVL+DTGSSDLWI GSDNPYC S S+        D++L 
Sbjct: 74  IKNEQSFYSVELLIGTPSQKITVLVDTGSSDLWIMGSDNPYCASTSNGKNVMRKDDSNLP 133

Query: 130 D--IFSDITAGGSGAIYKTLTLTXXXXXXXXXXXXXIDVSXXXXXXXXXXXXXXXXXXXX 187
           D  +F++IT      +     LT              D+                     
Sbjct: 134 DGILFTEIT------VTNLSDLTGFFSDFSFIPMSETDIPTGVTSTNTVGGPVFPTQTNN 187

Query: 188 XXXXXXXXXQSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLN 247
                    ++IDCS+YGTFDKNQSST+++N T+F  SYGD +FASG W  D + LG LN
Sbjct: 188 IALSE----RTIDCSQYGTFDKNQSSTFQTNFTSFLTSYGDSTFASGTWAHDVLNLGGLN 243

Query: 248 ISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKN 307
           I+ +S AVAN +NSTVGVLGIGLPGLETTYS   S +    + Y+NFPM+LK+ G     
Sbjct: 244 ITGLSFAVANMSNSTVGVLGIGLPGLETTYSGSTSKL----YQYNNFPMLLKQSGAIDST 299

Query: 308 VYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLS 367
            YSL+L+  DA  GS+LFGAVD +K+ G+LYT+P++N+  S+G   PIQFDVTL G+G+ 
Sbjct: 300 SYSLFLDDLDAKQGSVLFGAVDHTKYVGNLYTVPMVNILASKGYPNPIQFDVTLAGIGIQ 359

Query: 368 NQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDET 427
           N          K PALLDSG+T++Y P+++++ +A  LGAR+S  L +Y M C      T
Sbjct: 360 NDSKNYTVTTNKFPALLDSGTTISYFPQEVVQTIARQLGARYSSALGFYAMSCNGVSSST 419

Query: 428 KIVFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEI 487
             VF+FGGF+I   ++ +  P S +TCVL + P      +LGD FL HAYVVYDL+++EI
Sbjct: 420 NFVFDFGGFHITGPVSDFLLPTSGNTCVLAMAPQESQHILLGDIFLTHAYVVYDLDNYEI 479

Query: 488 SMAQANFDVNHED--IEVVSSSIP 509
           S+AQAN    + D  I+++S S+P
Sbjct: 480 SLAQANTGTQNLDSNIQIISDSVP 503

>Smik_12.186 Chr12 complement(367771..369489) [1719 bp, 572 aa] {ON}
           YLR120C (REAL)
          Length = 572

 Score =  416 bits (1068), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 228/491 (46%), Positives = 306/491 (62%), Gaps = 45/491 (9%)

Query: 31  KIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKI 90
           K VKL F K +G++ +     K+      KR DG  E+ + N+Q+FYSV+L+VGSP Q +
Sbjct: 40  KFVKLPFHKLYGDSLDNVGRDKKPEAHLFKRADGYEEIIITNQQSFYSVELDVGSPPQNV 99

Query: 91  TVLLDTGSSDLWITGSDNPYCKSNSHSSKKRDIGDNSLDD-----IFSDIT-----AGGS 140
           TVL+DTGSSDLWI GS+NPYC S++ S+ +R + D   D      + +DI       G  
Sbjct: 100 TVLVDTGSSDLWIMGSNNPYCSSDTRSNSRRRVIDKRDDSSSSGALVNDINPFGWLTGTG 159

Query: 141 GAIYKTLTLTXXXXXXXXXXXXXIDVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSID 200
           G I  T T                                                 ++D
Sbjct: 160 GLIGPTAT-------------------------------GSGGSSETATQSVPASEATMD 188

Query: 201 CSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTN 260
           C  YGTF  + SST++SNNT F ISYGDG+FASG +G D ++L  LN++ +S AVAN+TN
Sbjct: 189 CKEYGTFTTSDSSTFRSNNTYFSISYGDGTFASGTFGTDVLDLSDLNVTGLSFAVANETN 248

Query: 261 STVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHN 320
           ST+GVLGIGLP LE TYS   +        Y NFP+VLK  G  K N YSLYLN  DA +
Sbjct: 249 STMGVLGIGLPELEVTYSGSTASRGRRPFKYDNFPIVLKNSGAIKTNAYSLYLNDSDAEH 308

Query: 321 GSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSN-QXXXXXXXXXK 379
           G+ILFGAVD SK+ G+LYTIPI+N   + G S PIQFDVT+ G+G+S+ +         K
Sbjct: 309 GTILFGAVDHSKYTGTLYTIPIVNTLSASGFSSPIQFDVTINGIGVSDSKNGEKTLTTTK 368

Query: 380 IPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIE 439
           IPALLDSG+TL YLPE ++ ++AD +GA++S  L YY++DCPS  D T+IVF+FGGF+I 
Sbjct: 369 IPALLDSGTTLTYLPETVVALIADEIGAQYSYRLGYYVLDCPSD-DSTQIVFDFGGFHIN 427

Query: 440 TNLTTYTTPISSDTCVLRILPSGDSSA-ILGDAFLVHAYVVYDLEDFEISMAQANFDVNH 498
            +L+++     S TC+L I+P+ D++  ILGD+FL +AYVVYDL++ EISMAQA ++   
Sbjct: 428 ASLSSFILSTGS-TCLLGIIPTSDNTGTILGDSFLTNAYVVYDLDNLEISMAQAQYNTTT 486

Query: 499 EDIEVVSSSIP 509
           E+IEV+SSSIP
Sbjct: 487 ENIEVISSSIP 497

>SAKL0H15664g Chr8 (1365886..1367556) [1671 bp, 556 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 556

 Score =  415 bits (1067), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 221/529 (41%), Positives = 314/529 (59%), Gaps = 60/529 (11%)

Query: 1   MKWNQILKCTLLANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVK 60
           M+++ I    LL+ +  ++     +++++PK V L FDK  G  YEES    +      K
Sbjct: 1   MRFDIIAISLLLSQLVTASV----LKKRSPKYVSLPFDKSRGSTYEESSKHNKPYAVLSK 56

Query: 61  RDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKK 120
           RDDG  E+ L+N+ +F+SV+LE+G+P Q +TVL+DTGSSDLW+TGS+NPYC++ S  +++
Sbjct: 57  RDDGFQEIELKNQVSFFSVELEIGTPRQNVTVLVDTGSSDLWVTGSNNPYCRAGSVGNRR 116

Query: 121 RD-------------------IGDNSLDDIFSDITAGGSGAIYKTLTLTXXXXXXXXXXX 161
            D                   I  + +  + S +TA G+    ++ + +           
Sbjct: 117 NDASSGSGSGSGSSNNKKRVNIKRDEISSVRSWLTASGTNTRTQSGSASATRANSLSSAL 176

Query: 162 XXIDVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSIDCSRYGTFDKNQSSTYKSNNTA 221
             ID                                   CS+YGTF+ + SST+ SN+T 
Sbjct: 177 ATID-----------------------------------CSQYGTFNTSASSTFSSNDTL 201

Query: 222 FEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQ 281
           F I YGD S+A G WG+D + L  ++I  +S AVAN TNSTVGVLGIGLPGLE TYS   
Sbjct: 202 FVIFYGDSSYAYGTWGQDELYLHDIDIGGLSFAVANQTNSTVGVLGIGLPGLEVTYSGYA 261

Query: 282 SMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIP 341
           S    +R+ Y NFP++LK   + K N YSL+LNS ++ +GS+LFGAVD SK+ G LYT+P
Sbjct: 262 SSAR-NRYQYDNFPLILKRNNVIKANAYSLFLNSTNSSSGSLLFGAVDHSKYSGQLYTVP 320

Query: 342 ILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMV 401
           +LN  +S G + PIQF+V +QG+G+             IPALLDSG+TL+Y P  + EM+
Sbjct: 321 LLNTLESSGYTDPIQFEVAVQGIGVRTSGSNTTLTTTVIPALLDSGATLSYFPVQVAEMI 380

Query: 402 ADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNLTTYT-TPISSDTCVLRILP 460
           AD L A +S +  YY++DCPS  D+T+I+++FGGF+I + LT Y  T      CVL I+P
Sbjct: 381 ADALDATYSSSYGYYIVDCPSSDDDTEIIYDFGGFHIASKLTDYILTTNRPSICVLGIVP 440

Query: 461 SGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNHEDIEVVSSSIP 509
              +  ILGD FL  AYVVYDL++FEIS+AQAN++   E IEV+S S+P
Sbjct: 441 QNSNRFILGDVFLTSAYVVYDLDNFEISLAQANYEGGDEQIEVISESVP 489

>ZYRO0G02904g Chr7 (220115..221710) [1596 bp, 531 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 531

 Score =  403 bits (1035), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 213/516 (41%), Positives = 299/516 (57%), Gaps = 62/516 (12%)

Query: 1   MKWNQILK--CTLLANVARSAAFSQEVEEQ---TPKIVKLSFDKRHGENYEESL-LGKRD 54
           MKW  +    C LL+   +  +    +EE+   +PK+VK SF+K  G  +  S  L KRD
Sbjct: 1   MKWTILFAACCVLLSETVQCISVRHYLEEEEASSPKLVKFSFNKHQGRTFTASEELSKRD 60

Query: 55  ALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSN 114
                     +    L+N QNFYS+ L VG+P Q++ VLLDTGSSDLWI GSDNPYCK +
Sbjct: 61  K---------DVTFDLKNEQNFYSIKLSVGTPGQEVVVLLDTGSSDLWIPGSDNPYCKES 111

Query: 115 SHSSKKRDIGDNSLDDIFSDITAGGSGAIYKTLTLTXXXXXXXXXXXXXIDVSXXXXXXX 174
           S  S      +N  +  F  +  G          +T             +D         
Sbjct: 112 SSFSISNQGKENGAEGPFQTLPGG----------VTATNMSGGSTASATLD--------- 152

Query: 175 XXXXXXXXXXXXXXXXXXXXXXQSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASG 234
                                     C  +GTF++  S T+ SN+T F +SYGD S+A G
Sbjct: 153 --------------------------CKEFGTFNREDSKTFHSNDTEFSVSYGDTSYAIG 186

Query: 235 EWGRDHIELGSLNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNF 294
            WG D I +  +N+++VS+ VAN TNS+VG++GIGL  LE TY+  +++ + + H Y NF
Sbjct: 187 TWGYDSININDVNLTNVSIGVANKTNSSVGIMGIGLSNLENTYTGVENVKNRNTHKYLNF 246

Query: 295 PMVLKERGITKKNVYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQP 354
           PM+LKE+G  +KNVYSL+LN  +A  GSILFGAVD SK+ G LYT+P+LN+Y+ +G+  P
Sbjct: 247 PMLLKEQGFIEKNVYSLFLNRREAFEGSILFGAVDHSKYSGQLYTVPMLNLYQQQGLKDP 306

Query: 355 IQFDVTLQGLGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLN 414
           +Q  VTLQG+G+             +PALLDSG+TL YLP+ +L M+A+ L A +   + 
Sbjct: 307 LQLQVTLQGVGIEANNMTNTTSTTPVPALLDSGTTLVYLPDKMLAMLAEQLNAHWDRGIG 366

Query: 415 YYLMDCPSKHDETKIVFNFGGFNIETNLTTYTTPISSD-TCVLRILPSGDSSAILGDAFL 473
           YY+ DC S+ D T + FNFGGFNI +N++TY    S++ +CVL + P G  +AILGD F+
Sbjct: 367 YYVTDC-SRVDNTNLYFNFGGFNIVSNMSTYVVSRSNENSCVLGLQPGGPEAAILGDMFM 425

Query: 474 VHAYVVYDLEDFEISMAQANFDVNHEDIEVVSSSIP 509
            HAY+V+DL+DFEISMAQAN+      +E V+  +P
Sbjct: 426 QHAYIVFDLDDFEISMAQANYAGGKNQLEAVTQQVP 461

>YDR144C Chr4 complement(744311..746101) [1791 bp, 596 aa] {ON}
           MKC7GPI-anchored aspartyl protease, member of the yapsin
           family of proteases involved in cell wall growth and
           maintenance; shares functions with Yap3p and Kex2p
          Length = 596

 Score =  404 bits (1039), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 216/484 (44%), Positives = 297/484 (61%), Gaps = 40/484 (8%)

Query: 33  VKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYEL-SLRNRQNFYSVDLEVGSPSQKIT 91
           VK++F K++G ++E +L   +     + RDD +YEL  L N+ +FYSV+L++G+P QK+T
Sbjct: 37  VKMNFQKKYGSSFENALDDTKGRTRLMTRDD-DYELVELTNQNSFYSVELDIGTPPQKVT 95

Query: 92  VLLDTGSSDLWITGSDNPYCKSNSHSSKKRDIGDNSLDDIFSDITAGGSGAIYKTLTLTX 151
           VL+DTGSSDLW+TGSDNPYC     S+KK+D   +S   +  D  A    +++  ++   
Sbjct: 96  VLVDTGSSDLWVTGSDNPYC-----STKKKDTTGSSFKQVNKDALASVVESVFTEISYDT 150

Query: 152 XXXXXXXXXXXXIDVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSIDCSRYGTFDKNQ 211
                          S                             Q IDC+ YGTF+ ++
Sbjct: 151 TIVTSEATATFDSTASTS---------------------------QLIDCATYGTFNTSK 183

Query: 212 SSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGIGLP 271
           SST+ SNNT F I+YGD +FASG WG D + L  LNI+ +S AVAN+TNSTVGVLGIGLP
Sbjct: 184 SSTFNSNNTEFSIAYGDTTFASGTWGHDQLSLNDLNITGLSFAVANETNSTVGVLGIGLP 243

Query: 272 GLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSILFGAVDKS 331
           GLE+TYS          + Y+NFPMVLK  G+ K   YSL+ N  D+ +G+ILFGAVD  
Sbjct: 244 GLESTYSGVSLSSVQKSYTYNNFPMVLKNSGVIKSTAYSLFANDSDSKHGTILFGAVDHG 303

Query: 332 KFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLS---NQXXXXXXXXXKIPALLDSGS 388
           K+ G LYTIPI+N  + RG   PIQF VTLQGLG S    +         KIP LLDSG+
Sbjct: 304 KYAGDLYTIPIINTLQHRGYKDPIQFQVTLQGLGTSKGDKEDNLTTLTTTKIPVLLDSGT 363

Query: 389 TLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSK-HDETKIVFNFGGFNIETNLTTY-- 445
           T++Y+P +L++M+AD +GA +S    YY+MDC  +  +E+ I+F+FGGF +   L+ +  
Sbjct: 364 TISYMPTELVKMLADQVGATYSSAYGYYIMDCIKEMEEESSIIFDFGGFYLSNWLSDFQL 423

Query: 446 TTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNHEDIEVVS 505
            T   S+ C+L I P  D + ILGD FL + YVVYDL++ EISMAQANF  + E IE++ 
Sbjct: 424 VTDSRSNICILGIAPQSDPTIILGDNFLANTYVVYDLDNMEISMAQANFSDDGEYIEIIE 483

Query: 506 SSIP 509
           S++P
Sbjct: 484 SAVP 487

>Suva_2.305 Chr2 complement(539604..541397) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  404 bits (1039), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 221/485 (45%), Positives = 296/485 (61%), Gaps = 40/485 (8%)

Query: 33  VKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITV 92
           V++ F K++G+++E +   K+     VKR D    + L N+ +FYSVDL++G+PSQK+TV
Sbjct: 37  VRIQFQKKYGDSFENASSNKKTEARLVKRGDDYEVVDLSNQNSFYSVDLDIGTPSQKVTV 96

Query: 93  LLDTGSSDLWITGSDNPYCKSNS----HSSKKRDIGDNSLDDIFSDITAGGSGAIYKTLT 148
           L+DTGSSDLW+TGS+NPYC + S     SSK+R   DN L  + S + +  S   Y T  
Sbjct: 97  LVDTGSSDLWVTGSNNPYCSTKSGHTSSSSKERKDEDNILSLVQSVVQSVASEISYDTTI 156

Query: 149 LTXXXXXXXXXXXXXIDVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSIDCSRYGTFD 208
                          +                                Q+IDC+ YG FD
Sbjct: 157 TDTDATATQDSTSSAL--------------------------------QTIDCTTYGVFD 184

Query: 209 KNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGI 268
            ++SST++SN T F I+YGD +FASG WG D + L +LN++ +S AVAN+TNSTVGVLGI
Sbjct: 185 SSKSSTFQSNKTDFSITYGDLTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGI 244

Query: 269 GLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSILFGAV 328
           GL GLE+TYS      + + + Y+NFPMVLK  G  K   YSL+LN  +A +GSILFGAV
Sbjct: 245 GLAGLESTYSGATLSSAQESYTYNNFPMVLKNSGAIKSAAYSLFLNETNAKHGSILFGAV 304

Query: 329 DKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSN-QXXXXXXXXXKIPALLDSG 387
           D  K+ G LYTIPI+N  +  G   PIQF VTLQGLGL+            KIPALLDSG
Sbjct: 305 DHGKYSGDLYTIPIINTLQDHGYKDPIQFQVTLQGLGLAKGDSESTTITTTKIPALLDSG 364

Query: 388 STLAYLPEDLLEMVADGLGARFSENLNYYLM-DCPSKHDETKIVFNFGGFNIETNLTTY- 445
           +T++Y+P +L+EM+AD LGA +S  + YYLM       D+  +VF+FGGF I  NL++Y 
Sbjct: 365 TTISYMPVELMEMLADKLGASYSSKVGYYLMDCITDTDDDINVVFDFGGFYISGNLSSYQ 424

Query: 446 -TTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNHEDIEVV 504
            +   SSD C+L   P  DS+ ILGD FL +AYVVYDL++ EISMAQ +     EDI+V+
Sbjct: 425 LSADSSSDVCILGFAPQSDSTVILGDNFLSNAYVVYDLDNMEISMAQVDLSGRSEDIDVI 484

Query: 505 SSSIP 509
             S+P
Sbjct: 485 EDSVP 489

>TDEL0F04450 Chr6 complement(835112..836686) [1575 bp, 524 aa] {ON}
           Anc_8.318 YLR120C
          Length = 524

 Score =  400 bits (1028), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 216/509 (42%), Positives = 307/509 (60%), Gaps = 58/509 (11%)

Query: 5   QILKCTLLAN--VARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRD 62
           Q+L   L++   +   A    +V+E+  K V LSFDK  G +YEE+  G + +    KRD
Sbjct: 2   QLLPAALISGFLLGSQAVALSDVDEKPGKYVHLSFDKLRGNSYEEAGKGNKPSAELRKRD 61

Query: 63  DGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKKRD 122
           DG  E+ + N QNFYS++LE+G+PSQ +TVLLDTGSSDLW++  +NPYC  +  +     
Sbjct: 62  DGYEEIEIYNEQNFYSIELEIGTPSQNVTVLLDTGSSDLWVSSPENPYCIDSDDTKPVTQ 121

Query: 123 IGDNSLDDIFSDITAGGSGAIYKTLTLTXXXXXXXXXXXXXIDVSXXXXXXXXXXXXXXX 182
           +  ++L       T+ G+  I                    +D S               
Sbjct: 122 LSTSTLATSSGTATSSGNSGI------------------ATVDCSEYG------------ 151

Query: 183 XXXXXXXXXXXXXXQSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIE 242
                          + D S+  +F  N        NTAF ISYGD +FASG WG D+ +
Sbjct: 152 ---------------TFDPSKSTSFRSN--------NTAFSISYGDTTFASGTWGTDNFD 188

Query: 243 LGSLNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERG 302
           LG LN++++S AVAN +NSTVGV+GIGL GL++TY    S  SG  + Y NFPM LK +G
Sbjct: 189 LGDLNVTNLSFAVANQSNSTVGVMGIGLAGLQSTYVGVNSASSG-AYQYENFPMALKSQG 247

Query: 303 ITKKNVYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQ 362
           I  +N YSL+LN PDA  GS+LFGAVD SK+ G LYT+P+LN+Y++RG+  PI+FDVT+Q
Sbjct: 248 IIDRNAYSLFLNEPDADKGSVLFGAVDHSKYSGQLYTVPMLNMYRNRGIQNPIEFDVTVQ 307

Query: 363 GLGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPS 422
           G+ +++          + PALLDSG+TL+Y+P  L +++A  +GA++S+   YY M CPS
Sbjct: 308 GVSVTSGSTIRNLTNTQFPALLDSGTTLSYMPYTLTQLIAGAVGAQYSQYTGYYSMRCPS 367

Query: 423 KHDETKIVFNFGGFNI--ETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVY 480
           ++++T++ F+FGGF I    +    ++  SS TC L ++P   ++AI GD FLVHAYVVY
Sbjct: 368 ENNDTRLNFDFGGFQISANLSSYLLSSRSSSSTCYLGMIPLTSNAAIFGDNFLVHAYVVY 427

Query: 481 DLEDFEISMAQANFDVNHEDIEVVSSSIP 509
           DLE++EISMAQA F+ +   IEV+S SIP
Sbjct: 428 DLENYEISMAQAAFNNSDSQIEVISDSIP 456

>Kwal_26.7254 s26 (280683..282395) [1713 bp, 570 aa] {ON} YLR120C
           (YPS1) - GPI-anchored aspartic protease [contig 47] FULL
          Length = 570

 Score =  399 bits (1025), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 219/520 (42%), Positives = 307/520 (59%), Gaps = 46/520 (8%)

Query: 1   MKWNQILKCTLLANVARSAAFS-QEVEEQ-TPKIVKLSFDKRHGENYEESLLGKRDALPF 58
           MK++       ++ +  S A S QE+E Q   K V++SFDK  G+  E++ +G       
Sbjct: 1   MKFSASAAFLAISGLVSSTAVSLQEIEPQDVSKYVRISFDKLRGDTAEDARVGLMPRAEL 60

Query: 59  VKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYC----KSN 114
           VKR DG   + ++N+ NFYSV++ VGSP+Q +T+L+DTGSSD+W+ GS+NP+C    +S+
Sbjct: 61  VKRADGSETIKIKNQNNFYSVEVGVGSPAQNVTLLIDTGSSDMWVMGSNNPFCEGSSRSS 120

Query: 115 SHSSKKRDIG---DNSLDDIFSDITAGGSGAIYKTLTLTXXXXXXXXXXXXXIDVSXXXX 171
            H     +IG   +    D FS        +    LT T                     
Sbjct: 121 KHVLLGENIGLEDETVKKDFFS--------SFRSLLTATATSTVSASAVAPS-------- 164

Query: 172 XXXXXXXXXXXXXXXXXXXXXXXXXQSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSF 231
                                     ++ CS YGTF    SS++KSNNT F I YGD ++
Sbjct: 165 -----------------RTSVAASDATLSCSSYGTFATGSSSSFKSNNTDFYIQYGDLTY 207

Query: 232 ASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSMVSGDR--H 289
           A G WG D + L  + +SD+SMAVAN++NST GVLGIGL GLE T  +  S+VS  R  +
Sbjct: 208 ALGTWGHDDVTLQDITVSDLSMAVANESNSTFGVLGIGLTGLEVT--NVGSLVSSSRSAY 265

Query: 290 MYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSR 349
            Y N P +L ++G   +N YSL+L+  DA +GS+LFGAVD SK+ G+LYT+P++N+YKS 
Sbjct: 266 TYQNLPALLVDQGKIHQNAYSLFLDDLDAEHGSVLFGAVDHSKYTGNLYTVPLVNIYKSS 325

Query: 350 GVSQPIQFDVTLQGLGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARF 409
           G   PIQ DVTLQGLG+S            IPALLDSG+TL YLP  +++ +A  L A++
Sbjct: 326 GFPDPIQLDVTLQGLGMSANKTNITFTTTPIPALLDSGTTLTYLPSSMVQSIARRLSAQY 385

Query: 410 SENLNYYLMDCPSKHDETKIVFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSSAILG 469
           S ++ YY+++C    D  ++VF+FGGF+I++ L  +    SS+ C L ++P   S AILG
Sbjct: 386 SYDVGYYVLECSEVSDSDELVFDFGGFHIKSKLQNFLIKASSNFCALGLVPQSSSRAILG 445

Query: 470 DAFLVHAYVVYDLEDFEISMAQANFDVNHEDIEVVSSSIP 509
           D FL  AYVVYDLE+ E+SMAQAN+D   EDIEV+SS+IP
Sbjct: 446 DNFLTAAYVVYDLENLEVSMAQANYDGGSEDIEVISSTIP 485

>Smik_4.388 Chr4 complement(705092..706885) [1794 bp, 597 aa] {ON}
           YDR144C (REAL)
          Length = 597

 Score =  389 bits (1000), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 215/510 (42%), Positives = 307/510 (60%), Gaps = 58/510 (11%)

Query: 18  SAAFSQEVEEQTPKI----VKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYEL-SLRN 72
           S  F+  +  Q+ +I    VK++F +++G+++E +    +     V R D +YEL  L N
Sbjct: 18  SMVFADSIISQSSEINDGYVKMNFQRKYGDSFESATNDTKARARLVTRGD-DYELVELTN 76

Query: 73  RQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYC----KSNSHSSKKRDIGDN-- 126
           + +FYSV+L++G+P QK+TVL+DTGSSDLW+TGSDNPYC    +  S SS K    DN  
Sbjct: 77  QNSFYSVELDIGTPPQKVTVLVDTGSSDLWVTGSDNPYCFTEGEDTSGSSFKHVNKDNLV 136

Query: 127 -SLDDIFSDITAGGSGAIYKTLTLTXXXXXXXXXXXXXIDVSXXXXXXXXXXXXXXXXXX 185
             ++ +F++I+       Y T  +T                                   
Sbjct: 137 SVVESVFTEIS-------YDTTMVTSVATATIGNTAST---------------------- 167

Query: 186 XXXXXXXXXXXQSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGS 245
                      Q+++C+ YGTFD ++SST++SN T F I+YGD +FASG WG D + L +
Sbjct: 168 ----------SQAMNCTTYGTFDTSKSSTFESNKTEFSITYGDSTFASGTWGHDRLSLNN 217

Query: 246 LNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITK 305
           LN++ +S AVAN+TNSTVGVLGIGLPGLE+TYS      +   + Y+NFPM+LK  G  K
Sbjct: 218 LNVTGLSFAVANETNSTVGVLGIGLPGLESTYSGVSLSSAQKSYTYNNFPMILKNSGAIK 277

Query: 306 KNVYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLG 365
              YSL+ N  D+ +G+ILFGAVD  K+ G LYTIPI+N  ++RG   PIQF VTLQG+G
Sbjct: 278 STAYSLFTNHSDSKHGTILFGAVDHGKYAGDLYTIPIINTLQNRGYKDPIQFQVTLQGIG 337

Query: 366 LSN---QXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPS 422
           +S+             KIP LLDSG+T++Y+P DL+EM+A  +GA +S +  YY+MDC +
Sbjct: 338 VSHGERDENMTTLTTTKIPVLLDSGTTISYMPADLVEMIASEVGATYSPDYGYYIMDCIN 397

Query: 423 K-HDETKIVFNFGGFNIETNLTTYT--TPISSDTCVLRILPSGDSSAILGDAFLVHAYVV 479
           +  +E+ ++F+FGGF I   L+ +   T   S+ C+L I P  D + ILGD FLV  YVV
Sbjct: 398 EMEEESSLIFDFGGFYIANWLSNFQLLTDSRSNVCILGIAPQSDPAIILGDNFLVSTYVV 457

Query: 480 YDLEDFEISMAQANFDVNHEDIEVVSSSIP 509
           YDL++ EISMA A+F    E I+ +  S+P
Sbjct: 458 YDLDNMEISMAHADFSDGGEYIDTIKDSVP 487

>Skud_4.403 Chr4 complement(715972..717744) [1773 bp, 590 aa] {ON}
           YDR144C (REAL)
          Length = 590

 Score =  386 bits (991), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 208/484 (42%), Positives = 293/484 (60%), Gaps = 40/484 (8%)

Query: 33  VKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYEL-SLRNRQNFYSVDLEVGSPSQKIT 91
           V ++F+K++G+++E +   +      V+R+D +YEL  L N  +FYSV+L++G+P QKIT
Sbjct: 37  VIMNFEKKYGDSFENASNDRNAGAHLVRRED-DYELVKLTNENSFYSVELDIGTPPQKIT 95

Query: 92  VLLDTGSSDLWITGSDNPYCKSNSHSSKKRDIGDNSLDDIFSDITAGGSGAIYKTLTLTX 151
           VL+DTGSSDLW+TGS+NPYC     S+K +D  D S   I  D  A    ++   ++   
Sbjct: 96  VLVDTGSSDLWVTGSNNPYC-----STKGKDTSDFSFKQIHKDNPASVVESVITEISY-- 148

Query: 152 XXXXXXXXXXXXIDVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSIDCSRYGTFDKNQ 211
                                                        Q I+C  YGTFD ++
Sbjct: 149 -------------------------DTTISVIEATATLDNTPLASQKINCGTYGTFDSSK 183

Query: 212 SSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGIGLP 271
           SST++SN T F I+YGD +FASG WG D + L +LN++ +S AVAN+TNSTVGVLGIGLP
Sbjct: 184 SSTFESNKTKFSITYGDSTFASGTWGHDQLNLNNLNVTGLSFAVANETNSTVGVLGIGLP 243

Query: 272 GLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSILFGAVDKS 331
           GLE+TYS          + Y+NFPMVLK  G  K + YSL+ N  ++ +G+ILFGAVD  
Sbjct: 244 GLESTYSGVSLSSVQKSYTYNNFPMVLKNSGAIKSSAYSLFSNKSNSEHGTILFGAVDHG 303

Query: 332 KFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSN---QXXXXXXXXXKIPALLDSGS 388
           K+ G LYTIPI+N+ ++ G   PIQF VTLQG+ ++              KIPALLDSG+
Sbjct: 304 KYTGDLYTIPIINILQNNGYKDPIQFHVTLQGIAVATGDGMDNATTLTTTKIPALLDSGT 363

Query: 389 TLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSK-HDETKIVFNFGGFNIETNLTTYT- 446
           T++YLP  L+E++AD +GA +S    YY+M+C  +   +  +VF+FGGF+I + L+ +  
Sbjct: 364 TISYLPVKLVELLADKVGASYSSEYGYYVMNCIHEVKKDITVVFDFGGFHISSWLSNFQL 423

Query: 447 -TPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNHEDIEVVS 505
            T  SSD C+L   P  D + ILGD FLV  Y+VYDL++ EISMA A+F  N E I+V+ 
Sbjct: 424 FTDSSSDVCILGFAPQSDPTVILGDNFLVSTYIVYDLDNMEISMANADFSDNDEYIDVIE 483

Query: 506 SSIP 509
           S++P
Sbjct: 484 SAVP 487

>Kwal_56.23902 s56 complement(767431..769320) [1890 bp, 629 aa] {ON}
           YLR120C (YPS1) - GPI-anchored aspartic protease [contig
           171] FULL
          Length = 629

 Score =  364 bits (935), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 212/513 (41%), Positives = 288/513 (56%), Gaps = 31/513 (6%)

Query: 12  LANVARSAAFSQEVE--EQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELS 69
           LA +  S A S E +  +   K VKLSFDK  G+  E +  G+   +  VKRDDG     
Sbjct: 12  LAGLVSSTAISAEAKYSQDESKFVKLSFDKLRGDLVENARAGQIPRVKRVKRDDGTASFE 71

Query: 70  LRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKK----RDIG- 124
           + N+  FYSV + VGSP+Q +T+L+DTGSSD+W+ GS+NPYC+ +S  SK      D G 
Sbjct: 72  IDNQDTFYSVTIGVGSPAQDVTLLIDTGSSDIWVMGSNNPYCEGSSGKSKHVLLHEDSGF 131

Query: 125 --DNSLDDIFSDITAGGSGAIYKTLTLTXXXXXXXXXXXXXIDVSXXXXXXXXXXXXXXX 182
             D +  D +SD+ +      Y T T T             + V                
Sbjct: 132 EDDTNGKDFYSDLLS------YLTATGTAEYSGSYWATATDVTVETTSYWPDDTDVPTAT 185

Query: 183 XXXXXXXXXXXXXXQSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIE 242
                          +I CS YGTF  + SS++KSN T F I YGD S+A G WGRD + 
Sbjct: 186 SMDSYQA--------TISCSEYGTFATDSSSSFKSNGTQFLIQYGDLSYALGVWGRDDVT 237

Query: 243 LGSLNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERG 302
           L  + +SD+S+AVAN +NST GVLGIGLPGLE T +  +S    D + Y NFP +L ++G
Sbjct: 238 LQDVKVSDISLAVANISNSTFGVLGIGLPGLEVTNALAES--PSDAYTYKNFPAMLVDQG 295

Query: 303 ITKKNVYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQ 362
             +K+ YSL++N  +A +GS+LFGAVD SK+ G+L TIP++N  KS  V +PIQFDVTL 
Sbjct: 296 KIRKSAYSLFVNDLNATHGSVLFGAVDHSKYTGTLQTIPLVNSIKSAQVPKPIQFDVTLH 355

Query: 363 GLGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPS 422
           GLG++             PALLDSG+T  +LP  L+  +A  L A + +   +Y   C  
Sbjct: 356 GLGITLNDTNTTITTTPFPALLDSGTTFTHLPGYLVSAIAKKLNAEYGDEDGFYRYQCDE 415

Query: 423 KHDETKIVFNFGGFNIETNLTTYTTPI------SSDTCVLRILPSGDSSAILGDAFLVHA 476
             D  ++VF+FGGF+I++ L  +           +D C L ++P      ILGD FL  A
Sbjct: 416 ISDSDELVFDFGGFHIKSKLDNFALATYDDDDNETDVCALALIPYNRGEIILGDNFLTAA 475

Query: 477 YVVYDLEDFEISMAQANFDVNHEDIEVVSSSIP 509
           YVVYDLE+ EISMAQAN D   EDIE + S++P
Sbjct: 476 YVVYDLENLEISMAQANLDGGSEDIEEIVSTVP 508

>Kpol_543.61 s543 complement(141395..143161) [1767 bp, 588 aa] {ON}
           complement(141395..143161) [1767 nt, 589 aa]
          Length = 588

 Score =  355 bits (910), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 169/313 (53%), Positives = 230/313 (73%), Gaps = 2/313 (0%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           ++DC+++GTF+ + S T+ SN T+F ISY D S+ASG WG+D ++L  L+++ +S AVAN
Sbjct: 152 AVDCAKFGTFNPSTSDTWSSNETSFSISYADSSYASGTWGQDTLKLQDLDVTGLSFAVAN 211

Query: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPD 317
            TNSTVGVLGIGLP LE TYS   + V+G R+ Y NFP++LK  G TK N YSLYLN  D
Sbjct: 212 YTNSTVGVLGIGLPSLEVTYSGSNN-VAGTRYQYENFPLLLKNSGATKANAYSLYLNDLD 270

Query: 318 AHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSN-QXXXXXXX 376
           +  GS+LFG VD +K+ G+LYTIP++N  ++ G SQP++FDVTLQG+G+S+ +       
Sbjct: 271 SRTGSVLFGGVDHNKYSGTLYTIPLVNTLRAAGFSQPVEFDVTLQGMGISDDEHGNVTLT 330

Query: 377 XXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGF 436
             KIPALLDSG+TL YLP  L+ ++AD   A ++    YY+M+CP   ++++IVF+FGGF
Sbjct: 331 TTKIPALLDSGTTLVYLPSALVSLIADEYDAVYNSRTGYYVMNCPDSDEDSQIVFDFGGF 390

Query: 437 NIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDV 496
           +I TNLTTY        CVL ILP    +AILGD+FL HAYVVYDL++ EISMAQA+F+ 
Sbjct: 391 HISTNLTTYIIQAVGGICVLGILPQSSGTAILGDSFLQHAYVVYDLDNLEISMAQASFET 450

Query: 497 NHEDIEVVSSSIP 509
           + E++EV+SSSIP
Sbjct: 451 DDENVEVISSSIP 463

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 60/95 (63%)

Query: 28  QTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPS 87
           ++   V+  FDK  G+++E +    +     VKRD+G  E+ + N+ NFYSV L +GS +
Sbjct: 60  ESQGFVRYHFDKLVGDSFENASNKNKRYANIVKRDNGVEEVEIMNQSNFYSVSLSIGSNA 119

Query: 88  QKITVLLDTGSSDLWITGSDNPYCKSNSHSSKKRD 122
           Q +TVLLDTGSSDLW+TGS+NP C     +S   D
Sbjct: 120 QNVTVLLDTGSSDLWVTGSNNPLCSRGDSNSDAVD 154

>CAGL0M04191g Chr13 complement(461446..463251) [1806 bp, 601 aa]
           {ON} similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 601

 Score =  354 bits (908), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 172/313 (54%), Positives = 223/313 (71%), Gaps = 2/313 (0%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           +I+C++YGTFD ++SST+ SN+TAF I YGD +FASG WG D++ L  LN++ +S AVAN
Sbjct: 191 TINCAKYGTFDTSKSSTWHSNDTAFMIQYGDSTFASGTWGMDNLHLSDLNVTGLSFAVAN 250

Query: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDR-HMYSNFPMVLKERGITKKNVYSLYLNSP 316
            TNSTVGVLGIGLP LE TYS  ++ VSG R + Y NFP+VL   G  K N YSL+LN+ 
Sbjct: 251 RTNSTVGVLGIGLPALEVTYSG-RTAVSGQRPYQYDNFPLVLLRNGAIKSNSYSLFLNNA 309

Query: 317 DAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXX 376
            A  GS+LFGAVD SK+ G LYTIP++N Y S+G   PIQF+VTL GLG+S+        
Sbjct: 310 SAETGSVLFGAVDHSKYLGDLYTIPMVNTYASQGYKNPIQFEVTLNGLGISSSSDNTTIT 369

Query: 377 XXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGF 436
             KIPALLDSG+TL YLP+ L+  +   L A +S    YY+  CPS+ D+T++VF+FGGF
Sbjct: 370 TTKIPALLDSGTTLTYLPQALVTRIVQKLQATYSNRAGYYVFSCPSQSDDTEVVFDFGGF 429

Query: 437 NIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDV 496
           +I   +T +    S D+C+L I+P      ILGD+FL  AYVVYDLE++EISMAQAN+  
Sbjct: 430 HINAPITNFIIGSSGDSCILGIMPQSGGGIILGDSFLNSAYVVYDLENYEISMAQANYAG 489

Query: 497 NHEDIEVVSSSIP 509
             EDIEV+SSS+P
Sbjct: 490 GQEDIEVISSSVP 502

 Score =  103 bits (256), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 86/135 (63%), Gaps = 6/135 (4%)

Query: 1   MKWNQILKCTLLANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDA-LPFV 59
           MK++ +  C +LA+VA  +  ++ V + +   VKL FDK +GE +E +  G+  A +   
Sbjct: 1   MKFSSL--C-MLASVAAHSKAAKNVADLS--YVKLDFDKYYGETFETAKRGRSQADIRVN 55

Query: 60  KRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSK 119
           KR +G  E+ + N+ +FYSV LEVG+P Q + VL+DTGSSDLWITGSDNPYC+ ++ +S 
Sbjct: 56  KRANGYEEVQITNQNSFYSVTLEVGTPPQSVVVLVDTGSSDLWITGSDNPYCRGSTGTSG 115

Query: 120 KRDIGDNSLDDIFSD 134
           K  + +  L     D
Sbjct: 116 KNMLLEAELKRALED 130

>Skud_12.192 Chr12 complement(369422..371131) [1710 bp, 569 aa] {ON}
           YLR120C (REAL)
          Length = 569

 Score =  339 bits (869), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 166/313 (53%), Positives = 230/313 (73%), Gaps = 3/313 (0%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           +++C  +GTF  + SST++SNNT F ISYGDG+FASG +G D ++L  LN++ +S AVAN
Sbjct: 183 TMNCQEFGTFTTSDSSTFRSNNTYFSISYGDGTFASGTFGTDILDLSDLNVTGLSFAVAN 242

Query: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPD 317
           +TNST+GVLGIGLP LE TYS   +  S   + Y NFPMVLK  G  K N YSLYLN  D
Sbjct: 243 ETNSTMGVLGIGLPELEVTYSGSTASSSRRPYTYDNFPMVLKNSGAIKTNAYSLYLNDSD 302

Query: 318 AHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLS-NQXXXXXXX 376
           A +G+ILFGAVD SK+ G+LYT+PI+N   + G S PIQFDVT+ G+G+S          
Sbjct: 303 AKHGTILFGAVDHSKYAGTLYTVPIVNTLSASGFSSPIQFDVTINGIGISYPDNSQKTLT 362

Query: 377 XXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGF 436
             +IPALLDSG+TL YLP+ ++ M+AD L A++S  L YY++DCPS  + T+IVF+FGGF
Sbjct: 363 TTQIPALLDSGTTLTYLPQAVVAMIADELDAQYSSRLGYYVLDCPSNSNSTQIVFDFGGF 422

Query: 437 NIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDV 496
           +I  +L+++    + + C+L I+ + D++ ILGD+FL +AYVVYDL++ EISMAQA +++
Sbjct: 423 HINASLSSFILN-AGNICLLGIIATDDTT-ILGDSFLTNAYVVYDLDNLEISMAQAQYNI 480

Query: 497 NHEDIEVVSSSIP 509
            +E+IEV++SSIP
Sbjct: 481 TNENIEVITSSIP 493

 Score = 99.8 bits (247), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 64/92 (69%)

Query: 20  AFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSV 79
           A S+  ++   K VKL F K +G+  ++    K+  +  +KR DG  E+ + N+Q+FYSV
Sbjct: 26  AASKRDDDSNSKFVKLPFHKLYGDTRDDVGTDKKPEVRLLKRADGYEEIIITNQQSFYSV 85

Query: 80  DLEVGSPSQKITVLLDTGSSDLWITGSDNPYC 111
           DLEVG+P Q +TVL+DTGSSDLWI GS+NPYC
Sbjct: 86  DLEVGTPPQNVTVLVDTGSSDLWIMGSNNPYC 117

>ZYRO0F10252g Chr6 complement(828774..830429) [1656 bp, 551 aa] {ON}
           weakly similar to YYIL015W uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 551

 Score =  337 bits (863), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 171/314 (54%), Positives = 225/314 (71%), Gaps = 6/314 (1%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           +IDCS+YGTF+ + S T+KSN++ F ++YGDGSFA G WG DH+ L  LN+SDVS AVAN
Sbjct: 128 TIDCSQYGTFNLDGSETFKSNDSTFYLTYGDGSFAKGLWGMDHVYLDGLNVSDVSFAVAN 187

Query: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPD 317
           ++NSTVGV G+GLPG E T +     V+G+ + Y NFP VLK+ G+ +KN YSLYLNSPD
Sbjct: 188 ESNSTVGVFGVGLPGEEATVTPG---VNGNHYQYKNFPQVLKDNGVVQKNAYSLYLNSPD 244

Query: 318 AHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXX 377
           +++G+ILFGAVD SK+ G+LYT+PI+N Y  +GV+ P +FDVT+QG+ + N         
Sbjct: 245 SNSGNILFGAVDHSKYSGNLYTLPIVNTYADQGVA-PREFDVTVQGITVGNSSSNSTVSS 303

Query: 378 XKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFN 437
            K  ALLDSG+TL YLP  L + +A  LG +FS +  YYL+  PS++D+TKI F+FGGF+
Sbjct: 304 DKTLALLDSGTTLMYLPTALADELAKSLGGKFSPSTGYYLIPKPSENDDTKITFDFGGFH 363

Query: 438 IETNLTTYTTPISS--DTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFD 495
           IET L+ Y    S   D  +L IL +    AI GD FLV AYVVYDLED+EIS+AQANF+
Sbjct: 364 IETKLSNYILQGSGPQDVAILGILRTEGDRAIFGDVFLVDAYVVYDLEDYEISLAQANFN 423

Query: 496 VNHEDIEVVSSSIP 509
               DIE +S S+P
Sbjct: 424 SGSSDIEAISGSVP 437

 Score = 97.4 bits (241), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/127 (40%), Positives = 74/127 (58%), Gaps = 17/127 (13%)

Query: 1   MKWNQILKCTLLANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVK 60
           MK+   L  ++L + A +   S       P + KLSF+K  GE +E++          V 
Sbjct: 1   MKFLTSLVTSVLLSTASAGLVS-------PPVYKLSFNKLRGETFEKA----------VG 43

Query: 61  RDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKK 120
             +G     ++N+QNFYSV+L+VG+P+Q + VLLDTGSSDLWITGS NPYC  ++ +S  
Sbjct: 44  NSNGHANFDIKNQQNFYSVELKVGTPAQNVLVLLDTGSSDLWITGSGNPYCSPSTRNSHL 103

Query: 121 RDIGDNS 127
              G NS
Sbjct: 104 GSAGSNS 110

>KAFR0B05710 Chr2 complement(1177594..1179321) [1728 bp, 575 aa]
           {ON} Anc_8.318 YLR120C
          Length = 575

 Score =  336 bits (861), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 166/308 (53%), Positives = 213/308 (69%), Gaps = 3/308 (0%)

Query: 203 RYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNST 262
            YGTF+ N SST+ SN+T+F ISYGD S A G WG+D + +  +++S VS AVAN TNST
Sbjct: 186 EYGTFNTNDSSTWSSNHTSFFISYGDSSVAEGVWGQDVLSISDVDVSGVSFAVANYTNST 245

Query: 263 VGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGS 322
           VGVLGIGL GLETTYS   S    + ++Y N PM+LK  G+     YSL+LN      G+
Sbjct: 246 VGVLGIGLSGLETTYSGTSS---SESYIYENLPMLLKSSGVIDTIAYSLFLNEKSDTTGN 302

Query: 323 ILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXXKIPA 382
           +LFGAVD SK+ GSLYT+PI+NVY S G   P++FDVT+ GLG+S           KIPA
Sbjct: 303 LLFGAVDHSKYSGSLYTLPIVNVYASEGYKNPLEFDVTMYGLGISTSDSNTTIATMKIPA 362

Query: 383 LLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNL 442
           LLDSG+T+ Y PE LLE+VAD LGA +S+ L +Y M C S  D+T+ VF+FGGF+I   L
Sbjct: 363 LLDSGTTIVYFPETLLELVADQLGASYSDELGFYAMSCVSSSDDTEFVFDFGGFHITVPL 422

Query: 443 TTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNHEDIE 502
           + +   +S   C+L +    D S ILGD FL +AYVVYDLE++EISMAQAN+D   EDIE
Sbjct: 423 SDFLIRVSGSECILAMAAQDDESIILGDYFLTNAYVVYDLENYEISMAQANYDSEDEDIE 482

Query: 503 VVSSSIPQ 510
           V+SS++P 
Sbjct: 483 VISSTVPS 490

 Score = 85.9 bits (211), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 47/113 (41%), Positives = 76/113 (67%), Gaps = 12/113 (10%)

Query: 6   ILKCTLLANVARSAAFSQEVEEQTP----KIVKLSFDKRHGENYEESLLGKRDALPFVKR 61
           IL  +L+  +  ++  +++ ++ +     K +KL FDK  GE++++S    +D+L   KR
Sbjct: 9   ILSTSLITALTDASIVAKDSKQPSDFNKNKYLKLGFDKYVGESFDKS---SKDSLQ--KR 63

Query: 62  DDGEYEL-SLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKS 113
              EY + +L N+ +FYSV+L +G+PSQ +TVL+DTGSSDLW+TGSDNP C +
Sbjct: 64  --AEYAIFNLTNQASFYSVELAIGTPSQNVTVLVDTGSSDLWVTGSDNPLCST 114

>TBLA0H01290 Chr8 (290515..292518) [2004 bp, 667 aa] {ON} Anc_8.318
           YLR120C
          Length = 667

 Score =  337 bits (865), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 169/315 (53%), Positives = 226/315 (71%), Gaps = 4/315 (1%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELG-SLNISDVSMAVA 256
           +I+C  YGTFD   SST++SN T+F I Y D S+A+GEWGRD +     LN++ +S AVA
Sbjct: 260 TINCDTYGTFDIEDSSTFQSNKTSFAIRYADTSYATGEWGRDVLTFSDGLNVTGLSFAVA 319

Query: 257 NDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSP 316
           N TNSTVGVLGIGLP LE TYS      S   ++Y NFP+VLK  G   K+VYSLYLN  
Sbjct: 320 NQTNSTVGVLGIGLPQLEVTYSG--VYQSTKPYIYDNFPLVLKNSGAIHKSVYSLYLNKQ 377

Query: 317 DAHNGSILFGAVDKSKFDG-SLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXX 375
           +A NG++LFGAVD S+++G +LYT+P++N   S G S PI+FD+TLQGLG+++       
Sbjct: 378 NAKNGNVLFGAVDHSQYEGDTLYTVPLVNGDSSSGYSTPIEFDITLQGLGVTDNTNNYTV 437

Query: 376 XXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGG 435
              +I ALLDSG+TL Y P+D+L ++A  + A +S+ L YY+M+CP   D T+IVF+FGG
Sbjct: 438 TTTQIVALLDSGTTLTYFPKDMLNLLAKTINASYSDALGYYVMNCPDSDDNTQIVFDFGG 497

Query: 436 FNIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFD 495
           F+I  NLT +    +S  CVL +LP   +SAILGD FL HAYVVY+L+D EISMAQAN+D
Sbjct: 498 FHINANLTNFVLSSASGKCVLGLLPYNGNSAILGDMFLTHAYVVYNLDDLEISMAQANYD 557

Query: 496 VNHEDIEVVSSSIPQ 510
            ++EDIEV++S++P 
Sbjct: 558 NSNEDIEVITSTVPN 572

 Score = 95.5 bits (236), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 43/76 (56%), Positives = 61/76 (80%), Gaps = 3/76 (3%)

Query: 46  EESLLGKRDALPFV---KRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLW 102
            +S++  +++ P+V   KR+DG  E+ + N+Q+FYSV+L +G+P+Q ITVL+DTGSSDLW
Sbjct: 73  RDSIIDLKESKPYVNLIKRNDGYEEIQIINQQSFYSVNLRIGTPAQSITVLVDTGSSDLW 132

Query: 103 ITGSDNPYCKSNSHSS 118
           +TGSDNPYCKSNS  S
Sbjct: 133 VTGSDNPYCKSNSGKS 148

>TBLA0E02630 Chr5 complement(665115..667184) [2070 bp, 689 aa] {ON} 
          Length = 689

 Score =  337 bits (864), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 175/315 (55%), Positives = 222/315 (70%), Gaps = 6/315 (1%)

Query: 199 IDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELG-SLNISDVSMAVAN 257
           I+C  YGTFD   SSTY+SN T F I Y D SFASG+WGRD +     LN++ +S AVAN
Sbjct: 282 INCDAYGTFDIENSSTYQSNQTGFAIRYADTSFASGDWGRDVLTFSDGLNVTGLSFAVAN 341

Query: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPD 317
            TNSTVGVLGIGLP LE TY+          + Y NFP+VLK  G   K+ YSLYLN   
Sbjct: 342 QTNSTVGVLGIGLPQLEVTYAGVYQTTK--PYTYDNFPLVLKNSGAIHKSAYSLYLNKQS 399

Query: 318 AHNGSILFGAVDKSKFDG-SLYTIPILNVYKSRGVSQPIQFDVTLQGLGLS-NQXXXXXX 375
           A NG++LFGA+D S++ G +LYTIP++N   S G S+PI+FDVTLQGLG+S N+      
Sbjct: 400 AKNGNVLFGAIDHSQYQGDTLYTIPLVNSDTSSGYSKPIEFDVTLQGLGVSDNRNGNFTV 459

Query: 376 XXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGG 435
              +I ALLDSG+TL Y P+D+L ++A  + A +SE L YY+M+CP   D T++VF+FGG
Sbjct: 460 TTTQIVALLDSGTTLTYFPKDMLNLLAKRINASYSEALGYYVMNCPDSRDNTQLVFDFGG 519

Query: 436 FNIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFD 495
           F+I+TNLT +    +S  CVL +LP   +SAILGD FL HAYVVY+L+D EISMAQANF+
Sbjct: 520 FHIKTNLTNFVLSSASGKCVLGLLPYNGNSAILGDIFLTHAYVVYNLDDLEISMAQANFN 579

Query: 496 V-NHEDIEVVSSSIP 509
             N EDIEV+SS+IP
Sbjct: 580 NGNDEDIEVISSTIP 594

 Score = 92.4 bits (228), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 68/100 (68%), Gaps = 15/100 (15%)

Query: 31  KIVKLSFDKRHGE------------NYEESLLGKRDALPFVK---RDDGEYELSLRNRQN 75
           K +KL F K + +            N  +S+L  +++ P++K   R DG  ++ + N+Q+
Sbjct: 39  KFLKLEFQKFYADSVNDIPPRDYSFNKRDSVLDLKNSKPYIKLIKRHDGYEKIQIINQQS 98

Query: 76  FYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNS 115
           FYSV+L++G+P+Q ITVL+DTGSSDLW+TGS+NPYCK NS
Sbjct: 99  FYSVNLQIGTPAQSITVLVDTGSSDLWVTGSNNPYCKGNS 138

>TPHA0A01580 Chr1 (315749..317551) [1803 bp, 600 aa] {ON} Anc_8.318
           YLR120C
          Length = 600

 Score =  328 bits (842), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 163/312 (52%), Positives = 213/312 (68%), Gaps = 2/312 (0%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           SIDCS YGTFD + SS++ SN+T+F I+YGDGS+A G WG+D + L  ++++ +S AVAN
Sbjct: 139 SIDCSLYGTFDIDDSSSFTSNDTSFAITYGDGSYALGNWGQDVLSLQDIDVTGLSFAVAN 198

Query: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPD 317
            TNSTVGVLGIGLP LE TYS   S+   + + Y N P+VL+  G  K   YSL+LN  D
Sbjct: 199 YTNSTVGVLGIGLPSLEATYSG--SLAGSNPYQYDNLPLVLRNSGAVKSYAYSLFLNDED 256

Query: 318 AHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXX 377
           +  GSILFG VD SK++G+L T+P++N  KS G   P +FD+TLQGLG+S          
Sbjct: 257 SSEGSILFGGVDHSKYEGTLNTLPLVNYQKSSGFQSPYEFDITLQGLGISTSSKNTTVSD 316

Query: 378 XKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFN 437
            +I ALLDSG+TL YLP  L  ++A  L A +S  L YY M CPS  D T+IVF+FGGF+
Sbjct: 317 TQIVALLDSGTTLTYLPVTLTSLLAAELNASYSARLGYYTMSCPSSSDSTEIVFDFGGFH 376

Query: 438 IETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVN 497
           I   LT++    S + C+L I+P     AILGD+FL HAYVVYDLE+ EIS+AQA +  +
Sbjct: 377 INVPLTSFIVTSSMNVCILGIIPRSGDQAILGDSFLQHAYVVYDLENLEISLAQAKYGSS 436

Query: 498 HEDIEVVSSSIP 509
            EDIE + SS+P
Sbjct: 437 SEDIEAIVSSVP 448

 Score = 95.1 bits (235), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 59/82 (71%), Gaps = 1/82 (1%)

Query: 33  VKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITV 92
           +K  FDK +G++Y+ S    +  L  VKRD G  E+ L+N  +FYS+ L +G+P+Q +TV
Sbjct: 45  IKFKFDKSYGDSYKNSSKRNKPKLDIVKRD-GYEEIELKNESSFYSIKLSIGTPAQNVTV 103

Query: 93  LLDTGSSDLWITGSDNPYCKSN 114
           L+DTGSSDLW+TGSDNP C S+
Sbjct: 104 LIDTGSSDLWVTGSDNPLCSSD 125

>KAFR0H02300 Chr8 (439083..440648) [1566 bp, 521 aa] {ON} Anc_8.319
           YLR121C
          Length = 521

 Score =  325 bits (833), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 164/310 (52%), Positives = 224/310 (72%), Gaps = 7/310 (2%)

Query: 200 DCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDT 259
           DC+ YGTFDKNQSST+ SN+T F I+YGD SFA G WG+D + L  L++S +S AVAN T
Sbjct: 124 DCNTYGTFDKNQSSTWSSNDTLFSITYGDTSFARGTWGQDKLHLDDLDVSGLSFAVANVT 183

Query: 260 NSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAH 319
           NSTVGVLGIGLPGLE TY +       +R+ Y NFPM+LK  G T  N+YSL+L+ P+A 
Sbjct: 184 NSTVGVLGIGLPGLEVTYIN----APRNRYQYDNFPMILKNSGATHSNLYSLHLDHPEAE 239

Query: 320 NGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXXK 379
           +G++LFGAVD SK+ GSLYTIP++N  K+ G S P +F+VTLQG+G+            K
Sbjct: 240 HGTVLFGAVDHSKYTGSLYTIPLVNTLKTHGFSDPAKFEVTLQGVGIVANNTQTTLTNTK 299

Query: 380 IPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPS-KHDETKIVFNFGGFNI 438
           I ALLDSG+TL YLP+ L++++AD +GAR+S    YY++ C + ++ +T +VF+FGGF+I
Sbjct: 300 IAALLDSGTTLTYLPQALVQVIADSIGARWSSRYGYYIVSCRAVENSDTTLVFDFGGFHI 359

Query: 439 ETNLTTYTTPISSDTCVLRIL-PSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDV- 496
              LT +      + C+L I+  +G +SAILGD FL++AYVV+DLE+ EISMAQA  +V 
Sbjct: 360 NGKLTDFIVETFGNVCLLTIIEETGSNSAILGDNFLINAYVVFDLENNEISMAQALHNVD 419

Query: 497 NHEDIEVVSS 506
           + +DIE+V+S
Sbjct: 420 DDQDIEIVTS 429

 Score = 99.0 bits (245), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 51/99 (51%), Positives = 64/99 (64%), Gaps = 7/99 (7%)

Query: 26  EEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGS 85
           + + P  V L F K +G+++E    G        KR  G   + L NRQNFYSVDL++G+
Sbjct: 28  DSKQPDYVNLKFKKTYGDSFE----GSTTWSALAKRTRGYELVDLVNRQNFYSVDLDIGT 83

Query: 86  PSQKITVLLDTGSSDLWITGSDNPYC---KSNSHSSKKR 121
           PSQ ITVL+DTGSSDLW+TGSDNPYC   KSN  SS  +
Sbjct: 84  PSQTITVLVDTGSSDLWVTGSDNPYCVSVKSNLVSSTNK 122

>YLR121C Chr12 complement(388744..390270) [1527 bp, 508 aa] {ON}
           YPS3Aspartic protease, member of the yapsin family of
           proteases involved in cell wall growth and maintenance;
           attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor
          Length = 508

 Score =  320 bits (819), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 153/313 (48%), Positives = 216/313 (69%), Gaps = 2/313 (0%)

Query: 199 IDCSRYGTFDKNQSSTYKSNNTA-FEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           +DC +YG FDK +SST+K+N ++ F  +YGDG++A G +G+D ++   L++S +S AVAN
Sbjct: 101 MDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTYAEGAFGQDKLKYNELDLSGLSFAVAN 160

Query: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPD 317
           ++NST GVLGIGL  LE TYS   +++    + Y NFP+ LK  G      YSL+LN   
Sbjct: 161 ESNSTFGVLGIGLSTLEVTYSGKVAIMDKRSYEYDNFPLFLKHSGAIDATAYSLFLNDES 220

Query: 318 AHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXX 377
             +GSILFGAVD SK++G LYTIP++N+YKS+G   P+ FDVTLQGLGL           
Sbjct: 221 QSSGSILFGAVDHSKYEGQLYTIPLVNLYKSQGYQHPVAFDVTLQGLGLQTDKRNITLTT 280

Query: 378 XKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFN 437
            K+PALLDSG+TL YLP   + ++A  L A +S+ L YY   CPS  ++T + F+FGGF 
Sbjct: 281 TKLPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSVAFDFGGFR 340

Query: 438 IETNLTTYTTPISSDTCVLRILP-SGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDV 496
           I   L+ +T   S  TCVL I+P +G+++AILGD+FL +AYVVYDL+++EIS+AQA +  
Sbjct: 341 INAPLSDFTMQTSVGTCVLAIIPQAGNATAILGDSFLRNAYVVYDLDNYEISLAQAKYGT 400

Query: 497 NHEDIEVVSSSIP 509
             E++EV+ S++P
Sbjct: 401 GKENVEVIKSTVP 413

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/110 (43%), Positives = 65/110 (59%), Gaps = 15/110 (13%)

Query: 5   QILKCTLLANVARSAAFSQEVEEQTPKIVKLSF-DKRHGENYEESLLGKRDALPFVKRDD 63
           Q+     LA V  S AF + + +   K VK+ F  K++G+N E S           KR +
Sbjct: 4   QLAAVATLA-VLTSPAFGRVLPDG--KYVKIPFTKKKNGDNGELS-----------KRSN 49

Query: 64  GEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKS 113
           G  +  L N Q+FYSV+L +G+PSQ +TVLLDTGS+DLW+ G  NPYC S
Sbjct: 50  GHEKFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGS 99

>Skud_12.193 Chr12 complement(371627..373120) [1494 bp, 497 aa] {ON}
           YLR121C (REAL)
          Length = 497

 Score =  317 bits (813), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 151/314 (48%), Positives = 216/314 (68%), Gaps = 3/314 (0%)

Query: 199 IDCSRYGTFDKNQSSTYKSNNTA-FEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           +DC +YG FDK +SST+K+N ++ F  +YGDG+FA G +G+D ++   L++S +S AVAN
Sbjct: 101 MDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTFAQGAFGQDRLKYNGLDLSGLSFAVAN 160

Query: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPD 317
           ++NST GVLGIGLP LE TYS   ++V    + Y NFP+ LK  G      YSL+LN   
Sbjct: 161 ESNSTFGVLGIGLPALEVTYSGKVAVVDKKSYEYDNFPLFLKRSGAIDATAYSLFLNDES 220

Query: 318 AHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXX 377
             +GSILFGAVD SK++G LYT+P++N+Y+S+G   P+ FDVTL G+GL           
Sbjct: 221 QSSGSILFGAVDHSKYEGRLYTVPLVNLYRSQGYQHPVAFDVTLHGIGLQTDRHNTTLTA 280

Query: 378 XKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFN 437
            KIPALLDSG+TL YLP   + ++A  L A +S+ L YY   CPS  ++T + F+FGGF+
Sbjct: 281 TKIPALLDSGTTLTYLPSQAVALLAKSLNATYSKALGYYEYACPSSDNDTSVAFDFGGFH 340

Query: 438 IETNLTTYTTPIS-SDTCVLRILP-SGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFD 495
           I   ++ +T   S   TCVL ++P +G+++AILGD+FL +AYVVYDL+++E+S+AQA + 
Sbjct: 341 INAPVSDFTMQTSVGGTCVLAVIPQAGNATAILGDSFLRNAYVVYDLDNYEVSLAQAKYG 400

Query: 496 VNHEDIEVVSSSIP 509
              EDIE + S++P
Sbjct: 401 TGAEDIEAIKSTVP 414

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%)

Query: 60  KRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKS 113
           KR +G  +  L N Q+FYSV+L +G+PSQ +TVLLDTGS+DLW+    NPYC S
Sbjct: 46  KRSNGHEKFVLANEQSFYSVELAIGTPSQSLTVLLDTGSADLWVPSKGNPYCGS 99

>Smik_12.187 Chr12 complement(370001..371524) [1524 bp, 507 aa] {ON}
           YLR121C (REAL)
          Length = 507

 Score =  314 bits (805), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 152/313 (48%), Positives = 214/313 (68%), Gaps = 2/313 (0%)

Query: 199 IDCSRYGTFDKNQSSTYKSNNTA-FEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           +DC +YG FDK++SST+K+N ++ F  +YGDG+FA G +G+D ++  +L++S +  AVAN
Sbjct: 101 MDCDQYGVFDKSKSSTFKANKSSPFYAAYGDGTFAEGAFGQDKLKYNNLDLSGLPFAVAN 160

Query: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPD 317
           ++NST GVLGIGL  LE TYS   +++    + Y NFP+ LK  G      YSL+LN   
Sbjct: 161 ESNSTFGVLGIGLSTLEVTYSGKVAVMDKRSYEYDNFPLFLKHSGAIDATAYSLFLNDES 220

Query: 318 AHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXX 377
             +GSILFGAVD SK++G LYTIP++N+YKS+G   P+ FDVTLQGLGL           
Sbjct: 221 QASGSILFGAVDHSKYEGQLYTIPLVNMYKSQGYQHPVAFDVTLQGLGLQTDKRNTTLTT 280

Query: 378 XKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFN 437
            K PALLDSG+TL YLP   + ++A  L A +S+ L YY   CPS  ++T I F+FGGF 
Sbjct: 281 TKFPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSIAFDFGGFR 340

Query: 438 IETNLTTYTTPISSDTCVLRILP-SGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDV 496
           I   L+ +T   S  TC L ++P +G+++AILGD+FL +AYVVYDL+++EIS+AQA +  
Sbjct: 341 INAPLSDFTMQTSVGTCALALIPQAGNATAILGDSFLRNAYVVYDLDNYEISLAQAKYGK 400

Query: 497 NHEDIEVVSSSIP 509
             E+IE + S++P
Sbjct: 401 AKENIEAIKSTVP 413

 Score = 81.6 bits (200), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 62/109 (56%), Gaps = 12/109 (11%)

Query: 7   LKCTLLANVARSAAFSQEVEEQTP--KIVKLSFDKRHGENYEESLLGKRDALPFVKRDDG 64
           +K  L A V+ +   S  V    P  K VK+ F K+   N E S+L KR +        G
Sbjct: 1   MKVLLAAAVSLTVLSSLAVGRVLPEGKYVKMPFVKKG--NSESSVLSKRSS--------G 50

Query: 65  EYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKS 113
                L N Q+FYSV+L +G+PSQ +TVLLDTGS+DLW+ G  NPYC S
Sbjct: 51  HENFVLANEQSFYSVELAIGTPSQNLTVLLDTGSADLWVPGKGNPYCGS 99

>KNAG0I00910 Chr9 (171104..172813) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score =  316 bits (809), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 158/321 (49%), Positives = 208/321 (64%), Gaps = 9/321 (2%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           ++ CS YGTFD ++SST+KSNNTAF ISYGD S+ASG WG D + +  LN+S VS AVAN
Sbjct: 156 TVQCSTYGTFDHSKSSTFKSNNTAFAISYGDTSYASGSWGIDTMSINKLNVSGVSFAVAN 215

Query: 258 DTNSTVGVLGIGLPGLETTYS--------SDQSMVSGDRHMYSNFPMVLKERGITKKNVY 309
            +NS++GVLGIGLPGLE T           D +  S   + Y+NFPMVLK  GI  K  Y
Sbjct: 216 YSNSSMGVLGIGLPGLEVTNQLSNTASGKKDIAAASSSLYQYANFPMVLKNDGIIHKVAY 275

Query: 310 SLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQ 369
           SL+LN P    GS+LFGAVD SK+ G+LYT+P++++Y     S+P++FD+TL GLG+   
Sbjct: 276 SLFLNDPQEQEGSVLFGAVDHSKYTGTLYTVPLVDIYHDSASSKPVEFDITLYGLGVDKD 335

Query: 370 XXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKI 429
                     IPALLDSG+T++Y P  L   +A    A +     +Y M C      T +
Sbjct: 336 GSQSTIATTTIPALLDSGTTISYFPAQLANEIARKFNATYDSRSGFYTMSCSYDTSNTNL 395

Query: 430 VFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISM 489
           VF+FGGF+I   L  +    SS TCVL I P  ++  +LGD FL +AYVVYDLE+ E+SM
Sbjct: 396 VFDFGGFHITAPLDDFVVQQSSQTCVLAIGPQQENWVVLGDVFLSNAYVVYDLENLEVSM 455

Query: 490 AQANFDVN-HEDIEVVSSSIP 509
           AQANFD +  E +EV+SS++P
Sbjct: 456 AQANFDSSLPESVEVISSTVP 476

 Score = 78.6 bits (192), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/70 (52%), Positives = 50/70 (71%), Gaps = 4/70 (5%)

Query: 58  FVKRD--DGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNS 115
             KRD  DG   + ++N+ +FYSVDLE+G+P QK+TVL+DTGSSDLW+ G+DNP C S  
Sbjct: 5   LAKRDNTDGYSLMDVQNQVSFYSVDLEIGTPPQKVTVLVDTGSSDLWVMGTDNPLCASGR 64

Query: 116 HSSKKRDIGD 125
               K+ +GD
Sbjct: 65  RG--KKFLGD 72

>NCAS0C03300 Chr3 (647716..649395) [1680 bp, 559 aa] {ON} 
          Length = 559

 Score =  314 bits (804), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 211/314 (67%), Gaps = 3/314 (0%)

Query: 199 IDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAND 258
           IDCS +GTFD + SST+ +N TAF I YGDGSFA G WG D + +  + +  +S+AVAN 
Sbjct: 123 IDCSEFGTFDSSSSSTFHNNGTAFNIHYGDGSFALGTWGTDTVSIDDITLDALSLAVANS 182

Query: 259 TNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDA 318
           +NS++GV+G+GL GLETTYSS  ++ SG  + Y+NFP+ LK  GI   N YSLYLN P+ 
Sbjct: 183 SNSSMGVIGLGLAGLETTYSSSHAVKSGQTYQYANFPLALKNAGIVAANAYSLYLNDPEE 242

Query: 319 HNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQX-XXXXXXX 377
             G+ILFGAVD S + G LYTIP++N+Y   G    ++FDVTL G+G+ +          
Sbjct: 243 TTGNILFGAVDHSLYSGQLYTIPLVNIYSGSGFKNAVEFDVTLNGIGIVDSSGSATTVST 302

Query: 378 XKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHD-ETKIVFNFGGF 436
             I ALLDSG+TL Y P   + ++A  LGA++S +  YY + C +  D  TK+VF+FGGF
Sbjct: 303 TPIIALLDSGTTLTYFPTQYVSLLAAQLGAQYSSSNGYYTISCDAMQDTTTKLVFDFGGF 362

Query: 437 NIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDV 496
           +I   L  +     + TC L I+P   SSAILGD FL +AYVVYDL++ EISMAQA +D 
Sbjct: 363 HINATLADFVVQSGTSTCFLSIIPQNSSSAILGDTFLNNAYVVYDLDNLEISMAQAKWDQ 422

Query: 497 NH-EDIEVVSSSIP 509
           +  EDIEV+SSS+P
Sbjct: 423 SSDEDIEVISSSVP 436

 Score =  105 bits (261), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 48/101 (47%), Positives = 75/101 (74%), Gaps = 3/101 (2%)

Query: 21  FSQEVEEQTP-KIVKLSFDKRHGENYE-ESLLGKRDALPFVKRDDGEYE-LSLRNRQNFY 77
           F+Q ++ + P K V L F+K++G++Y+  S   ++  L  VKRD  +YE + L N+Q+FY
Sbjct: 21  FAQALDNELPNKFVNLRFNKKYGDHYDTASTDSRKPKLELVKRDGSDYEEVELTNQQSFY 80

Query: 78  SVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSS 118
           SV+++VG+PSQ++TVLLDTGSSD W+ GSDNPYC  ++ ++
Sbjct: 81  SVEVDVGTPSQRVTVLLDTGSSDFWVMGSDNPYCSDDTSTT 121

>NDAI0G02620 Chr7 (599890..601662) [1773 bp, 590 aa] {ON}  YGL258W-A
          Length = 590

 Score =  310 bits (793), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 225/316 (71%), Gaps = 7/316 (2%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELG-SLNISDVSMAVA 256
           +IDCS YGTFD ++SST++SN+T F ISYGDGSFA G WG D I+L  SL+++DVS+AVA
Sbjct: 129 TIDCSTYGTFDSSKSSTFQSNDTDFLISYGDGSFAEGTWGTDVIKLDDSLSLNDVSVAVA 188

Query: 257 NDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSP 316
           + TNS++GVLGIGL  LETTYSS +S+     +MY NFP+ LK+ G+ +   YSLYLN P
Sbjct: 189 SSTNSSMGVLGIGLRPLETTYSSTKSVNEKTSYMYDNFPISLKKSGLIESTAYSLYLNDP 248

Query: 317 DAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLG-LSNQXXXXXX 375
            + +G+ILFG VD SK+ G LYT+P+L+   +     P++FDVTL G+G + +       
Sbjct: 249 SSKSGNILFGGVDHSKYTGQLYTVPMLS--STTSYKTPVEFDVTLNGIGIIDSSGNKKTL 306

Query: 376 XXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSK-HDETKIVFNFG 434
              +   LLDSG+T +YLP  L+ M+ + LGA +  N+ YY +DC ++  D+TKIVF+ G
Sbjct: 307 TATQFYGLLDSGTTFSYLPSALVAMIGEELGASYDSNIGYYTIDCSAEDSDDTKIVFDMG 366

Query: 435 GFNIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANF 494
           GF+I T L+ +   IS+ TC+L I+P  D   +LGD+FL +AY+VYDL+++EI+MAQA +
Sbjct: 367 GFHINTTLSDFVIQISTSTCILSIVPQ-DGKVVLGDSFLNNAYIVYDLDNYEIAMAQAAW 425

Query: 495 DVNHE-DIEVVSSSIP 509
           D   E +I+V+S++IP
Sbjct: 426 DSTREANIDVISTTIP 441

 Score =  105 bits (261), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 70/97 (72%)

Query: 19  AAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYS 78
           A+ S +     PK + L+F+KR+G+++  S      +   +KRDDG  +++L N+Q+FYS
Sbjct: 20  ASASSKDNTSPPKYLALNFEKRYGDSFLNSSSSNGPSAQLIKRDDGYEQVTLTNQQSFYS 79

Query: 79  VDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNS 115
           V++E+G+PSQK+TVLLDTGSSD W+T SDNPYC + S
Sbjct: 80  VEVEMGTPSQKLTVLLDTGSSDFWVTSSDNPYCGTTS 116

>Suva_10.212 Chr10 complement(396611..398848) [2238 bp, 745 aa] {ON}
           YLR121C (REAL)
          Length = 745

 Score =  313 bits (802), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 157/316 (49%), Positives = 216/316 (68%), Gaps = 4/316 (1%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTA-FEISYGDGSFASGEWGRDHIEL-GSLNISDVSMAV 255
           +++C +YG FDK  SST+ +N++A F  SYGDG+FA G +G+D +   G L++S +S AV
Sbjct: 101 AMNCDQYGVFDKANSSTFTANHSAPFYASYGDGTFAEGVFGQDKLHYSGGLDLSGLSFAV 160

Query: 256 ANDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNS 315
           AN +NSTVGVLGIGLP LE TYS   ++     + Y NFP+ LK  G      YSL+LN 
Sbjct: 161 ANKSNSTVGVLGIGLPMLEVTYSGKVAVADKRSYQYDNFPLFLKRSGAIDATAYSLFLND 220

Query: 316 PDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXX 375
               +GS+LFGAVD SK+ G LYTIP++N+YK++G  +P+ FDVTLQGLGL  +      
Sbjct: 221 ETQTSGSVLFGAVDHSKYLGQLYTIPLVNLYKAQGYQRPVAFDVTLQGLGLQTRAHNTTL 280

Query: 376 XXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDE-TKIVFNFG 434
              +IPALLDSG+TL YLP D + ++A  L A FS+ L YY   CP+  D  T +VF+ G
Sbjct: 281 TTTRIPALLDSGTTLTYLPADAVALMAKSLNATFSKELGYYEYACPTSGDNATSVVFDLG 340

Query: 435 GFNIETNLTTYTTPISSDTCVLRILP-SGDSSAILGDAFLVHAYVVYDLEDFEISMAQAN 493
           GF+I   L+ +T   +  TCVL I+P +G+++AILGD+FL  AYVVYDL+++E+S+AQA 
Sbjct: 341 GFHINAPLSDFTMQTNVGTCVLAIVPQAGNATAILGDSFLRSAYVVYDLDNYEVSLAQAK 400

Query: 494 FDVNHEDIEVVSSSIP 509
           +    EDIE + SS+P
Sbjct: 401 YGSGKEDIEAIRSSVP 416

 Score = 77.0 bits (188), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 52/83 (62%), Gaps = 10/83 (12%)

Query: 31  KIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKI 90
           K V++ F KR  +N   S LGKR          G+    L N Q+FYSV+L +G+PSQ +
Sbjct: 28  KYVRIPFAKR--QNGPGSELGKRAG--------GDENFVLSNEQSFYSVELALGTPSQNV 77

Query: 91  TVLLDTGSSDLWITGSDNPYCKS 113
           TVLLDTGS+DLW+  + NPYC S
Sbjct: 78  TVLLDTGSADLWVPSNANPYCGS 100

>KNAG0G02410 Chr7 complement(550827..552419) [1593 bp, 530 aa] {ON} 
          Length = 530

 Score =  306 bits (784), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 156/316 (49%), Positives = 210/316 (66%), Gaps = 13/316 (4%)

Query: 199 IDCSRYGTFDKNQSSTYKSNNTA--FEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           +DCS YGTF    SST+  N++A  F I+YGD +FASG WG+DH+ L  +N++ VS AVA
Sbjct: 117 VDCSEYGTFSLEDSSTWSQNSSAPPFYITYGDTTFASGVWGQDHLHLQDVNVTGVSFAVA 176

Query: 257 NDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSP 316
           N TNSTVGV+GIGLPGLETT S  +       + Y+NFP VLK  G T+  +YSLYLN  
Sbjct: 177 NRTNSTVGVMGIGLPGLETTNSGSRP------YTYANFPQVLKNSGATQSALYSLYLNDL 230

Query: 317 DAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXX---XX 373
           +   GSILFGAVD SK+ GS+YT+PI+N  +S G + PIQFD+TLQG+GLS+        
Sbjct: 231 EEERGSILFGAVDHSKYTGSMYTLPIINRLQSYGYTTPIQFDITLQGIGLSSSESNGDEV 290

Query: 374 XXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNF 433
                K+PALLDSG+T+ YLP +++  +A  LGA  S     Y++ C +  +   +V++F
Sbjct: 291 TITSTKMPALLDSGTTMTYLPSNIVSQIAQQLGASMSARFGQYVLPCSNVPENMHLVYDF 350

Query: 434 GGFNIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQAN 493
           GGF+I +NLT Y    S   C+L + P   ++AILGD FL  AYVVYDLE+ +I +AQA 
Sbjct: 351 GGFHINSNLTNYIVQASQTLCILGLFPRDSNTAILGDTFLTDAYVVYDLENLQIGLAQAK 410

Query: 494 FDVNHED--IEVVSSS 507
           F V+  D  I++V+ S
Sbjct: 411 FGVSDSDAKIDIVTGS 426

 Score =  101 bits (251), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 71/105 (67%), Gaps = 4/105 (3%)

Query: 33  VKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITV 92
           V + F+K+ G+NY  +   +R  +   KR+ G  E++L N+Q+F+SV+L+VG+P+Q +TV
Sbjct: 22  VGMRFEKKFGDNYAGATKWQRPQMRLAKRNTGYEEITLTNQQSFFSVELDVGTPAQNVTV 81

Query: 93  LLDTGSSDLWITGSDNPYC----KSNSHSSKKRDIGDNSLDDIFS 133
           L+DTGSSDLWITG+DNPYC     S + S  +RD  D S    FS
Sbjct: 82  LVDTGSSDLWITGADNPYCLTYSGSGADSIPRRDRVDCSEYGTFS 126

>ZYRO0E02266g Chr5 complement(169081..170601) [1521 bp, 506 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 506

 Score =  301 bits (772), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 187/486 (38%), Positives = 276/486 (56%), Gaps = 41/486 (8%)

Query: 32  IVKLSFDKRHGENYEESLLGKRDALPFVKRDDG--EYELSLRNRQNFYSVDLEVGSPSQK 89
           + K+ F KR+G++++ES       + F ++  G  + E+ + N+  +YS  + +G+P Q+
Sbjct: 29  VGKIPFSKRYGKSFDESR-----QISFSEKGTGGDDQEIDISNQNVYYSASIYLGTPGQE 83

Query: 90  ITVLLDTGSSDLWITGSDNPYCKSNSH-SSKKRDIGDNSLDDIFSDITAGGSGAIYKTLT 148
           +T+LLDTGSSDLWI      +C+S+S  ++K +  G  S   +FS  +A G  +   T T
Sbjct: 84  LTLLLDTGSSDLWIPQKGGYHCQSDSDDATKGKSSGIAS--QLFSIASAEGGPSPSLTTT 141

Query: 149 LTXXXXXXXXXXXXXIDVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSIDCSRYGTFD 208
           L                +                              +S   S  G FD
Sbjct: 142 L----------------IGSSGGSHPDPLEPTNRNVQPPAAITASALEESCQSSS-GNFD 184

Query: 209 KNQSSTYKSNNT--AFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVL 266
            N SS++  N+T   F I YGD S+ASG W  D + +G +++ D+++AVA+DTNS+V V 
Sbjct: 185 PNSSSSFNKNDTVDGFFIEYGDNSYASGYWATDDLTVGDISVKDMTIAVADDTNSSVAVF 244

Query: 267 GIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSILFG 326
           GI   GLE++   D      D H Y NFP +LK++GI K+N YSLYLNS  A +G+ILFG
Sbjct: 245 GISYRGLESSVFGDNLQ---DPHEYENFPYLLKDQGIVKRNAYSLYLNSAGASDGNILFG 301

Query: 327 AVDKSKFDGSLYTIPILNVYKSRGVSQPIQ-FDVTLQGLGLSNQXXXXXXXXXKIPALLD 385
            VD +K+ G LYT+P+L   K +  S P + F VT+QG+G+                LLD
Sbjct: 302 GVDHNKYSGDLYTLPVL---KGQEDSDPWERFVVTVQGIGIKGSETQNTLTTTPFIGLLD 358

Query: 386 SGSTLAYLPEDLLEMVADGLGARFSEN--LNYYLMDCPSKHDETKIVFNFGGFNIETNLT 443
           SG+T  YLPE + +MVA+  G  F ++  +  Y++ CPS  D+ KIVFNFGGFNIET+L+
Sbjct: 359 SGTTAVYLPEPVADMVANAYGGSFDDDPEVQSYVISCPS--DDEKIVFNFGGFNIETSLS 416

Query: 444 TYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNHEDIEV 503
            Y T   +  C+L I P+ D   ILGD+FL  +YVVYD+++ EIS+AQANFD + ED+E 
Sbjct: 417 NYITDNGNGQCILNISPTSDYMGILGDSFLRDSYVVYDMDNNEISLAQANFD-STEDVEA 475

Query: 504 VSSSIP 509
           ++  +P
Sbjct: 476 ITGPVP 481

>NDAI0J01030 Chr10 (235967..237925) [1959 bp, 652 aa] {ON} 
          Length = 652

 Score =  305 bits (781), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 211/319 (66%), Gaps = 5/319 (1%)

Query: 197 QSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           +++DC  YGTF+ ++SST+K+N T+F ISYGD +FASG W +D + L  LN++ +S AVA
Sbjct: 240 RTLDCQEYGTFNSSRSSTFKNNYTSFSISYGDSTFASGTWAQDVLNLSDLNVTGLSFAVA 299

Query: 257 NDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSP 316
           N TNSTVGVLGIGLP LE+TYS          + Y NFPMVLK+ G      YSL+L+  
Sbjct: 300 NMTNSTVGVLGIGLPALESTYSGASGATQRQMYQYMNFPMVLKQSGAIHTTTYSLFLDDL 359

Query: 317 DAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXX 376
           D  +GS+LFGA+D SK+ G LYT+P++N+ ++ G S PIQFDVTL G+GL N        
Sbjct: 360 DESHGSVLFGAIDHSKYTGQLYTVPMINIMRNSGYSNPIQFDVTLFGIGLQNGERNLTLT 419

Query: 377 XXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGF 436
             K+ ALLDSG+T++Y P  ++E+VA  + A++S  L +Y + C S    T +VF+FGGF
Sbjct: 420 TTKLAALLDSGTTISYFPTSVVELVARQINAQYSARLGFYTVPCRSVSSNTNLVFDFGGF 479

Query: 437 NIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQAN--- 493
           +I   L  +    S  TC+L + P      ILGD FL HAYVVYDL+++ I++AQA+   
Sbjct: 480 HISGPLQDFLIQTSQQTCILAMAPQESQHVILGDIFLTHAYVVYDLDNYVIALAQADTST 539

Query: 494 -FDVNHEDIEVVS-SSIPQ 510
               +  DIE+++ S+IP+
Sbjct: 540 SNQSSSSDIELITNSTIPR 558

 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 67/102 (65%), Gaps = 8/102 (7%)

Query: 24  EVEEQTP----KIVKLSFDKRHGENYEESLLGKRDALPFVKRDD----GEYELSLRNRQN 75
           E  E  P    K VKL F+K  G+++E +    +     +KRD+    G  ++ + N+Q+
Sbjct: 45  EASENQPAPTLKYVKLPFEKYTGDSFESATRNNKPLNQLLKRDNEDGAGYEDVKITNQQS 104

Query: 76  FYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHS 117
           FYSV+L +G+P Q +TVL+DTGS+DLW+TGS NP+C+S+ +S
Sbjct: 105 FYSVELAIGTPPQHVTVLVDTGSADLWVTGSMNPFCQSSLNS 146

>SAKL0C02970g Chr3 (285647..287425) [1779 bp, 592 aa] {ON} some
           similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 592

 Score =  302 bits (774), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 185/488 (37%), Positives = 262/488 (53%), Gaps = 38/488 (7%)

Query: 25  VEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVG 84
           +E +T K V + F K  G+ +  S    +      KR D    L L+  +  Y V+L +G
Sbjct: 21  IEPETSKHVSIPFKKAKGKTFSGSADSNKWRNRLSKRGDDYENLGLKTDKLAYYVELSLG 80

Query: 85  SPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKKRDIGDNSLDDIFSDITAGGSGAIY 144
           +P QK  V LDTGSSDLW+  S NPYC  +  +  ++  G+ +  +   D TA      +
Sbjct: 81  TPGQKFEVQLDTGSSDLWVYDSHNPYCMPSETTHNEKVYGEAAYGETAFDQTALDQ---F 137

Query: 145 KTLTLTXXXXXXXXXXXXXIDVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSIDCSRY 204
           +TL  +             +  S                              +IDC+ +
Sbjct: 138 ETLLASATEDDPSYTQTEAVPSSE----------------------------ATIDCASF 169

Query: 205 GTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVG 264
           GTF+   SS++ +N+T F ISY D + A G W +D ++LG L ISD+  AVA   +    
Sbjct: 170 GTFNYTLSSSFSANDTEFYISYLDSTAAYGIWAQDVLKLGDLEISDMPFAVAVVGDVQTP 229

Query: 265 VLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSIL 324
           V G+G PG E+T  S       + + Y+NFP++LK +G  KK VYSL+L++ D+ +GS L
Sbjct: 230 VFGVGFPGTESTAGSSVK----EPYEYANFPVLLKSQGYVKKVVYSLFLDAQDSSSGSFL 285

Query: 325 FGAVDKSKFDGSLYTIPILNVYKSRGV--SQPIQFDVTLQGLGLSNQXXXXXXXXXKIPA 382
            GAVD SK+ G LYT+P+ +         S P +F +TLQGLG+S++         +   
Sbjct: 286 LGAVDHSKYSGGLYTLPMYSGTDGDDTLSSTPSRFIITLQGLGISDKGENKTVATTRSLV 345

Query: 383 LLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNL 442
            LDSGST    P +  E++AD LGA +S +   Y+M CPSK D+T  V++FGGF I + L
Sbjct: 346 YLDSGSTGTVFPSEYAELIADSLGASYSGDYEAYVMKCPSKDDDTNFVYDFGGFTISSPL 405

Query: 443 TTYTTPISSDT-CVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNHEDI 501
           + Y      D+ CVL I        +LGDAFLV AYVVYDLED+EIS+AQAN+D   E+I
Sbjct: 406 SNYMEATGDDSVCVLDIDTDDIPYIVLGDAFLVSAYVVYDLEDYEISIAQANYDGGSENI 465

Query: 502 EVVSSSIP 509
           EVVS SIP
Sbjct: 466 EVVSDSIP 473

>ZYRO0F10318g Chr6 complement(835672..837132) [1461 bp, 486 aa] {ON}
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 486

 Score =  295 bits (754), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 149/324 (45%), Positives = 210/324 (64%), Gaps = 15/324 (4%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           +IDC++YGTFD ++SS++K+N+++  I YGD S+A G +G+D +E+ SL+I +VS+ VA+
Sbjct: 130 TIDCNQYGTFDYSKSSSFKANDSSLLIRYGDQSYALGRFGQDTVEMNSLSIPNVSLGVAH 189

Query: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPD 317
             N T GVLGIGL GLETT +   S ++   + Y NFP VLK +GI   N YSL+LNSP 
Sbjct: 190 QANVTQGVLGIGLAGLETTNTGFSSTLNSKSYTYENFPQVLKSQGIIDANAYSLFLNSPG 249

Query: 318 AHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLS---------- 367
           A  G ILFG VD SK+ G LYT+PI+N   +     PIQF VTLQG+G+S          
Sbjct: 250 ASQGGILFGGVDHSKYTGPLYTVPIIN---TGAPGNPIQFQVTLQGVGISLDKSNGTNTN 306

Query: 368 --NQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHD 425
             +          K P LLDSG+TL  LP  + + +A  LGA ++   +YY + CPS++D
Sbjct: 307 AADSTSNVTLTASKFPVLLDSGTTLMTLPRPVTDQMAKQLGATYNSETSYYQLKCPSQND 366

Query: 426 ETKIVFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDF 485
            T+++ +FGGF +   +T + T   +  C+L I PS   S  LGD FLV AYVVYDL+++
Sbjct: 367 NTRLILDFGGFQVNAKITNHITRSQNGECLLGITPSDTDSGTLGDVFLVDAYVVYDLDNY 426

Query: 486 EISMAQANFDVNHEDIEVVSSSIP 509
           EIS+AQA+F  + + IE +SSS+P
Sbjct: 427 EISLAQADFSDSAQSIEPISSSVP 450

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 74/124 (59%), Gaps = 11/124 (8%)

Query: 1   MKWNQILKCTLLANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVK 60
           MK+  +    +LA+    AA      E +PKI++LSF+K  G    + +L      P  +
Sbjct: 1   MKFTTLNAIGILASTVSGAAIENHRREVSPKIIQLSFNKHGGAANNKDIL-----TPTSQ 55

Query: 61  RDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCK----SNSH 116
             D    ++  NR  FYSV+L VG+P+QK++VLLDTGSSDLW+ G+DN +C+    S+S+
Sbjct: 56  NTD--ISVNATNRYIFYSVELSVGTPAQKLSVLLDTGSSDLWVPGADNLFCENHAVSDSN 113

Query: 117 SSKK 120
           S+ K
Sbjct: 114 STDK 117

>TBLA0D00140 Chr4 (31269..33092) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  296 bits (757), Expect = 8e-92,   Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 210/327 (64%), Gaps = 23/327 (7%)

Query: 199 IDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGS-LNISDVSMAVAN 257
           IDCS YGTFD ++SST+ SN+T F I YGD +FASG WGRD IE    LN++D S  VA+
Sbjct: 184 IDCSTYGTFDPSKSSTFVSNDTNFMIRYGDRTFASGTWGRDSIEFSDHLNLTDFSFGVAD 243

Query: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDR--HMYSNFPMVLKERGITKKNVYSLYLNS 315
            TNST+ VLG+GLP LE TYS     +S DR  + Y+NFPM LK+ G+  + VYSLYLN 
Sbjct: 244 LTNSTISVLGMGLPRLEVTYSG----LSLDRSPYTYANFPMALKQSGLIDRMVYSLYLNK 299

Query: 316 PDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXX 375
             A  GS+LFGAVD SK+ GSL TIP++++    G   PI F+V LQGLG+S+       
Sbjct: 300 AGASTGSVLFGAVDHSKYHGSLNTIPLISL---SGSGIPIAFNVALQGLGMSSDSQGTQT 356

Query: 376 -XXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFG 434
                +PALLDSG+T+ YLP+ L+  VA  LGA F E    YL+DCPS  D+ +  F+FG
Sbjct: 357 FLSTPLPALLDSGTTMTYLPDALVATVASTLGASFDEAQGLYLLDCPSGSDDREFNFDFG 416

Query: 435 GFNIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANF 494
           GF I   L+ +      D CVL +  S    AILGD+FL  AYVVYDLE+ EISMAQA +
Sbjct: 417 GFQISVPLSNFILEALPDVCVLTLFESHAERAILGDSFLTEAYVVYDLENLEISMAQARY 476

Query: 495 DVNHED------------IEVVSSSIP 509
           D +++             +EVV+S+IP
Sbjct: 477 DDDNDSDIEKYNADNKVLLEVVTSNIP 503

 Score = 83.6 bits (205), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 40/86 (46%), Positives = 62/86 (72%), Gaps = 5/86 (5%)

Query: 31  KIVKLSFDKRHGENYEE--SLLGKRDALP---FVKRDDGEYELSLRNRQNFYSVDLEVGS 85
           K+++L  +K +G++     S + +  + P    VKR+DG   + ++N+Q FYSVDL +G+
Sbjct: 28  KVLRLDINKFYGDSKFNLGSEIDEDISTPSARLVKREDGHEIIEIQNQQAFYSVDLMLGT 87

Query: 86  PSQKITVLLDTGSSDLWITGSDNPYC 111
           P QK+TVL+DTGSSDLW+TG++NPYC
Sbjct: 88  PPQKVTVLVDTGSSDLWVTGNNNPYC 113

>KAFR0B06530 Chr2 (1355295..1356911) [1617 bp, 538 aa] {ON} 
          Length = 538

 Score =  293 bits (750), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 150/313 (47%), Positives = 211/313 (67%), Gaps = 6/313 (1%)

Query: 200 DCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDT 259
           +CS+YGTF+ N+SST+ SNN+ F I YGD +FASG WGRD + +  LN++ ++ AVAN +
Sbjct: 142 NCSQYGTFNTNKSSTWSSNNSRFFIQYGDTTFASGTWGRDVMSINGLNVTGLTFAVANAS 201

Query: 260 NSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAH 319
           NS+  VLGIGL  LETTY+   S  S   + Y+NFP+VLK  G+T+   YSL+LN  DA 
Sbjct: 202 NSSNSVLGIGLTQLETTYNGSNSSHS---YTYANFPVVLKNAGLTESISYSLFLNELDAE 258

Query: 320 NGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXXK 379
           +GSILFGAVD SK+ G+LYT+P++N YK RG   PI+F VTLQG+G+ +          K
Sbjct: 259 SGSILFGAVDHSKYSGNLYTLPLVNTYKDRGFPNPIEFAVTLQGIGIVSGSKKTTITQTK 318

Query: 380 IPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHD-ETKIVFNFGGFNI 438
           + A+LDSG++L  LP  ++  +A  L  R+S  ++ YL+ C  ++   T +VF+FGGF I
Sbjct: 319 LAAILDSGTSLTVLPGTIIHSIASSLNGRYSPLIDSYLVSCSLRNSTNTNLVFDFGGFTI 378

Query: 439 ETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNH 498
           +  L+ +   I  D C+L +    ++S ILGD FL  AYVVYDLE+ +ISMAQA FD + 
Sbjct: 379 KGTLSNFILEIEDDICILGLSSVDENSVILGDTFLASAYVVYDLENLQISMAQAKFDNST 438

Query: 499 EDIEVV--SSSIP 509
            DI+V+  +S +P
Sbjct: 439 SDIDVIRGNSGVP 451

 Score = 79.0 bits (193), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 55/78 (70%), Gaps = 7/78 (8%)

Query: 40  RHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSS 99
           +H  N+++S L KR +  +        EL ++N+Q+FYS+DL +G+P Q +TV +DTGSS
Sbjct: 62  QHNLNFKQSELYKRASSDY-------QELEIKNQQSFYSLDLFIGTPGQNVTVQIDTGSS 114

Query: 100 DLWITGSDNPYCKSNSHS 117
           DLW+TGS+NPYC  ++ S
Sbjct: 115 DLWVTGSNNPYCNGSTFS 132

>KLTH0G12386g Chr7 (1052977..1054719) [1743 bp, 580 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 580

 Score =  293 bits (749), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 154/312 (49%), Positives = 206/312 (66%), Gaps = 1/312 (0%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           ++ CS YGTF  + SS+++SNNTAF I YGD ++A G WGRD++ L  + +S +SMAVAN
Sbjct: 185 TLTCSSYGTFATDSSSSFQSNNTAFYIEYGDSTYALGTWGRDNVTLQDITLSGISMAVAN 244

Query: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPD 317
           ++NST GVLGIGL  LE T +       G+ + Y N P  +   GI  KN YSL+L+S D
Sbjct: 245 ESNSTFGVLGIGLAALEVT-NVGTLATRGNSYTYENLPAKMVSEGIIHKNAYSLFLDSLD 303

Query: 318 AHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXX 377
           A  GS+LFGAVD SK+ GSLYT+P+ N YKS G S PIQ +VTLQG G++          
Sbjct: 304 AKEGSVLFGAVDHSKYTGSLYTLPLSNSYKSMGYSDPIQLEVTLQGFGMTANNTNSTFTT 363

Query: 378 XKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFN 437
             + ALLDSG+TL YLP  L+  VA   GAR+  +  YYL+ C    D  ++VF+FGGF+
Sbjct: 364 TPLTALLDSGTTLTYLPTTLVRQVAAKYGARYDSSYGYYLLSCSDVKDTDELVFDFGGFH 423

Query: 438 IETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVN 497
           I + +  +    +S+ C L ++P   SS ILGD FL  AYVVYDL++ EIS+AQAN+D  
Sbjct: 424 INSKVENFLIRATSNICALGLIPQSSSSLILGDNFLTAAYVVYDLDNLEISLAQANYDGG 483

Query: 498 HEDIEVVSSSIP 509
             +IEV+SSS+P
Sbjct: 484 SSNIEVISSSVP 495

 Score = 99.4 bits (246), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 44/98 (44%), Positives = 63/98 (64%)

Query: 24  EVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEV 83
           E  +   K VK+SFDK  G+  E++  G        KR DG   + ++N+Q FYSV+L V
Sbjct: 26  EGAQSASKFVKVSFDKLRGDTAEDATAGAVAHGVLAKRADGSETVVIKNQQTFYSVELGV 85

Query: 84  GSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKKR 121
           GSP+Q +T+L+DTGSSD+W+ GS+NPYC+  S  + K 
Sbjct: 86  GSPAQNVTLLIDTGSSDMWVMGSNNPYCEGGSSGNSKH 123

>KLLA0E04049g Chr5 (366535..368304) [1770 bp, 589 aa] {ON} similar
           to uniprot|P12630 Saccharomyces cerevisiae YIL015W BAR1
           Aspartyl protease secreted into the periplasmic space of
           mating type a cells, cleaves and inactivates alpha
           factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 589

 Score =  288 bits (738), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 152/313 (48%), Positives = 212/313 (67%), Gaps = 4/313 (1%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           ++DCS +GTFD ++SS+++SN+T F ISY DG+FA G+WG D I L  +N++ +S AV+N
Sbjct: 188 TLDCSEFGTFDTSKSSSWQSNDTRFYISYADGTFADGDWGVDEIHLDDVNVTGLSFAVSN 247

Query: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPD 317
            T+S  GVLGIGL G E+TYS   S    +R+ Y NFP+VL+  G+ +KN YS++LN  D
Sbjct: 248 YTDSQFGVLGIGLTGSESTYSGQLSTY--NRYQYDNFPIVLQRNGVIEKNAYSVFLNDLD 305

Query: 318 AHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXX 377
           A +GSILFGAVD SK+ G+LYT+P++N  +S G ++ I+  +TLQG+G+++         
Sbjct: 306 ADSGSILFGAVDHSKYTGTLYTVPMVNALRSIGYTEQIRLSITLQGIGVTSSYGNETVTQ 365

Query: 378 XKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFN 437
            K PALLD+G+T  Y P  L   +A  + A +S +  YY +DC S  D   +VF+FGGF+
Sbjct: 366 TKYPALLDTGATFCYFPSSLAAAIASSVSATYSSSSGYYFVDCDSGSDY-DLVFDFGGFH 424

Query: 438 IETNLTTY-TTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDV 496
           I + L+ Y  T  SS  CVL ILP  D+   LGDAFL  AYVVYDLE+ EIS+AQA++  
Sbjct: 425 IISPLSDYIVTTSSSSQCVLGILPQSDNEITLGDAFLTSAYVVYDLEELEISLAQASYTS 484

Query: 497 NHEDIEVVSSSIP 509
             E IEV+  S+P
Sbjct: 485 GDEKIEVIRDSVP 497

 Score = 99.0 bits (245), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 49/115 (42%), Positives = 71/115 (61%), Gaps = 4/115 (3%)

Query: 1   MKWNQILKCTLLANVARSAAFSQ----EVEEQTPKIVKLSFDKRHGENYEESLLGKRDAL 56
           MK + +    LLA++  +   ++    +V E   K V +SFDK  G +  E+ L KR   
Sbjct: 1   MKLSDVCLGALLASLGSAGYITKRDVSQVGEANKKHVFMSFDKLRGNDASEASLSKRRVG 60

Query: 57  PFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYC 111
              KR DG  ++ + N+  FYSVDLE+G+P+QK+ VL+DTGSSDLW+ GS NP+C
Sbjct: 61  HLKKRADGYVDVEIDNQNTFYSVDLEIGTPAQKVGVLIDTGSSDLWVPGSGNPFC 115

>KNAG0E03220 Chr5 complement(647282..648904) [1623 bp, 540 aa] {ON} 
          Length = 540

 Score =  287 bits (734), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 200/313 (63%), Gaps = 2/313 (0%)

Query: 199 IDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAND 258
            DC+  GTF+ ++SS++KSNNT F   Y D +FASG WG D + +G +++SDVS+AV N 
Sbjct: 147 FDCALLGTFNNSESSSFKSNNTDFLTGYADNTFASGFWGTDVVRIGDVDVSDVSLAVVNL 206

Query: 259 TNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDA 318
           TNST  VLGIG+P LE++ +   +  +   + Y NFP+ LK +G+ +K  YSL+LN  DA
Sbjct: 207 TNSTSPVLGIGMPVLESSNAGRLAAETNSSYEYDNFPVQLKNKGVIEKIAYSLFLNDSDA 266

Query: 319 HNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXX 378
             GS+LFGAVD SK++  L+T+P++N YK +GV  PI+F VT+ GLG             
Sbjct: 267 TEGSVLFGAVDHSKYENGLFTVPMVNTYKDQGVQHPIEFYVTMYGLGFKKDGFLNTITTT 326

Query: 379 KIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNI 438
             P LLDSGST +YLP+ L+ M+A  L A FSE +N Y + CPS+ D T + F+ GGF I
Sbjct: 327 NFPVLLDSGSTTSYLPDTLVSMLASALNATFSEKINGYTLKCPSEEDATFLSFDLGGFLI 386

Query: 439 ETNLTTYTTPISSDTCVLRILPSGDSSA--ILGDAFLVHAYVVYDLEDFEISMAQANFDV 496
           +  L+        + CVL +   G+     ILGD FL  AYVVYDLE +EIS+ QA+   
Sbjct: 387 DVPLSDLVAKRHKNQCVLMVKGQGEGEGGYILGDTFLSSAYVVYDLESYEISIGQASTGD 446

Query: 497 NHEDIEVVSSSIP 509
             EDIEV+ S++P
Sbjct: 447 AAEDIEVIKSTVP 459

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 8/81 (9%)

Query: 31  KIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKI 90
           K V++ F K        S     D+L   +R D    + + N+Q +YSV+L VG+P Q +
Sbjct: 26  KYVQMGFHKSR------SFSSGGDSL--ARRADDYLSVDVENQQLYYSVELYVGTPPQNV 77

Query: 91  TVLLDTGSSDLWITGSDNPYC 111
           +VL+DTGSSDLW+T  DNPYC
Sbjct: 78  SVLIDTGSSDLWLTSPDNPYC 98

>TBLA0A03910 Chr1 complement(977504..979294) [1791 bp, 596 aa] {ON}
           Anc_8.318 YLR120C
          Length = 596

 Score =  289 bits (739), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 143/313 (45%), Positives = 202/313 (64%), Gaps = 2/313 (0%)

Query: 199 IDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAND 258
           I+C+ +GTF+  +SST+K+N+T F ISYGD +FASG WGRD +    +N++ +S  VAN 
Sbjct: 196 INCTEFGTFNTKKSSTFKNNHTDFFISYGDNTFASGYWGRDVLSFQDINVTGLSFGVANV 255

Query: 259 TNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDA 318
           TNSTVGVLGIGLP LE+TY    + V+   ++Y+NFP VLK  GI  K  YSL+LN  D+
Sbjct: 256 TNSTVGVLGIGLPELESTYFGTVNSVNESSYIYNNFPQVLKNSGIINKTAYSLFLNKSDS 315

Query: 319 HNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXX 378
             GS+L GAVD SKF   LYT+P+LN+  S+G + P  F V +Q +              
Sbjct: 316 TQGSLLLGAVDTSKFADKLYTVPMLNINPSKGYTDPSAFLVLMQKMTRYKYGQGHLVPSS 375

Query: 379 KIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPS--KHDETKIVFNFGGF 436
           +IP LLDSG+T+ YLP  ++E +     A++ E L+ Y + CPS  K ++T   F+FGGF
Sbjct: 376 RIPVLLDSGTTMVYLPRSIVEQIMRHEEAQYVEELDLYQIKCPSPNKKNQTSFSFDFGGF 435

Query: 437 NIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDV 496
            I+ +L+ +  P  +  C+  ++P   +  ILGD+FL HAYVVYDLED+EISMAQA +D 
Sbjct: 436 QIKASLSDFIVPTDNGQCIFGMIPQDMNVGILGDSFLTHAYVVYDLEDYEISMAQAVYDG 495

Query: 497 NHEDIEVVSSSIP 509
              +   + S++P
Sbjct: 496 GEPNYIPIVSTVP 508

 Score = 97.4 bits (241), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 71/101 (70%), Gaps = 6/101 (5%)

Query: 19  AAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRD-----DGEYE-LSLRN 72
           A  ++ ++   PK ++L FD+ +GE+YE+S LGK  A+   KR      +G YE + L N
Sbjct: 33  AKEAKNIQPIKPKFLELKFDRHYGESYEDSTLGKDGAVHLEKRTFDSAYNGSYEDVILTN 92

Query: 73  RQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKS 113
           +  FYSV+L++G+P+QK+TV++DTGSSDLWIT + NP+C +
Sbjct: 93  QLTFYSVELDIGTPAQKVTVVVDTGSSDLWITETSNPFCST 133

>Ecym_4251 Chr4 complement(520455..521963) [1509 bp, 502 aa] {ON}
           similar to Ashbya gossypii AGL192W
          Length = 502

 Score =  281 bits (720), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 145/318 (45%), Positives = 205/318 (64%), Gaps = 11/318 (3%)

Query: 197 QSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           + +DC  YG FDK++SS++K+N+T F ISYGD SFASGEWG D ++LG LN   ++ AVA
Sbjct: 118 EPLDCFEYGAFDKSKSSSWKNNHTEFYISYGDTSFASGEWGTDKLDLGDLNADGLTFAVA 177

Query: 257 NDTNSTVGVLGIGLPGLETTYSSDQSMVSGDR-HMYSNFPMVLKERGITKKNVYSLYLNS 315
             +NS+V VLGIGL G+E T +S      GD  + Y N P+VLK  G+  K  YSLYLN 
Sbjct: 178 TASNSSVAVLGIGLTGIEVTRAS------GDNGYEYDNLPIVLKRNGVIDKTAYSLYLND 231

Query: 316 PDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXX 375
            DA +GS+LFGAVD SK+ G+L T+P++NV    G  +PI+  +TL GLG S+       
Sbjct: 232 LDATSGSVLFGAVDHSKYTGTLATVPLVNVNARYGFPKPIELHITLNGLGFSSGKKRGTI 291

Query: 376 XXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCP-SKHDETKIVFNFG 434
              K+PALLDSG+TL+Y P +L   +A  +GA ++  L  +L+ C  +K +   +++NFG
Sbjct: 292 SATKVPALLDSGTTLSYFPTELAAAIASNVGAVWNARLRKFLIPCSQAKRNNIDLIYNFG 351

Query: 435 GFNIETNLTTYTTPIS-SDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQAN 493
           G  I + L  Y +  +  D C+L I+P+  +  ILGD FL   Y VYDLE  E+S+AQA 
Sbjct: 352 GVEITSPLVNYLSETNVEDVCLLGIVPTSSNDIILGDVFLTSVYTVYDLEALEVSIAQAA 411

Query: 494 FDVN--HEDIEVVSSSIP 509
           +  +   E+IEV+ S++P
Sbjct: 412 YGASAEKENIEVIKSTVP 429

 Score = 84.0 bits (206), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 72/125 (57%), Gaps = 7/125 (5%)

Query: 1   MKWNQILKCTLLANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPF-- 58
           MK +  +  T+LA V  S A   +  E +   V+   DK  G ++  S   ++  +PF  
Sbjct: 1   MKLSGCIAATVLAFVPSSFALLAQRAE-SAAYVRFDLDKTRGNDFRSS---EKGVMPFGE 56

Query: 59  -VKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHS 117
             KRDD   ++ + N Q FYSV+L +G+P+Q++TVL+DTGSSDLWI G+D      NS S
Sbjct: 57  LKKRDDEYVDVKIHNEQTFYSVNLSIGTPAQEVTVLVDTGSSDLWIIGADVDCGPDNSDS 116

Query: 118 SKKRD 122
           ++  D
Sbjct: 117 TEPLD 121

>AGL192W Chr7 (337445..338944) [1500 bp, 499 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR121C (YPS3),
           YDR144C (MKC7) and YLR120C (YPS1); Tandem gene
           duplication in Saccharomyces cerevisiae
          Length = 499

 Score =  278 bits (711), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 138/317 (43%), Positives = 201/317 (63%), Gaps = 10/317 (3%)

Query: 199 IDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAND 258
           ++C  +G+FD ++SST+K NNT F I YGD ++A G WG D ++LG  N+  ++ AVA+ 
Sbjct: 118 LNCYEHGSFDTSRSSTWKDNNTQFHIRYGDSTYAHGTWGTDRLDLGQANVDGLTFAVAHA 177

Query: 259 TNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDA 318
           +NS+V VLGIGLP +ETT SS Q       + Y N PMVLK   + KK VYS+++N  +A
Sbjct: 178 SNSSVAVLGIGLPAMETTMSSQQF-----GYQYDNLPMVLKRNNVIKKTVYSMFINELNA 232

Query: 319 HNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGL---SNQXXXXXX 375
             GS+LFGAVD SK+ G+L T+P++N    R V++P++  VTL  +GL    ++      
Sbjct: 233 KTGSVLFGAVDHSKYKGTLNTVPLVNANYRRRVNKPVELHVTLAAIGLHTGRDEDKVQTL 292

Query: 376 XXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKH-DETKIVFNFG 434
              K+PALLDSG+TL Y P  L + +A   GAR+      Y++DC S+   +T  +++FG
Sbjct: 293 LGSKVPALLDSGTTLTYFPMQLADRLARAAGARWHSEEVGYIVDCNSRRLHQTAYIYDFG 352

Query: 435 GFNIETNLTTYTTPIS-SDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQAN 493
           GF I + L+ Y+   +   TC   I+P      ILGD FL  AYVV+DLE  E+SMAQAN
Sbjct: 353 GFQIRSPLSDYSMMTNVRGTCRFGIMPHSSDYVILGDVFLTRAYVVFDLEALEVSMAQAN 412

Query: 494 FDVNHEDIEVVSSSIPQ 510
           ++   E IEV++ ++P+
Sbjct: 413 YEGGKEQIEVIAGAVPR 429

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 64/100 (64%), Gaps = 4/100 (4%)

Query: 7   LKCTLLANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEY 66
           L   L  NVA ++   +E   +  + V++ FDK+ G ++ E+  G R A+P + + +   
Sbjct: 8   LGAVLATNVACASLVERE---EAAQFVRMDFDKKRGPSFSEAWSG-RAAVPRLAKRNDWV 63

Query: 67  ELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGS 106
           ++ + N+Q FYSV+L +G+P Q++ VL+DTGSSDLW+ G+
Sbjct: 64  DIEIDNQQMFYSVNLSIGTPPQEVRVLMDTGSSDLWVVGA 103

>CAGL0E01419g Chr5 (132904..134679) [1776 bp, 591 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 591

 Score =  277 bits (709), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 143/330 (43%), Positives = 204/330 (61%), Gaps = 17/330 (5%)

Query: 197 QSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           +++DC     FD  +SS++KSN+T F  SYGD S+ASG WG D + LG+L+I+DV  AVA
Sbjct: 165 KTLDCQSLSLFDLEKSSSFKSNSTPFFTSYGDNSYASGLWGTDDVRLGNLSIADVFFAVA 224

Query: 257 NDTNSTVGVLGIGLPGLET----------------TYSSDQSMVSGDRHMYSNFPMVLKE 300
           N +NS+ GVLG+GLP LE+                  +SD  + +  +  Y+NFP +LK+
Sbjct: 225 NFSNSSTGVLGVGLPALESYNPALSDNFNVSDYLPVNASDADIDNISKPTYANFPQILKQ 284

Query: 301 RGITKKNVYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVT 360
           + + +K  YSL+LN  +A NG ILFGAVD SK+ GSL T+P++N     G++   Q ++T
Sbjct: 285 KNVIEKVAYSLFLNDTNATNGQILFGAVDHSKYTGSLSTLPLVNSLYVEGINDTTQLEIT 344

Query: 361 LQGLGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYY-LMD 419
           L G+GL N          K+PALLDSG+T++YLP DL  +VA  L         +  L +
Sbjct: 345 LDGMGLKNSQGQFTIYNQKMPALLDSGTTVSYLPIDLHSLVAKQLKGIVDPQTGFIELKN 404

Query: 420 CPSKHDETKIVFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVV 479
           CP+K+D T++VFNFGG  I    T +      D C +  +P G+   +LGD FL +AY+V
Sbjct: 405 CPAKNDNTQLVFNFGGAFISIKYTEFIEKSDDDNCYVTFMPQGEPGILLGDNFLRNAYIV 464

Query: 480 YDLEDFEISMAQANFDVNHEDIEVVSSSIP 509
           YDLED EIS+AQANF+   E+IE +  ++P
Sbjct: 465 YDLEDMEISIAQANFNGGAENIEAIVKNVP 494

 Score = 80.9 bits (198), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 68/117 (58%), Gaps = 4/117 (3%)

Query: 12  LANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKR-DDGEYELSL 70
           L NVA  A     V  +  K +KL F+K   +  EE  L    A    KR  D      L
Sbjct: 3   LKNVALVAGCVNAVAAE--KYLKLDFEKHRADIDEELPLTHSAARQLRKRASDDSVAFPL 60

Query: 71  RNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKKRD-IGDN 126
             ++N+YS++LEVG+P Q +++LLDTGSSD+W+ GS+N YCK++ + S+  D +G N
Sbjct: 61  VAQENYYSINLEVGTPPQNVSLLLDTGSSDMWVIGSNNGYCKNSDNKSRNLDALGSN 117

>KLTH0F06754g Chr6 (590569..592872) [2304 bp, 767 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 767

 Score =  279 bits (713), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 174/484 (35%), Positives = 255/484 (52%), Gaps = 59/484 (12%)

Query: 33  VKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYEL---SLRNRQNFYSVDLEVGSPSQK 89
           V + F K  G +Y+++ +G R A    KR   + E     L N   FYSV L++G+P Q+
Sbjct: 36  VAIDFAKAKGISYQDARVGARPA-KLQKRALSQGETLNSELVNNNVFYSVGLDIGTPPQQ 94

Query: 90  ITVLLDTGSSDLWITGSDNPYCKSNSHSSKKRDIGDNSLDDIFSDITAGGSGAIYKTLTL 149
           +TVL D        TGS + +  SN +          S  +  +D+ +  +     T T+
Sbjct: 95  VTVLFD--------TGSSDLWVSSNDNPYCSNGDSTESYANYRADLKSSSALTAAPTTTI 146

Query: 150 TXXXXXXXXXXXXXIDVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSIDCSRYGTFDK 209
           +                                               +IDC++YGTF+ 
Sbjct: 147 SGITIA-----------------------------------------PTIDCAQYGTFNA 165

Query: 210 NQSSTYKSN-NTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGI 268
           ++S++  +N +  F +SY D S+A G W RD + +   +IS +  AVA  +NSTVGVLG+
Sbjct: 166 DRSTSLFANYSKPFFVSYNDDSYALGYWARDKLVVDGDDISSLEFAVAEISNSTVGVLGV 225

Query: 269 GLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSILFGAV 328
           GL GLE+T       +S    +Y NFPMVLKE G   K  YSLYLNS DA +GS+LFG V
Sbjct: 226 GLQGLESTVHYRSPNISS---IYPNFPMVLKENGAIDKIAYSLYLNSLDAPSGSVLFGGV 282

Query: 329 DKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXX--XXXKIPALLDS 386
           D SK+ G LYT+P++N YK  GV  P+QFDVT+QG+G+ ++           KI AL+DS
Sbjct: 283 DHSKYTGGLYTLPLVNTYKDYGVKTPVQFDVTVQGIGIESEKACRQETFTTTKIAALMDS 342

Query: 387 GSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNLTTYT 446
           G+TL Y   +++  +A  + A FS     ++  CPS  D+T+ +F+FGGF I++ L+ Y 
Sbjct: 343 GTTLMYTAPEIVNKIALYVNASFSPGYGLFMFRCPSDGDDTQFIFDFGGFQIKSPLSNYI 402

Query: 447 TPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNHEDIEVVSS 506
                +      L S +   I GD FL  AYVVYDLE+ E+S+AQAN++    +IE + S
Sbjct: 403 LRTDDENICGLGLISSNQGTIFGDEFLASAYVVYDLENLELSLAQANWNPGSPEIEKIVS 462

Query: 507 SIPQ 510
            IP+
Sbjct: 463 EIPR 466

>KAFR0I01700 Chr9 complement(346265..347923) [1659 bp, 552 aa] {ON} 
          Length = 552

 Score =  271 bits (692), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 198/316 (62%), Gaps = 18/316 (5%)

Query: 199 IDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAND 258
           +DC  +GTF+ N SST+ +N+T F I+Y D S A G WG+D + +G L+IS V  AVAN 
Sbjct: 164 VDCGFFGTFNPNDSSTWSTNHTDFVITYSDNSTAEGVWGQDVLSIGGLDISGVPFAVANY 223

Query: 259 TNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDA 318
           TNS++GVLGIGLPG ETTY ++        +MY N PMVLK+ G+     YSL L + + 
Sbjct: 224 TNSSLGVLGIGLPGSETTYLTNS-------YMYDNLPMVLKKSGVIDSAAYSLLLAAYNN 276

Query: 319 HNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXX 378
           +   +LFGAVD SK+ GSLYTIP++N+Y+SRG   P++FDVT+ GLG+S+          
Sbjct: 277 YTSGLLFGAVDHSKYSGSLYTIPMINIYESRGYESPVEFDVTIYGLGISSTDSNTTIATM 336

Query: 379 KIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNI 438
           K PALLDSGST  + P  LL + A+ L A +SE    Y +  P        VF+FGGF+I
Sbjct: 337 KTPALLDSGSTAIFFPTTLLNLAAEQLNATYSEEKGLYTI--PYSPANISFVFDFGGFHI 394

Query: 439 -----ETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQAN 493
                E    +Y  P      +L I+   ++  +LG+AFL  AYVV+D E++EISM Q++
Sbjct: 395 NLPIRELCSVSYGEP----EYILNIVAHNENRIVLGEAFLARAYVVFDFENYEISMGQSS 450

Query: 494 FDVNHEDIEVVSSSIP 509
           +D   EDIE + S++P
Sbjct: 451 YDYAEEDIEAIISTVP 466

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 59/114 (51%), Gaps = 13/114 (11%)

Query: 1   MKWNQILKCTLLANVARSAAFSQEVEEQTP---KIVKLSFDKRHGENYEESLLGKRDALP 57
           +    IL  +++A++  +    + VE+ +    K +KL F     E +E     K   LP
Sbjct: 4   LNLRAILATSVIASLTSALIVDKNVEQLSSNENKYLKLDFAS---ETFE-----KSSRLP 55

Query: 58  FVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYC 111
             KRD   Y     + + +Y V L VG+P Q +T+L+DT SSD+W+T  DNP C
Sbjct: 56  LQKRD--TYATVNISAEFYYVVQLSVGTPGQNVTLLVDTCSSDIWVTSPDNPLC 107

>KAFR0E03940 Chr5 (779476..781392) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  273 bits (697), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 205/312 (65%), Gaps = 1/312 (0%)

Query: 199 IDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAND 258
           IDC+ YGTF  + SS++  NNT F+  Y DGS A+G WG D ++ G   +SD+S+AVA+ 
Sbjct: 118 IDCTTYGTFSVSDSSSFVYNNTDFQTQYADGSSATGFWGHDVVDFGGQELSDISIAVADQ 177

Query: 259 TNSTVGVLGIGLPGLETTYSSDQSMVSGD-RHMYSNFPMVLKERGITKKNVYSLYLNSPD 317
           T+S+ GVLGIGL GLE+TYS   +  S   R+ Y NFP+ L +  + + N YSLYL+   
Sbjct: 178 TDSSFGVLGIGLTGLESTYSGSAAASSSTGRYQYDNFPIRLVQENVIQANAYSLYLDPAT 237

Query: 318 AHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXX 377
             +G+ILFG VD +K+ G L TIP++N  ++ G + PI+  VTL GLG+S+         
Sbjct: 238 GSSGTILFGGVDHNKYSGDLNTIPLINTLEANGYTSPIKLQVTLNGLGVSDGSSTSTVTT 297

Query: 378 XKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFN 437
            +IPALLDSG+TL YLP  + +++A+ +GA +S   N Y++ C +  +++ IV++FGGF 
Sbjct: 298 TQIPALLDSGTTLTYLPTAMFDLLAEQIGATYSSTSNGYVLSCANVDEDSMIVYDFGGFQ 357

Query: 438 IETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVN 497
           I+T L      +S D C L I  +  S A LGD FL HAYVVYDL++ EISMAQ N++  
Sbjct: 358 IQTPLAGSLYQLSDDQCELAIGSTSSSYATLGDLFLTHAYVVYDLDNKEISMAQINYNAT 417

Query: 498 HEDIEVVSSSIP 509
            EDIE++S S+P
Sbjct: 418 TEDIEIISDSVP 429

 Score = 93.6 bits (231), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 67/109 (61%), Gaps = 5/109 (4%)

Query: 12  LANVARSAAFS--QEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELS 69
           L +V+  A FS  +    + P  V + F KR+G++  +S L K +    VKR  G  E+ 
Sbjct: 5   LVSVSSVALFSSLKAAAAEAPGFVGVQFSKRYGKSISDSSLAKGN---LVKRSSGTDEVE 61

Query: 70  LRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSS 118
           L N   FY++D+E+G+P Q +TVL+DTGSSD W+  S NPYC+S S +S
Sbjct: 62  LINESVFYAIDMEIGTPKQSVTVLVDTGSSDFWVPSSTNPYCESKSATS 110

>Kwal_33.14239 s33 (582768..584723) [1956 bp, 651 aa] {ON} YDR144C
           (MKC7) - aspartyl protease related to Yap3p [contig 105]
           FULL
          Length = 651

 Score =  272 bits (695), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 203/316 (64%), Gaps = 10/316 (3%)

Query: 198 SIDCSRYGTFDKNQSSTYK-SNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           ++DC+ +GTF+ N+SST++   N  F I YGDG+FA+G W +D + L   +IS++  AVA
Sbjct: 142 TVDCAEFGTFNPNKSSTFRPQGNDTFMIMYGDGTFANGLWAKDTLSLDGHDISNLQFAVA 201

Query: 257 NDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSP 316
           N ++S VGVLG+GL GLE    S       +   Y NFP+VLK+  +  K  YSLY+NS 
Sbjct: 202 NMSDSDVGVLGVGLTGLE----SSADPFDDEPSQYPNFPVVLKQNNVISKMAYSLYINSL 257

Query: 317 DAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXX--XXX 374
           DA  GS+LFGAVD SK+ G LYTIP++N      V + ++FDVT+QGLG+ ++       
Sbjct: 258 DAEAGSVLFGAVDHSKYTGGLYTIPLVNALAQYFVDEILEFDVTVQGLGIESKKNCFQKT 317

Query: 375 XXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFG 434
               + PAL+DSG+TL Y+  DL + +AD LGA  S++   Y  +CP+K D+T++VF+FG
Sbjct: 318 LTTAQFPALMDSGTTLIYIDPDLADAIADSLGATMSDDYELYTFECPAKDDDTQLVFDFG 377

Query: 435 GFNIETNLTTYTTPISSD-TCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQAN 493
           GF I   L+ Y      +  C L ++PS   S ILGD FL  AYVV+DLE+ E+S+ QAN
Sbjct: 378 GFQITNPLSNYVLETDDEKVCGLGVVPS--YSNILGDEFLASAYVVFDLENLELSIGQAN 435

Query: 494 FDVNHEDIEVVSSSIP 509
            +   EDIE + S++P
Sbjct: 436 LNPGPEDIEPIISTVP 451

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 53/92 (57%), Gaps = 4/92 (4%)

Query: 26  EEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSL---RNRQNFYSVDLE 82
           E      V  +F K  G ++  +  G R      +RD G  + +L   +N + FYSV L 
Sbjct: 22  ESSNGDYVSFNFGKSLGSSFHGARGGSRPG-KLHRRDSGSSDSALSVLKNEEVFYSVKLN 80

Query: 83  VGSPSQKITVLLDTGSSDLWITGSDNPYCKSN 114
           +G+P Q ITVL DTGSSDLW++ + NP+C+++
Sbjct: 81  IGTPPQDITVLFDTGSSDLWVSSNSNPFCEAD 112

>Suva_9.13 Chr9 (14409..15803) [1395 bp, 464 aa] {ON} YIR039C (REAL)
          Length = 464

 Score =  256 bits (653), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 130/310 (41%), Positives = 193/310 (62%), Gaps = 3/310 (0%)

Query: 201 CSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTN 260
           CS +GTF  N SST+K N T F ISY D  + +G +G D + LG++ +S+ +  V+NDT 
Sbjct: 137 CSYWGTFSPNVSSTFKYNETIFNISYADNMYYAGTYGTDVVSLGNITLSNFTFGVSNDTK 196

Query: 261 STVGVLGIGLPGLETTYSSDQSMVSGDR-HMYSNFPMVLKERGITKKNVYSLYLNSPDAH 319
            + G+LG+ LP +E T   + ++ S     +Y NFPM LK +G  +K  YSL+LN P A 
Sbjct: 197 MSYGILGVSLPSVEETDDIEDALSSNTTPFVYENFPMALKSQGKIEKIAYSLFLNEPSAR 256

Query: 320 NGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXXK 379
            GSILFGAVDKSK+ G LYT+P+L  Y +        F        + ++         +
Sbjct: 257 FGSILFGAVDKSKYSGQLYTLPMLQAYNTLDALYSGMFVTAQSAAIIDSKSGNKTVSEVQ 316

Query: 380 IPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIE 439
            P L DSG++ + LP ++ + +      ++S +   Y+ DC SK + T++  +FGGFNI 
Sbjct: 317 FPVLFDSGTSTSVLPTEIADAIGRSFDGKYSSDDEGYIFDC-SKVNNTQLSIDFGGFNIS 375

Query: 440 TNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNHE 499
            N++ + TP++ D CVL+ILPS D+ ++LGDAFLV  YVVYDLE+ E+S+AQA+F+   E
Sbjct: 376 ANISNFVTPLTKDHCVLQILPS-DTVSVLGDAFLVDTYVVYDLENHEVSVAQASFNNEEE 434

Query: 500 DIEVVSSSIP 509
           DIE++S S+P
Sbjct: 435 DIEIISDSVP 444

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 30/46 (65%)

Query: 68  LSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKS 113
           +++ +  + Y V++E+G+P Q     LDTGSSD+    +D+ YC+S
Sbjct: 57  INMFSSAHIYVVEMEIGTPPQAAYFQLDTGSSDMCANEADSSYCES 102

>SAKL0F07172g Chr6 complement(541680..543308) [1629 bp, 542 aa] {ON}
           some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 542

 Score =  257 bits (656), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 131/313 (41%), Positives = 201/313 (64%), Gaps = 8/313 (2%)

Query: 199 IDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAND 258
           +DCSRYGTF+K+ S T+  +++ F+I+Y D +FA+G W +D +  G   I+D+  AVAN+
Sbjct: 112 VDCSRYGTFEKDNSLTFSQSDSRFQINYADNTFANGYWAKDVVSFGDNFIADMQFAVANE 171

Query: 259 TNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDA 318
           TNSTVGVLGIG   LE+     +         Y NFP+ LK  G+  K  YSLYLNS D+
Sbjct: 172 TNSTVGVLGIGFERLESV----KGYEGAPNTYYQNFPLALKNNGVIDKTAYSLYLNSLDS 227

Query: 319 HNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGL-SNQXXXXXXXX 377
            +GSILFG +D +K+ G LYT P++N++ S  V++P +F VT+QG+G+ S+         
Sbjct: 228 SSGSILFGGIDSNKYTGDLYTFPLVNIHPSV-VNKPAKFHVTVQGIGVQSSGSEQSILMS 286

Query: 378 XKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFN 437
            K PALLDSG+TL   P++  + +A+ + A +++    Y M CP ++D+T+ +F+FG   
Sbjct: 287 TKYPALLDSGTTLLVAPQEFADSMANYVNATYNDLEGIYTMTCPPENDDTEFLFDFGDLK 346

Query: 438 IETNLTTYT-TPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDV 496
           I+  L  +   P  ++ C   +LP+ D + ILGD FL  AYVVYDLE +E+S+AQAN++ 
Sbjct: 347 IKVPLKNFILAPEDNEYCGFGVLPTVD-TMILGDMFLSAAYVVYDLESYEVSLAQANWNS 405

Query: 497 NHEDIEVVSSSIP 509
           +  +I+ +  ++P
Sbjct: 406 DESEIQAIRHTVP 418

 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 57/91 (62%), Gaps = 9/91 (9%)

Query: 29  TPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQ 88
           T  ++++ F K    +Y  SL          KR+     L+L+N Q FY+ DL VG+P Q
Sbjct: 21  TDGVMEVMFSKHKDVSYGNSLW---------KRNQNSLALNLKNEQIFYAADLNVGTPPQ 71

Query: 89  KITVLLDTGSSDLWITGSDNPYCKSNSHSSK 119
            +TVLLDTGSSDLW+TGSDNPYC SN  +++
Sbjct: 72  NLTVLLDTGSSDLWVTGSDNPYCLSNETTTE 102

>Suva_16.14 Chr16 (11240..12862) [1623 bp, 540 aa] {ON} YIR039C
           (REAL)
          Length = 540

 Score =  254 bits (648), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 133/311 (42%), Positives = 197/311 (63%), Gaps = 6/311 (1%)

Query: 201 CSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTN 260
           CS +GTF  N SST+K N T F ++YGD S+ +G +G D + LG++ +S+ +  V+NDT 
Sbjct: 141 CSYWGTFSPNSSSTFKYNETIFNLTYGDNSYYAGTYGTDVVSLGNITLSNFTFGVSNDTT 200

Query: 261 STVGVLGIGLPGLETTYSSDQSMVSGDR-HMYSNFPMVLKERGITKKNVYSLYLNSPDAH 319
           +  G+LG+ LP  E T  ++ ++ S     +Y+NFPM LK +G  KK  YSL+LN P A 
Sbjct: 201 NNGGILGVSLPSAEVTDDTEDALSSNTTPFIYNNFPMALKSQGKIKKIAYSLFLNEPSAR 260

Query: 320 NGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLG-LSNQXXXXXXXXX 378
            GSILFGAVDKS++ G LYT+P+L  Y +   +    F VT Q +  L ++         
Sbjct: 261 FGSILFGAVDKSEYSGQLYTLPMLQAYNTLDATDAGMF-VTAQSVAILDSKSGNKTVSEV 319

Query: 379 KIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNI 438
           + P L DSG++ + LP  + + +      ++S +   Y+ DC +K + T + F+FGGFNI
Sbjct: 320 QFPVLFDSGTSTSVLPTKIADAIGRSFDGKYSSDDQGYIFDC-AKVNNTLLSFDFGGFNI 378

Query: 439 ETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNH 498
             N++ + TP + D C+L+ILPS D+  +LGDAFLV  YVVYDLE+ E+S+AQA+FD   
Sbjct: 379 SANISNFVTP-AKDHCILQILPS-DTIFVLGDAFLVDTYVVYDLENHEVSVAQASFDNKE 436

Query: 499 EDIEVVSSSIP 509
           EDI ++S S+P
Sbjct: 437 EDIGIISDSVP 447

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%)

Query: 68  LSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKS 113
           +++ +    Y V +E+G+P Q   + LDTGSSD+ I  +D  YC+S
Sbjct: 61  INMFSSAGMYVVKMEIGTPPQTAYLQLDTGSSDMCINEADAAYCES 106

>CAGL0E01749g Chr5 complement(172875..174323) [1449 bp, 482 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 482

 Score =  248 bits (633), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 135/318 (42%), Positives = 197/318 (61%), Gaps = 8/318 (2%)

Query: 197 QSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           + IDC  +G F+ ++SSTYK+N T F +SY D +FASG WG D +    + + +V+  +A
Sbjct: 117 RDIDCKAFGFFNTSKSSTYKNNGTNFTLSYADTTFASGPWGVDTLSFNGVKVDNVTFGLA 176

Query: 257 NDTNSTVGVLGIGLPGLETT--YSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLN 314
             +NST  V GI LP  ETT   +++ S +  + + YSNFPM+LKE+GI KK  YS+YLN
Sbjct: 177 AFSNSTTPVFGISLPARETTNQLAANGSRIGPNSYEYSNFPMLLKEQGIVKKIAYSVYLN 236

Query: 315 SPDAHNGSILFGAVDKSKFDGSLYTIPILN-VYKSRGVSQPIQFDVTLQGLGLSNQXXXX 373
              +  GSILFGAVD+SK+ G+LYT+P++N +YK   VS+P QF++TL G+GL       
Sbjct: 237 DTRSKYGSILFGAVDQSKYIGTLYTLPLVNSLYKQ--VSKPFQFEITLNGIGLQTADKNY 294

Query: 374 XXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMD-CPSKHDETKIVFN 432
                K+  LLD+G T + LP  +  +VA  +     ++  +  +D CP+K ++  +VFN
Sbjct: 295 TLYDQKLATLLDTGVTTSVLPAKVAALVASKVNGTIDDDNGFIKLDKCPNKKEKRTVVFN 354

Query: 433 FGGFNIETNLTTYTTPISSDTCVLRILPSGDSS-AILGDAFLVHAYVVYDLEDFEISMAQ 491
           FGG  I  ++   T  I    C L++    D   A LGD FL H YVVY+LED EIS+A 
Sbjct: 355 FGGAEISIDIRDLTRKIKGK-CYLQMQARDDIEFAALGDIFLRHVYVVYNLEDEEISIAN 413

Query: 492 ANFDVNHEDIEVVSSSIP 509
           ANF+ +  DI+ + S++P
Sbjct: 414 ANFNYSTPDIQEIVSTVP 431

 Score = 78.2 bits (191), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 60/118 (50%), Gaps = 22/118 (18%)

Query: 7   LKCTLLANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEY 66
           +K TLL N+   A            ++KL F+K   +N           L   KRDD   
Sbjct: 1   MKYTLLLNLISCAQ----------ALLKLDFEKVPEQN-----------LALNKRDDKGL 39

Query: 67  ELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSN-SHSSKKRDI 123
           +L L N    Y+V L VG+P Q ITV LDTGSSDLW T   NPYCK+N  HS KK  I
Sbjct: 40  QLELENGGLLYAVQLSVGTPPQNITVQLDTGSSDLWFTSEANPYCKNNRKHSPKKSQI 97

>CAGL0E01837g Chr5 complement(183237..184802) [1566 bp, 521 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3
          Length = 521

 Score =  248 bits (633), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 128/316 (40%), Positives = 196/316 (62%), Gaps = 5/316 (1%)

Query: 197 QSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           +++DC +YG +++N+SST+ SN T   I+YGD  F  G WG D + +G+LN+S++S+ V+
Sbjct: 116 RTLDCKKYGFYNRNESSTFNSNGTDLFITYGDNGFVRGTWGTDSVSVGNLNLSNLSIGVS 175

Query: 257 NDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSP 316
             TN++ G+LG+GLPG E+T++   ++     + YSNFP+ LKE G+ +K  YS+YLN  
Sbjct: 176 PMTNTSTGILGVGLPGEESTFNYSSNVTGPSNYQYSNFPIRLKEEGLIEKIAYSIYLNET 235

Query: 317 DAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXX 376
            +  GSILFGAVD SK+ G LYT P++N     G S P QF++T+ G+GL  +       
Sbjct: 236 GSKYGSILFGAVDHSKYQGPLYTFPLVNSKYKEG-SDPFQFEITMNGVGLVGKTDNITLY 294

Query: 377 XXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLN-YYLMDCPSKHDETKIVFNFGG 435
             K+P LLDSGST++ LP D+ ++VA  +        N   L  CPSK D  K++FNF G
Sbjct: 295 DQKLPTLLDSGSTISLLPRDVADLVAQQVNGTVDGKGNCIKLPKCPSKKDNQKLIFNFSG 354

Query: 436 FNIETNLTTYTTPISSDTCVLRILP-SGDSSAILGDAFLVHAYVVYDLEDFEISMAQANF 494
                N+T +        C L+     G + A+LGD F+ + Y V++L+D E+S+AQAN+
Sbjct: 355 AEFSVNVTDFMEK-HKGKCYLQFSALDGINFALLGDNFMNNVYTVFNLDDKELSLAQANY 413

Query: 495 DVN-HEDIEVVSSSIP 509
           + +   DIE +  ++P
Sbjct: 414 NSSLKPDIEEIKDTVP 429

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 45/81 (55%), Gaps = 12/81 (14%)

Query: 33  VKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITV 92
           VKL F K  G +     L KRD +     D    +L+    Q  Y V++ VG+P QK+ +
Sbjct: 18  VKLDFTKTPGSD-----LAKRDVV-----DPEAAQLTFDKDQ--YIVEVAVGTPPQKVLL 65

Query: 93  LLDTGSSDLWITGSDNPYCKS 113
            +DTGSSDL++    NPYCK+
Sbjct: 66  QIDTGSSDLFVIEESNPYCKN 86

>CAGL0E01793g Chr5 complement(178411..179961) [1551 bp, 516 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 516

 Score =  247 bits (630), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 136/318 (42%), Positives = 198/318 (62%), Gaps = 7/318 (2%)

Query: 197 QSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           +++DC +YG F+ + SST+K+N+T   + Y D SF  G WG D + LG LNIS V+ AVA
Sbjct: 116 RNLDCKKYGFFNMSSSSTFKNNDTDIFLYYEDLSFVRGTWGTDVVSLGGLNISGVNFAVA 175

Query: 257 NDTNSTVGVLGIGLPGLETTYS-SDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNS 315
             +NS+ GVLG+ LP  E+TYS +     +   + YSN P+ LKE+GI  K  YS+YLN 
Sbjct: 176 EISNSSSGVLGVSLPSEESTYSINSNGTTNATNYQYSNLPLQLKEQGIIDKVTYSIYLND 235

Query: 316 PDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXX 375
             +  GSILFGAVD SK+ G+LYT+P++N  +   V++P + D+TL G+G  +       
Sbjct: 236 TKSKYGSILFGAVDHSKYTGTLYTLPLVNS-EYDVVNKPYELDITLNGIGYQSMSSNMTL 294

Query: 376 XXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLN-YYLMDCPSKHDETKIVFNFG 434
              K+ AL+DSG+T++  P++++E+VA  + A    N N   L  CPSK D  K++FN G
Sbjct: 295 YDQKVAALIDSGTTISEFPDEIVEVVAKQMNATVDPNGNGIRLAKCPSKKDNAKLLFNLG 354

Query: 435 GFNIETNLTTYTTPISSDTCVLRILPSGDSS--AILGDAFLVHAYVVYDLEDFEISMAQA 492
           G  I  ++  +TT +    C L I+PSG  S   ILGD F+   Y V+DLE  E+S+AQA
Sbjct: 355 GALIYVDIKEFTTKVKGK-CYLEIIPSGAESDLVILGDNFMRSVYTVFDLEANEVSIAQA 413

Query: 493 NFDVN-HEDIEVVSSSIP 509
           NF+ +    IE + S++P
Sbjct: 414 NFNSSLPAQIEEIKSTVP 431

 Score = 69.3 bits (168), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 31/61 (50%), Positives = 41/61 (67%)

Query: 60  KRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSK 119
           KR D    + LRN  + Y V L VG+P Q ++V LDTGS+DLW +G+DNPYCK+N   + 
Sbjct: 32  KRADDLSPVPLRNDVDQYIVQLAVGTPPQMVSVQLDTGSADLWFSGADNPYCKTNKKKAP 91

Query: 120 K 120
           K
Sbjct: 92  K 92

>CAGL0E01771g Chr5 complement(175652..177211) [1560 bp, 519 aa] {ON}
           similar to uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  245 bits (626), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 133/315 (42%), Positives = 189/315 (60%), Gaps = 4/315 (1%)

Query: 197 QSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           ++I+C++YG F+ + SSTY  N+T F +SYGD +FASG WG D I L  + + +V+  +A
Sbjct: 119 RNINCNKYGFFNASGSSTYSRNDTNFSLSYGDETFASGPWGTDTISLNGVKVENVTFGLA 178

Query: 257 NDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRH-MYSNFPMVLKERGITKKNVYSLYLNS 315
           + +NST  V GIGLPG E+TY+      +G  +  YSNFP+ LK++G   K  YS+YLNS
Sbjct: 179 SFSNSTNPVFGIGLPGDESTYAMFSEDTNGTTNTQYSNFPLQLKQQGKIDKVAYSIYLNS 238

Query: 316 PDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXX 375
             +  GSILFGAVD SK+ G LYT+PI+N +    V  P + +VTL GLGL         
Sbjct: 239 TKSKQGSILFGAVDHSKYSGPLYTLPIVNRF-GHLVENPYELEVTLSGLGLQRATSNITL 297

Query: 376 XXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYY-LMDCPSKHDETKIVFNFG 434
               +PALLD+G+T  Y+P  + + +A+       +  +   L  CPSK     IVFNF 
Sbjct: 298 FDQLLPALLDTGTTYTYMPSSVAQYLANQTNGVIDKKTSLIKLAKCPSKKSNDTIVFNFS 357

Query: 435 GFNIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANF 494
           G  I+  +  +        C L  +    S  +LGD+F+ H Y V+DL+D EIS+AQANF
Sbjct: 358 GAQIKIKMVDFVEK-HKGKCYLPCVSQESSFFLLGDSFMRHVYTVFDLDDKEISIAQANF 416

Query: 495 DVNHEDIEVVSSSIP 509
           +   EDIE +SS++P
Sbjct: 417 NSTKEDIEEISSTVP 431

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (60%), Gaps = 1/74 (1%)

Query: 60  KRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSH-SS 118
           + D+  +   L N    Y+V + VG+P Q +TV LDTGSSDLW   + NPYCK+N   + 
Sbjct: 34  RADNDSFIAPLLNGGELYTVQIAVGTPPQNLTVQLDTGSSDLWFVSASNPYCKNNKKFAP 93

Query: 119 KKRDIGDNSLDDIF 132
           KK+D+   + DD F
Sbjct: 94  KKQDLMPITSDDGF 107

>ZYRO0F10296g Chr6 complement(833615..835201) [1587 bp, 528 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 528

 Score =  243 bits (619), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 130/311 (41%), Positives = 184/311 (59%), Gaps = 3/311 (0%)

Query: 200 DCSRYGTFDKNQSSTYKSNNT-AFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAND 258
           +C+    F+ + S T+  N T  + I Y D S+ASG WG D ++LG L + +VS AVAND
Sbjct: 191 NCNATAFFEADNSKTFHRNRTDPYYIQYEDLSYASGYWGTDDLQLGDLQVHNVSFAVAND 250

Query: 259 TNSTVGVLGIGLPGLETTYSS-DQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPD 317
           TNST  V GIG PG E++++S      +   H Y+NFP  LK +GI ++  YSLYLNSP+
Sbjct: 251 TNSTTPVFGIGFPGGESSFASVGPEYRAAHPHEYANFPQTLKNQGIIQRVAYSLYLNSPN 310

Query: 318 AHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQ-FDVTLQGLGLSNQXXXXXXX 376
           +  G++LFG VD S++ G LYT+PIL +        P     +TLQG+ ++ +       
Sbjct: 311 STYGNVLFGGVDHSQYQGQLYTLPILQLGNLTSDGDPYNTLAITLQGVSVTRRGSKHKVK 370

Query: 377 XXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGF 436
              IP +LDSG+T  YLP  L + +A             Y++DCP   D   I F+FGG 
Sbjct: 371 TKPIPVVLDSGTTAMYLPYKLAKSIASRYHGILGPEDQGYIIDCPKSGDNDYITFDFGGV 430

Query: 437 NIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDV 496
            I+T++  Y    S + C+L I+P+ D  A+ GD FL  AYVVYDLE  EIS+AQA+F+ 
Sbjct: 431 TIKTDIRNYIFEQSENKCLLGIIPNSDILAVFGDVFLTDAYVVYDLEGKEISLAQASFNS 490

Query: 497 NHEDIEVVSSS 507
           + E IE ++SS
Sbjct: 491 SSEQIEAITSS 501

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 74/132 (56%), Gaps = 6/132 (4%)

Query: 9   CTLLANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRD--DGEY 66
           C L+++V+   A       Q+  + K+ F+K +G+++ E+   ++    F  ++  D   
Sbjct: 10  CGLVSSVSCLPAVHDSRSSQS--VAKIGFNKVYGKSFSEATADRKYVNLFRNKNISDDND 67

Query: 67  ELSLRNRQN-FYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSN-SHSSKKRDIG 124
           E++L+N  N +YSV++ +G+P Q +T+ LDTGSSDLW+       C  N ++  KKR   
Sbjct: 68  EVALQNNANTYYSVNISLGTPGQNMTIQLDTGSSDLWVIKPGGLQCTDNDTNLFKKRSEN 127

Query: 125 DNSLDDIFSDIT 136
           DN  D I S I+
Sbjct: 128 DNDNDAISSFIS 139

>YIR039C Chr9 complement(430498..432111) [1614 bp, 537 aa] {ON}
           YPS6Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance
          Length = 537

 Score =  242 bits (617), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 134/312 (42%), Positives = 200/312 (64%), Gaps = 8/312 (2%)

Query: 201 CSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDT- 259
           CS +GTFD + SST+++N T F  +YGDG++ +G +G D +   ++ ++D +  V+NDT 
Sbjct: 139 CSYWGTFDASNSSTFENNATFFNNTYGDGTYYAGTYGTDVVSFENITLNDFTFGVSNDTI 198

Query: 260 NSTVGVLGIGLPGLETTYSSDQSM-VSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDA 318
            +  G+LGI LP  E T   + ++ ++    +Y NFPM LK +G   K  YSL+LN PDA
Sbjct: 199 GNPSGILGISLPIAEFTDGIEYALALNRTPFIYDNFPMELKNQGKINKIAYSLFLNGPDA 258

Query: 319 HNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLG-LSNQXXXXXXXX 377
           H GSILFGAVDKSK+ G LYT+P+L  + + G S P    +T Q +  L ++        
Sbjct: 259 HFGSILFGAVDKSKYTGQLYTLPMLQAFNTLG-SNPGMI-ITAQSVAILDSESGNKTVSD 316

Query: 378 XKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFN 437
            + P +LDSG+T +YLP ++ E +       +S +   Y+ DC SK ++T +  +FGGFN
Sbjct: 317 IQFPVMLDSGTTFSYLPTEIAEAIGKSFDGEYSSDDQGYIFDC-SKVNDTLLSVDFGGFN 375

Query: 438 IETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVN 497
           I  N++ + T  + D CVL +  S +S+ +LGDAFLV AYVVYDLE++EIS+AQA+F+  
Sbjct: 376 ISANISNFVTS-AKDRCVLNVKQS-ESTYMLGDAFLVDAYVVYDLENYEISIAQASFNNQ 433

Query: 498 HEDIEVVSSSIP 509
            EDIEV+S ++P
Sbjct: 434 EEDIEVISDTVP 445

>KNAG0I00900 Chr9 (169003..170598) [1596 bp, 531 aa] {ON} 
          Length = 531

 Score =  239 bits (611), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 180/311 (57%)

Query: 199 IDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAND 258
           IDC+ YGTF+ + SS++K+N T F + Y D + AS  WG D + +  L I D+S  VAN 
Sbjct: 153 IDCTNYGTFNHSSSSSFKNNGTNFTMFYADKTGASRFWGTDVVRVELLEILDMSFGVANV 212

Query: 259 TNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDA 318
            N+T GV GIG P LETT   +  +     + Y+NFP  L  +G   K  YSL+LN   A
Sbjct: 213 FNATEGVFGIGFPSLETTNMFNARIDPYSSYEYANFPQALNNQGSVDKVAYSLFLNDSHA 272

Query: 319 HNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXX 378
             GS+LFGAVD SK+   L+T+P++N ++ +G+  P  F+V     G  N+         
Sbjct: 273 MKGSVLFGAVDHSKYRNDLFTVPLVNDFRDKGMDHPHYFNVFNARRGCPNKRRPQNRRHD 332

Query: 379 KIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNI 438
           +   +LDSG+T++ LP  L++ +   L A F E LN Y + CPSK D +   F+ G F+I
Sbjct: 333 EFIVVLDSGATVSSLPTKLVDQLVQSLNATFDEELNSYTLKCPSKKDTSVASFDIGRFHI 392

Query: 439 ETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNH 498
           +  L+ +      + C+LR+ P+ +   IL D FL  AYVV+DLE +EISM QAN +   
Sbjct: 393 DGPLSNFVRKYEKNKCILRLDPADNQPYILCDNFLSRAYVVHDLESYEISMGQANTEYAP 452

Query: 499 EDIEVVSSSIP 509
           E IE + S +P
Sbjct: 453 EQIEAIKSKVP 463

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 62/118 (52%), Gaps = 10/118 (8%)

Query: 11  LLANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYEL-S 69
           L+ ++    A    V +   K V++ FDK        S       + F KRD G+Y L  
Sbjct: 13  LIVSLCLGTAAIASVVKLPKKYVQMGFDK--------SCTSATGDMVFAKRD-GDYVLVD 63

Query: 70  LRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKKRDIGDNS 127
           L N +  Y+V L VG+P Q ITV ++ GS+D W+T  DNPYC+   HS  ++ +G N+
Sbjct: 64  LINEKILYTVQLAVGTPPQNITVSINIGSADPWMTSPDNPYCEIKKHSGYEKQVGANT 121

>KNAG0I01200 Chr9 (226271..228304) [2034 bp, 677 aa] {ON} 
          Length = 677

 Score =  240 bits (612), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 127/319 (39%), Positives = 202/319 (63%), Gaps = 15/319 (4%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIEL--GSLNISDVSMAV 255
           S +C  YGTFD  QSST++  N+A +I+Y DG+   G WG D +EL  G++ + +  + V
Sbjct: 90  SSECKEYGTFDYGQSSTFQDRNSALKINYQDGTKVDGRWGVDTLELNNGAIQLQNTMIGV 149

Query: 256 ANDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNS 315
           A+ ++S  GV+G+G PGLETT   +    +G+ + Y+NFPM LK++G+T   V+++ L+ 
Sbjct: 150 ADSSDSVAGVIGLGFPGLETT---NNVQANGESYTYANFPMQLKQQGVTDATVFAIALD- 205

Query: 316 PDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGL-SNQXXXXX 374
            +++ G ILFGAVD+ K+ G LYT+P++N   SRG + PI+ +VTLQG+G+ S+      
Sbjct: 206 -NSYGGDILFGAVDEGKYIGGLYTLPVVN---SRGTATPIRMEVTLQGIGVDSDGGDQET 261

Query: 375 XXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFG 434
                + AL+DSGST+ YLPE +   + + +GAR+  +   Y +DC +  +   ++F+FG
Sbjct: 262 FSSTPMLALVDSGSTMVYLPELIATAIYNKVGARYDGSSEMYTIDCGTNVENDNLIFDFG 321

Query: 435 GFNIETNLTTYTTP---ISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQ 491
           GF+I T ++ Y       S+  C+  IL    ++ +LGD FL  AYVV+DL+ +EISMAQ
Sbjct: 322 GFHISTPVSNYIITDQRSSNGQCLFGILSQSGNTVVLGDTFLSSAYVVFDLDHYEISMAQ 381

Query: 492 ANFDVNHEDI-EVVSSSIP 509
            N +    ++ +V S +IP
Sbjct: 382 GNSNNGDGNVKDVTSGTIP 400

 Score = 83.2 bits (204), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 38/72 (52%), Positives = 56/72 (77%), Gaps = 2/72 (2%)

Query: 53  RDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCK 112
           R +   V+R+DG+  + L  +  FYS+DL +G+PSQK+TVLLDTGSSDLW+TG++NPYC+
Sbjct: 28  RQSPQLVRREDGD-SVHLGKQTGFYSIDLAIGTPSQKVTVLLDTGSSDLWVTGANNPYCQ 86

Query: 113 SNSHSSKKRDIG 124
           + S SS+ ++ G
Sbjct: 87  T-SLSSECKEYG 97

>Suva_34.1 Chr34 complement(13..1176) [1164 bp, 387 aa] {ON} YIR039C
           (REAL)
          Length = 387

 Score =  231 bits (589), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 126/297 (42%), Positives = 182/297 (61%), Gaps = 5/297 (1%)

Query: 215 YKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGIGLPGLE 274
           +K N T F I+Y D S+ +G +G D + LG + +S+ +  V+NDT    G+LGI LP  E
Sbjct: 1   FKYNETIFNITYDDNSYYAGTFGTDIVSLGDITLSNFTFGVSNDTTINGGILGISLPSAE 60

Query: 275 TTYSSDQSMVSGDRHM-YSNFPMVLKERGITKKNVYSLYLNSPDAHNGSILFGAVDKSKF 333
            T S   ++ S      Y NFPM LK +G  +K  YSL+LN P+A  GSILFGAVDKSK+
Sbjct: 61  ITDSGQGALSSNTTPFAYDNFPMALKNQGKIEKIAYSLFLNEPNARFGSILFGAVDKSKY 120

Query: 334 DGSLYTIPILNVYKSRGVSQPIQFDVTLQGLG-LSNQXXXXXXXXXKIPALLDSGSTLAY 392
            G LYT+P+L  Y +          VT Q +  L +          + P L DSG++ + 
Sbjct: 121 TGQLYTLPMLQAYNTLDALGGGML-VTAQSVAILDSISGNKTVSEVQFPVLFDSGTSTSV 179

Query: 393 LPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNLTTYTTPISSD 452
           LP ++ + +      ++S +   Y+ DC SK + T++  +FGGFNI  N++ + TP++ D
Sbjct: 180 LPTEIADAIGRSFDGKYSSDDEGYIFDC-SKVNNTQLSIDFGGFNISANISNFVTPLTKD 238

Query: 453 TCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNHEDIEVVSSSIP 509
            CVL+ILPS D+ ++LGDAFLV  YVVYDLE  E+S+AQA+F+   EDIE++S S+P
Sbjct: 239 HCVLQILPS-DTVSVLGDAFLVDTYVVYDLESHEVSVAQASFNNEEEDIEIISDSVP 294

>CAGL0E01881g Chr5 (188277..189803) [1527 bp, 508 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
          Length = 508

 Score =  226 bits (575), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 129/322 (40%), Positives = 189/322 (58%), Gaps = 10/322 (3%)

Query: 197 QSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           ++ DCS + TF+ + S+T+KSN+T F I+YGDGS+  G WG D + L    + +V+ AVA
Sbjct: 118 RTFDCSDFKTFNSSSSNTFKSNDTDFFITYGDGSYVEGTWGTDQVALAGQTLENVTFAVA 177

Query: 257 NDTNSTVGVLGIGLPGLETTYSSDQSMVSG----DRHMYSNFPMVLKERGITKKNVYSLY 312
             TN++ G+LGIGLP LE++ + D + ++      ++ Y NFP  LK   +  K VYS+Y
Sbjct: 178 ELTNNSYGLLGIGLPELESSITIDTAQLTNTSSVKKNPYMNFPESLKLNKLINKVVYSIY 237

Query: 313 LNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLS---NQ 369
           LN  +   GSILFGAVD +++DG+L T+P++   +  G  +P +  VTL G+        
Sbjct: 238 LNRTNDKFGSILFGAVDHNRYDGNLTTVPLVFSNRDFGTPRPNELMVTLNGMSFEATDGN 297

Query: 370 XXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLN-YYLMDCPSKHDETK 428
                    K PALLD+GST  +LP D+   +A+     + +  N   +  C SK D+T 
Sbjct: 298 VTQILNATSKFPALLDTGSTDTHLPVDVYNALAESTNGTYDQTQNKIRIPKCLSKKDKTI 357

Query: 429 IVFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEIS 488
           + F+ GG NI          I    C + + P+G   AILGD  + +AY+V+DLED EIS
Sbjct: 358 LNFSLGGVNIGVPYKEMVKKIKGK-CYINVAPTGSDFAILGDDVIRYAYMVFDLEDREIS 416

Query: 489 MAQANF-DVNHEDIEVVSSSIP 509
           +AQA+F D   EDIEVV S+IP
Sbjct: 417 LAQASFNDTLPEDIEVVVSTIP 438

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 1/73 (1%)

Query: 58  FVKRDDGEY-ELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSH 116
             KR D +Y  + L N Q FY V++ +GS  Q +T+L+DTGSSD W+ G+ NPYCKSN  
Sbjct: 28  LAKRADDDYLNVQLDNEQIFYGVEVSIGSDKQNMTLLVDTGSSDFWVLGAQNPYCKSNRG 87

Query: 117 SSKKRDIGDNSLD 129
              K+    +S+D
Sbjct: 88  KKPKKKDQPSSVD 100

>CAGL0E01815g Chr5 complement(181154..182713) [1560 bp, 519 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3
          Length = 519

 Score =  225 bits (573), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 125/322 (38%), Positives = 194/322 (60%), Gaps = 12/322 (3%)

Query: 197 QSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           ++++C +YG F+ ++SST+K N++ F +SY D SFA+G WG D +    LNIS+V+ A+ 
Sbjct: 117 RTLNCKKYGVFNSSESSTFKRNDSEFLLSYADMSFATGNWGSDVVSFNELNISNVNFALG 176

Query: 257 NDTNSTVGVLGIGLPGLETT----YSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLY 312
           +  NS+ GVLG+GLP +E+T    Y+  +  +S D H Y+NFP+ LK+ G+  K  YSLY
Sbjct: 177 SFANSSNGVLGVGLPDVESTYDGPYAGSRKNIS-DSHQYANFPITLKQNGVIDKIAYSLY 235

Query: 313 LNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXX 372
           LNS  +  GS+LFGAVD ++++G LYT+P+ N    +  + P Q ++T+ GLGL      
Sbjct: 236 LNSSKSKFGSVLFGAVDHNRYNGPLYTLPLANSL-FQNFTDPFQLEITMNGLGLQGNDAN 294

Query: 373 XXXXXXKIPALLDSGSTLAYLPEDLLEMVADGL-GARFSENLNYYLMDCPSKHDETKIVF 431
                 K  ALLDSG+TL  + + + +++A  + G    ++    L  CPSK +  K++F
Sbjct: 295 ITLYDKKSAALLDSGTTLTVVSKHIGDLIAAQVNGTIAGKDQCIRLPKCPSKKENKKLIF 354

Query: 432 NFGGFNIETNLTTYTTPISSDTCVLRILPSGDSS---AILGDAFLVHAYVVYDLEDFEIS 488
           NF G  +  ++           C L+     D+S    I GD FL   Y+VY+LED EIS
Sbjct: 355 NFSGAEVAVDINQMMNK-HKGKCYLQFAVHEDTSNDAIIFGDNFLRSVYLVYNLEDKEIS 413

Query: 489 MAQANFDVN-HEDIEVVSSSIP 509
           +A ANF+ +  E+IE + S++P
Sbjct: 414 IAPANFNSSLPENIEPIKSTVP 435

 Score = 73.2 bits (178), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 47/74 (63%), Gaps = 3/74 (4%)

Query: 58  FVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSN-SH 116
            VKRDD    + L+N  + Y V L VG+P Q ITV LDTGSSDLW   +DNP+CK N  +
Sbjct: 31  LVKRDDEYVNVPLKNDGDLYLVQLAVGTPPQNITVQLDTGSSDLWFPSADNPFCKENKKY 90

Query: 117 SSKKRDIGDNSLDD 130
           + K +D+    LDD
Sbjct: 91  APKGKDV--QPLDD 102

>Smik_65.1 Chr65 (2..1027) [1026 bp, 342 aa] {ON} YIR039C (REAL)
          Length = 342

 Score =  219 bits (558), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 124/293 (42%), Positives = 173/293 (59%), Gaps = 6/293 (2%)

Query: 218 NNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGIGLPGLETTY 277
           N+T F+ +YGDG++  G +G D + LG++ +   S  VAN+T +  G+LGI LP  E T+
Sbjct: 1   NDTQFDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTENQGGILGISLPAGENTH 60

Query: 278 SSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSILFGAVDKSKFDGSL 337
           S   +  +     Y NFPM LK  G  +K  YSL+LN P AH GSILFGAVDKSK+ G L
Sbjct: 61  SLGGAYNT-TPFEYENFPMALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQL 119

Query: 338 YTIPILNVYKSRGVSQPIQFDVTLQGLG-LSNQXXXXXXXXXKIPALLDSGSTLAYLPED 396
           YT+P+L  Y +     P  F VT Q +  L+           + P L DSG+T + LP +
Sbjct: 120 YTLPMLQAYDTLDSVSPGMF-VTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTE 178

Query: 397 LLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNLTTYTTPISSDTCVL 456
           +   +      ++S     Y  DC SK  +T +  +FGGFNI  N++ + T  + D C+L
Sbjct: 179 VAHAIGKSFDGKYSSGDQGYTFDC-SKVKDTLLSIDFGGFNISANISNFVTR-TKDHCLL 236

Query: 457 RILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNHEDIEVVSSSIP 509
            I  + DS  +LGDAFLV AYVV+DLE  E+S+AQA+FD   E+IEV+S  +P
Sbjct: 237 NI-EAADSGFVLGDAFLVDAYVVFDLESHEVSIAQASFDDKKEEIEVISDRVP 288

>KAFR0B06700 Chr2 complement(1396587..1398182) [1596 bp, 531 aa]
           {ON} 
          Length = 531

 Score =  224 bits (570), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 128/295 (43%), Positives = 180/295 (61%), Gaps = 6/295 (2%)

Query: 202 SRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNS 261
           + YG F    S++ K N T F   Y DG+ A GEW  D + LG   +S+V+ AV NDT+S
Sbjct: 107 ASYGVFSPKDSTSLKFNGTEFSTQYADGTTAYGEWCYDTVALGDTTVSNVTFAVVNDTDS 166

Query: 262 TVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNG 321
             GVLG+GL GLE TY++  S      + Y NFP+ L  +G+ + N YSLYLN  DA +G
Sbjct: 167 NFGVLGLGLTGLEATYTNALS----SPYQYDNFPVKLVRQGLIQANAYSLYLNKADASSG 222

Query: 322 SILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXXKIP 381
           ++LFGAVD +K+ G+L+TIP +N  +S G +  I+F VTL G+ LS           K P
Sbjct: 223 NVLFGAVDHAKYTGTLHTIPFVNTLESLGYNSVIEFHVTLDGMDLSTNDGQTTLTTSKFP 282

Query: 382 ALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETN 441
            L+DSG+T +YLP++LL+ +A  +GA +S     Y++ CPS+ D+T I +NFGGFNI+T 
Sbjct: 283 VLVDSGNTFSYLPDNLLQQIASQIGATYSNEYVGYVLTCPSEDDDTVISYNFGGFNIDTP 342

Query: 442 LTTYTTPIS--SDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANF 494
           L+   T +   S+TC+L I PSG     LGD FL + Y         +S+AQA +
Sbjct: 343 LSGSVTELGDDSNTCILMIAPSGSEFGQLGDTFLENVYASSTWTIESLSLAQAQY 397

 Score = 68.6 bits (166), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 37/107 (34%), Positives = 63/107 (58%), Gaps = 3/107 (2%)

Query: 1   MKWNQILKCTLLANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVK 60
           M++  I    LL+ +    A     EE +   V ++F++ +G +  ++ + KR ++  +K
Sbjct: 1   MRFQTISSVALLSAIQHVYAH-LGAEESSSGFVSMNFNRLYGAS-PDTAVSKR-SMSHIK 57

Query: 61  RDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSD 107
           R +   ++ L+N   FYS+DL +GS  Q +TVL+DTGSSDLW+ G D
Sbjct: 58  RSENYEQVRLKNEACFYSMDLAIGSNHQNVTVLVDTGSSDLWVPGPD 104

>KLLA0D15917g Chr4 complement(1336727..1338262) [1536 bp, 511 aa]
           {ON} some similarities with uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease
          Length = 511

 Score =  213 bits (543), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 122/318 (38%), Positives = 180/318 (56%), Gaps = 14/318 (4%)

Query: 199 IDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAND 258
           +DC + G FD   S +  +    F   Y DGS++ G W  D I +    + D+  AVAN 
Sbjct: 116 LDCDKIGVFDPGSSYSLSATGYNFSTQYFDGSYSDGFWVVDDISIADQQVPDLQFAVANI 175

Query: 259 TNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDA 318
           +++  GVLG+GLP LE     D          Y NFP  LK   +  + +YSLY +S D 
Sbjct: 176 SSAPSGVLGVGLPRLEAVRGYD----GAPNANYDNFPQTLKSNRLINRVLYSLYFDSGDL 231

Query: 319 HNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXX--XXXX 376
            +G++LFG +D+ K+DG LYT+P++N+Y+   + +P  FD+TLQGLG+ ++         
Sbjct: 232 ESGTVLFGGIDEKKYDGVLYTLPLVNIYEQ--IDEPAAFDITLQGLGIRSESNCKDTVIA 289

Query: 377 XXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGF 436
             K PALLDSGST+   P++ LE +A  LGA FSE+   Y++DCP+ +D+    F+FG  
Sbjct: 290 HKKAPALLDSGSTIMGAPQEALESIAQELGAAFSESDGLYVLDCPASNDDRTFYFDFGEL 349

Query: 437 NIETNL--TTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANF 494
            ++  +    Y      + C L I+ SG+   ILGD  L  AYVVYDL++ EIS+AQ   
Sbjct: 350 KLKVPIHDLLYLPESGQNYCGLAIIASGE-EWILGDLVLKSAYVVYDLDNLEISIAQVK- 407

Query: 495 DVNHEDIEVVSS--SIPQ 510
             +   I+ VS+  S+PQ
Sbjct: 408 TTSGSRIQTVSATGSLPQ 425

 Score = 60.1 bits (144), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 36/56 (64%)

Query: 59  VKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSN 114
           +++    +E  L  +  FY+V+L VG+PSQKI  + DTGSSDLW+    NP+C  N
Sbjct: 42  LQKRSKSFESKLNPQDYFYTVELGVGTPSQKINCIFDTGSSDLWVPAKSNPFCLGN 97

>CAGL0E01859g Chr5 complement(185870..187387) [1518 bp, 505 aa] {ON}
           similar to uniprot|P32329 Saccharomyces cerevisiae
           YLR120c YAP3 or uniprot|Q12303 Saccharomyces cerevisiae
           YLR121c YPS3 or uniprot|P53379 Saccharomyces cerevisiae
           YDR144c MKC7
          Length = 505

 Score =  213 bits (542), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 121/320 (37%), Positives = 181/320 (56%), Gaps = 8/320 (2%)

Query: 197 QSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           +++DC+ +G F+ + S+T+ SN T F ISY D S+A G W  D++ L  LNIS ++  +A
Sbjct: 111 RNLDCAEFGLFNSSASTTFNSNKTEFFISYLDSSYAEGVWATDNLYLNGLNISGLNFGLA 170

Query: 257 NDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSP 316
             +NS+  VLG+GL  LE +Y +D       R  Y NFP +LK++G   K  YSLYLN  
Sbjct: 171 YFSNSSNSVLGVGLTPLEASYDTDIKQDDSPRFQYPNFPQILKQKGAISKVTYSLYLNDT 230

Query: 317 DAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXX 376
            +  G ILFG VD SK+ G LYTIP++N    +        +VTL GLG+ +        
Sbjct: 231 KSKYGQILFGGVDHSKYVGQLYTIPLVNSKYQKSPGVIADLEVTLNGLGIRDNTTNTNTT 290

Query: 377 --XXKIPALLDSGSTLAYLPEDLLEMVADGL-GARFSENLNYYLMDCPSKHDETKIVFNF 433
               K+PAL DSG++ +Y+P  + +++A  + G   ++     L  CPSK D  ++VFNF
Sbjct: 291 LYTQKLPALFDSGTSYSYVPYTMAQVIASQVNGTIDNKTEAIRLPKCPSKKDTREVVFNF 350

Query: 434 GGFNIETNLTTYTTPISSDTCVLRIL---PSGDSSAILGDAFLVHAYVVYDLEDFEISMA 490
            G  I   L  +     S  C L ++   P+     +LGD FL   Y V+DLE  E+S+A
Sbjct: 351 NGVEIAIPLKQFYQK-KSGKCYLDLMVAPPNNGPGLLLGDTFLRQVYTVFDLEAQELSIA 409

Query: 491 QANFDVN-HEDIEVVSSSIP 509
           +ANF+ +   D+E + S++P
Sbjct: 410 RANFNSSLPADVEEIKSTVP 429

 Score = 70.1 bits (170), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 47/88 (53%), Gaps = 13/88 (14%)

Query: 33  VKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITV 92
           V L F+K HG++              VKRD  + +L    +   Y++ L VG+P Q IT 
Sbjct: 15  VALDFEKSHGDD-------------LVKRDVQDVKLINSQKAMLYNIQLSVGTPPQNITA 61

Query: 93  LLDTGSSDLWITGSDNPYCKSNSHSSKK 120
            LDTGSSDLW   S NPYCK+N   + K
Sbjct: 62  QLDTGSSDLWFPDSTNPYCKANKKQAPK 89

>NCAS0A12460 Chr1 complement(2461028..2462650) [1623 bp, 540 aa]
           {ON} Anc_7.182
          Length = 540

 Score =  211 bits (538), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 119/308 (38%), Positives = 177/308 (57%), Gaps = 13/308 (4%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTA-FEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           +IDCS + TF+K+ SS++K+  T+ F   Y D +FA G W  + + +  +++S +   + 
Sbjct: 116 TIDCSSFMTFNKSLSSSFKTKGTSRFYAYYSDKTFADGSWATEKLTMNGVDVSSLQFGLG 175

Query: 257 NDTNSTV-GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNS 315
           N   + V GVLGIG P  E+    D +        Y NFP VLK +GI     YS++LN 
Sbjct: 176 NCVTTPVSGVLGIGFPRRESVKGYDNA----PNEFYPNFPQVLKNQGIIDVVAYSMFLNK 231

Query: 316 PDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXX 375
            ++  GSILFGA+D SK+ G L T P+LN+Y      +P    V LQGLG  +       
Sbjct: 232 LESDTGSILFGAIDTSKYTGDLVTFPMLNIYPDV-TDKPATLMVILQGLGAQDNANCKAE 290

Query: 376 X--XXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHD--ETKIVF 431
                KIP LLDSG+TL   P+++ +M+AD + A FSE+   Y+M+CP+K     T  +F
Sbjct: 291 TFVTSKIPVLLDSGTTLMGAPKEIADMMADFMNATFSEDEGIYIMECPTKETLANTDYIF 350

Query: 432 NFGGFNIETNLTTYTTPISSD--TCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISM 489
           +FGG  I+  L+ +     S+   C   +LP   ++ +LGD FL  AYVV+DL++++IS+
Sbjct: 351 DFGGVQIKVPLSNFILSAQSEGGPCGFAVLPDDSNTMVLGDIFLSSAYVVFDLDNYQISL 410

Query: 490 AQANFDVN 497
           A AN D N
Sbjct: 411 AAANLDNN 418

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 3/65 (4%)

Query: 58  FVKRDDG--EYELSLRN-RQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSN 114
           + KR+ G    E+ L++  Q +Y+  LE+G+P Q +TVL D+GSSDLW+  + NPYC+S 
Sbjct: 40  YAKRNSGSGHLEIELQHIEQTYYATTLEIGTPPQNLTVLFDSGSSDLWVMDASNPYCESQ 99

Query: 115 SHSSK 119
              S+
Sbjct: 100 YTGSQ 104

>TPHA0C00840 Chr3 (173318..176320) [3003 bp, 1000 aa] {ON} Anc_8.318
           YLR120C
          Length = 1000

 Score =  218 bits (556), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 116/299 (38%), Positives = 176/299 (58%), Gaps = 9/299 (3%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S +C R+G+F  ++SST+  N+T F I+Y  G+   G WG+D++ +G +N + +S  V +
Sbjct: 114 SFNCERFGSFSISKSSTFTKNSTEFAITYVSGNNCIGVWGQDNLIIGGVNATGLSFGVVH 173

Query: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPD 317
            T S+ G+LGIGLP  ETT     ++     + Y NFPMVLK +GI     YS+YL+S  
Sbjct: 174 TTTSSAGILGIGLPDTETT-----AVGQYGHYKYDNFPMVLKNKGIISHQGYSIYLDSSS 228

Query: 318 AHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGL-SNQXXXXXXX 376
           +  G  L G VD SK+ G+LY +P++N Y +   S P  F VTLQGLGL +N        
Sbjct: 229 STYGEFLLGGVDTSKYTGTLYKLPLVNWYNTY-FSSPGDFHVTLQGLGLITNSGSAVTLT 287

Query: 377 XXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGF 436
             K+  +LD+GST+  +P  L   +   LG  +S     Y+  CP+  + +K+VFNFGG 
Sbjct: 288 ETKMAVILDTGSTVTGIPATLYNALLSSLGGYYSSTHGAYVFTCPT--ETSKLVFNFGGI 345

Query: 437 NIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANFD 495
           N +  ++++   +  + C L++    DS+ ILGD FL + Y  +DLE+ EI +A A+FD
Sbjct: 346 NYKLPMSSFINTLGDNVCSLKVSSRSDSNFILGDDFLRNVYAAFDLENKEIGLAMADFD 404

 Score = 65.9 bits (159), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 32/81 (39%), Positives = 49/81 (60%), Gaps = 1/81 (1%)

Query: 31  KIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKI 90
           K   + F K + ++ EE       +   + + DGE ++ L NR  FYS ++EVG+P+Q +
Sbjct: 28  KAAVIPFRKYYADSLEELDYNTSTSETKLVKRDGE-DIVLTNRNTFYSAEIEVGTPAQTM 86

Query: 91  TVLLDTGSSDLWITGSDNPYC 111
            V++DTGSSDLW+ G DN  C
Sbjct: 87  NVIVDTGSSDLWVIGHDNLTC 107

>Skud_9.154 Chr9 (291885..293435) [1551 bp, 516 aa] {ON} YIL015W
           (REAL)
          Length = 516

 Score =  202 bits (513), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 115/313 (36%), Positives = 182/313 (58%), Gaps = 12/313 (3%)

Query: 198 SIDCSRYGTFDKNQSSTYKS-NNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           S+DCS   T+++N SSTY+  +N  F I Y D +F+ G WG++ + +  ++I D+   +A
Sbjct: 101 SVDCSSMSTYNENSSSTYQDLDNGRFYIIYADETFSDGSWGKETVSVNGIDIPDIQFGLA 160

Query: 257 NDTNSTV-GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNS 315
               + V GVLGIG P  E+    + +    D++ Y NFP +LK   I     YSL+LNS
Sbjct: 161 KYATTPVSGVLGIGFPRRESVKGYEGA---PDKY-YPNFPQLLKSEQIIDVVAYSLFLNS 216

Query: 316 PDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQX--XXX 373
           PD+  GSI+FGA+D+SKF G L T P++N Y +  V  P    +T+QGLG  N+      
Sbjct: 217 PDSGMGSIVFGAIDESKFYGDLLTFPMVNEYPTI-VDAPATLAMTIQGLGAQNKSGCERE 275

Query: 374 XXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNF 433
                K P LLDSG++L   P+ + + +A  + A +S +   Y+++CP   D+ +  F+F
Sbjct: 276 TFMTTKYPVLLDSGTSLLNAPKTIADKMASFVNASYSADEGIYILNCPDSADDIEYTFDF 335

Query: 434 GGFNIETNLTT--YTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQ 491
           G   I   LT+   +  +    C   + P+ D S +LGD FL  AYVV+DL++++IS+AQ
Sbjct: 336 GDLQINVPLTSLILSPEVEGGYCGFAVQPTND-SMVLGDVFLSSAYVVFDLDNYKISLAQ 394

Query: 492 ANFDVNHEDIEVV 504
           AN++ + +  +V+
Sbjct: 395 ANWNASEDSKQVI 407

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 39/56 (69%), Gaps = 1/56 (1%)

Query: 64  GEYELSL-RNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSS 118
           G  ELSL R  Q +Y+  L++G+PSQ++TVL DTGS+D W+  S NP+C   S+ S
Sbjct: 31  GHLELSLQREEQMYYATTLDIGTPSQQLTVLFDTGSADFWVMDSSNPFCSPKSNPS 86

>YIL015W Chr9 (322342..324105) [1764 bp, 587 aa] {ON}  BAR1Aspartyl
           protease secreted into the periplasmic space of mating
           type a cells, helps cells find mating partners, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest
          Length = 587

 Score =  202 bits (513), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 118/315 (37%), Positives = 179/315 (56%), Gaps = 16/315 (5%)

Query: 198 SIDCSRYGTFDKNQSSTYKS-NNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           SIDC    T+++++SSTY+   N  F I+Y DG+FA G WG + + +  ++I ++   VA
Sbjct: 101 SIDCRSMSTYNEHRSSTYQYLENGRFYITYADGTFADGSWGTETVSINGIDIPNIQFGVA 160

Query: 257 NDTNSTV-GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNS 315
               + V GVLGIG P  E    S +         Y NFP +LK   I     YSL+LNS
Sbjct: 161 KYATTPVSGVLGIGFPRRE----SVKGYEGAPNEYYPNFPQILKSEKIIDVVAYSLFLNS 216

Query: 316 PDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXX 375
           PD+  GSI+FGA+D+SKF G L+T P++N Y +  V  P    +T+QGLG  N+      
Sbjct: 217 PDSGTGSIVFGAIDESKFSGDLFTFPMVNEYPTI-VDAPATLAMTIQGLGAQNKSSCEHE 275

Query: 376 --XXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNF 433
                K P LLDSG++L   P+ + + +A  + A +SE    Y++DCP    + +  F+F
Sbjct: 276 TFTTTKYPVLLDSGTSLLNAPKVIADKMASFVNASYSEEEGIYILDCPVSVGDVEYNFDF 335

Query: 434 GGFNIETNLTTYTTPISSDT----CVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISM 489
           G   I   L++    +S +T    C   + P+ D S +LGD FL  AYVV+DL++++IS+
Sbjct: 336 GDLQISVPLSSLI--LSPETEGSYCGFAVQPTND-SMVLGDVFLSSAYVVFDLDNYKISL 392

Query: 490 AQANFDVNHEDIEVV 504
           AQAN++ +    ++V
Sbjct: 393 AQANWNASEVSKKLV 407

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 39/56 (69%), Gaps = 1/56 (1%)

Query: 64  GEYELSLRNRQN-FYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSS 118
           G  E  L++ +  +Y+  L++G+PSQ +TVL DTGS+D W+  S NP+C  NS++S
Sbjct: 31  GHLEFLLQHEEEMYYATTLDIGTPSQSLTVLFDTGSADFWVMDSSNPFCLPNSNTS 86

>Smik_9.175 Chr9 (296875..298656) [1782 bp, 593 aa] {ON} YIL015W
           (REAL)
          Length = 593

 Score =  201 bits (510), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 117/313 (37%), Positives = 176/313 (56%), Gaps = 12/313 (3%)

Query: 198 SIDCSRYGTFDKNQSSTYKS-NNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           S+DC    T+ +  SSTY++ +N  F I Y DG+FA G WG + + +  + I ++   +A
Sbjct: 101 SVDCQSMVTYSEGNSSTYQNLDNGRFYIIYADGTFADGTWGTETVSIDGIVIPNIQFGLA 160

Query: 257 NDTNSTV-GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNS 315
               + V GVLGIG P  E    S +         Y NFP +LK   I     YSL+LNS
Sbjct: 161 KYATTPVSGVLGIGFPRRE----SVKGYEGAPNKYYPNFPQILKSEQIIDVVAYSLFLNS 216

Query: 316 PDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXX--X 373
           P++  GSI+FGA+D+SKF G L+T P++N Y +  V  P    +T+QGLG  N+      
Sbjct: 217 PESGTGSIIFGAIDESKFSGDLFTFPMVNEYPNI-VDTPATLAMTIQGLGAQNKNSCEYE 275

Query: 374 XXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNF 433
                K P LLDSG++L   P+ + + +A  + A +S     Y++DCP+  DE +  F+F
Sbjct: 276 TFMTTKYPVLLDSGTSLLNAPKVIADKMASFVNATYSAEEGIYILDCPAFADEIEYTFDF 335

Query: 434 GGFNIETNLTTYTTPISSDT--CVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQ 491
           G   I   LT+      ++   C   + P+ D S +LGD FL  AYVV+DL++++IS+AQ
Sbjct: 336 GDLKISVPLTSLILSPEAEGGYCGFAVQPTND-SMVLGDVFLSSAYVVFDLDNYKISLAQ 394

Query: 492 ANFDVNHEDIEVV 504
           AN+DV+    ++V
Sbjct: 395 ANWDVSEITTKLV 407

 Score = 60.5 bits (145), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 24/49 (48%), Positives = 37/49 (75%), Gaps = 1/49 (2%)

Query: 64  GEYELSLRNRQN-FYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYC 111
           G  E SL+ +++ +Y+  L++G+PSQ++TVL DTGS+D WI  S NP+C
Sbjct: 31  GRLEFSLQRKEDMYYATTLDIGTPSQQLTVLFDTGSADFWIMDSSNPFC 79

>ZYRO0D15554g Chr4 complement(1298587..1300152) [1566 bp, 521 aa]
           {ON} weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 521

 Score =  194 bits (494), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 117/306 (38%), Positives = 168/306 (54%), Gaps = 14/306 (4%)

Query: 197 QSIDCSRYGTFDKNQSSTYKSNNTA-FEISYGDGSFASGEWGRDHIELGSLNISDVSMAV 255
           ++IDC      D N SS ++  N   F I+Y DGSF  G W  D +     +IS +   V
Sbjct: 102 ETIDCQGLTALDVNSSSQFRDLNVGRFYINYTDGSFDDGYWATDEVSAAGAHISGLQFGV 161

Query: 256 ANDTNSTV-GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLN 314
           A   +  + G+LG+G P  E+     +         Y NFP +LK+ GI     YS+YLN
Sbjct: 162 AQYASEEIPGILGLGFPRRESV----RGYPGAPNKFYDNFPQMLKKDGIIDVVAYSMYLN 217

Query: 315 SPDAHNG-SILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXX 373
            P+   G S+LFG VD SK+ G LYT P+ N Y +  VS+P    VTLQG G   +    
Sbjct: 218 DPNGSGGGSVLFGGVDPSKYSGDLYTFPMANQYPNI-VSKPATLAVTLQGFGAQKKSEGR 276

Query: 374 XXX--XXKIPALLDSGSTLAYLPEDLLEMVADGLG--ARFSENLNYYLMDCPSKHDETKI 429
                      LLDSG++L   PE+++  +A  +   ARFSE+   Y+MDCP K D+T+ 
Sbjct: 277 QETFDTNNYAVLLDSGTSLMGAPEEVVSKMAHFINKNARFSEDDGIYVMDCPPKDDDTEF 336

Query: 430 VFNFGGFNIETNLTTYTTPISSDT-CVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEIS 488
           VF+FG   I   ++T   P S ++ C L +LP  D +  LGD FL +AY+V+DL+++++S
Sbjct: 337 VFDFGDLQIAVPVSTLILPPSGESYCGLGVLPK-DGTWTLGDVFLSYAYLVFDLDNYKVS 395

Query: 489 MAQANF 494
           MA+A F
Sbjct: 396 MAKAKF 401

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 31/78 (39%), Positives = 48/78 (61%), Gaps = 10/78 (12%)

Query: 55  ALPFVKRD---------DGEYELSLRNRQN-FYSVDLEVGSPSQKITVLLDTGSSDLWIT 104
           A P VK+D          G   LSL++  + FYS  LE+GSP+QK+ +++D+GS+D W+ 
Sbjct: 15  AFPLVKKDGSNNGGDGNSGTLMLSLKHVSDEFYSTTLEIGSPAQKLDLVVDSGSADTWVM 74

Query: 105 GSDNPYCKSNSHSSKKRD 122
            S NP+C SN+ S   ++
Sbjct: 75  ASTNPFCSSNAKSGASKN 92

>NDAI0B01720 Chr2 complement(409125..410768) [1644 bp, 547 aa] {ON}
           Anc_7.182
          Length = 547

 Score =  191 bits (484), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 114/324 (35%), Positives = 182/324 (56%), Gaps = 18/324 (5%)

Query: 198 SIDCSRYGTFDKNQSSTYK---SNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMA 254
           +IDCS +  ++   SSTY+   ++N+ F + Y DGSF  G W ++ +++ + NI+ + +A
Sbjct: 113 TIDCSYFNKYNPEISSTYQKLPNDNSRFYLQYTDGSFEDGIWSKETVQIDNYNITSLQLA 172

Query: 255 VANDTNSTVG-VLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYL 313
           VAN   + VG +LGI  P  E+    D ++       Y NFP VLK   I    +YS+YL
Sbjct: 173 VANYATTPVGGLLGISFPRRESVKGYDGAL----NEYYPNFPQVLKNENIIDIVLYSMYL 228

Query: 314 NSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQ---X 370
           N  +  +GS+LFGA+D SKF+G + T P++NVY +  V +P    +T+QG+   N     
Sbjct: 229 NDLN-QDGSLLFGAIDTSKFEGDMITYPMVNVYPNV-VDKPATLALTIQGVAAQNTNDCT 286

Query: 371 XXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKH--DETK 428
                   K P LLDSG+TL   P++L + +AD + A +SE+   Y+++CPS+   ++ +
Sbjct: 287 QNETFMTSKFPVLLDSGTTLMSAPKELADKMADFVNATYSEDDRIYILNCPSQEVLNDIE 346

Query: 429 IVFNFGGFNIETNLTTYTTPI--SSDTCVLRILPSGDS-SAILGDAFLVHAYVVYDLEDF 485
            +F+FGG  ++  L  +  P    S  C   +LP   +   +LGD FL   Y V+DL+ +
Sbjct: 347 YIFDFGGLQVKIPLEKFILPSDDGSGPCAFGVLPETTTDRMVLGDIFLSFVYAVFDLDHY 406

Query: 486 EISMAQANFDVNHEDIEVVSSSIP 509
           +IS+A  N + N E  E    +IP
Sbjct: 407 QISLANINKNANSESNEDSIINIP 430

 Score = 61.2 bits (147), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 45/72 (62%), Gaps = 3/72 (4%)

Query: 60  KRDD--GEYELSLRN-RQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSH 116
           KR+D  G   + L + +Q +Y+  L+VG+P Q ITVLLD+GSSD W+  S NP+C  N  
Sbjct: 36  KRNDISGHLHMKLEHIQQTYYATTLQVGTPPQNITVLLDSGSSDFWLMDSKNPFCMENYC 95

Query: 117 SSKKRDIGDNSL 128
           +S +    +N L
Sbjct: 96  NSTEIPKYNNDL 107

>CAGL0E01727g Chr5 (171119..172738) [1620 bp, 539 aa] {ON} similar
           to uniprot|P32329 Saccharomyces cerevisiae YLR120c YAP3
           or uniprot|Q12303 Saccharomyces cerevisiae YLR121c YPS3
           or uniprot|P53379 Saccharomyces cerevisiae YDR144c MKC7
          Length = 539

 Score =  189 bits (479), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 107/294 (36%), Positives = 166/294 (56%), Gaps = 7/294 (2%)

Query: 222 FEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGIGLPGLETTY-SSD 280
           F + Y DG++ASG WG D  +L   N+S+++ A+AN  N+++GVLG+G P  ETT   S 
Sbjct: 144 FFVKYEDGTYASGMWGTDTFKLNHHNVSNITFALANIANASMGVLGVGFPAEETTDDPSP 203

Query: 281 QSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTI 340
            S++  + + Y NFP+ LK     KK  YS++LN  ++  G ILFG VD SK+ G+L+T+
Sbjct: 204 GSLIDKEHYQYDNFPIALKRTRTIKKVSYSIFLNDTNSKKGVILFGGVDHSKYQGTLWTV 263

Query: 341 PILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEM 400
           P++N   +   +   + ++TL GLG  +          KIP LLD+G+TLAY P+ ++++
Sbjct: 264 PMVNNLLTLNQTTTSRPEITLNGLGFRDDKKNVTLWGEKIPVLLDTGTTLAYAPKQVVDV 323

Query: 401 VADGL-GARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNLTTYTTPISSDTCVLRIL 459
           +A  + G   S+     L  CP+  D ++++FNF G  I  +L           C L I 
Sbjct: 324 IAKRVNGTIDSKTGGIKLKKCPNAKDNSELIFNFAGAEIPVSLLNMVEK-RKGKCYLEIR 382

Query: 460 PSGDSSA---ILGDAFLVHAYVVYDLEDFEISMAQANF-DVNHEDIEVVSSSIP 509
              + S    +LGD F+ H Y V+++ED E+S A AN  D     IE + S +P
Sbjct: 383 YHEELSKTGMLLGDIFMRHVYSVFNMEDMEVSFAVANGNDSAPLQIEAIISDVP 436

 Score = 64.3 bits (155), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 58/115 (50%), Gaps = 18/115 (15%)

Query: 7   LKCTLLANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEY 66
           +K  L A VA+ A    + E QT + V L+  KRH  N      G  +A+       G+ 
Sbjct: 1   MKFLLFAAVAQ-AYLQLDFERQTAQDVALA--KRHTSN------GVANAMDVPIEQIGDL 51

Query: 67  ELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKKR 121
                     Y+V L VG+P Q +TV LDTGSSDLW   + NPYCK N+  + K+
Sbjct: 52  ---------MYTVQLHVGTPPQNVTVQLDTGSSDLWFPVASNPYCKRNAKLAPKK 97

>Ecym_4394 Chr4 (827655..829211) [1557 bp, 518 aa] {ON} similar to
           Ashbya gossypii AGR240W
          Length = 518

 Score =  188 bits (477), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 108/316 (34%), Positives = 176/316 (55%), Gaps = 15/316 (4%)

Query: 201 CSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTN 260
           CS   T++  +SST+      F I Y + +F+ G W +D + +G+ ++S +   V+N +N
Sbjct: 110 CSSSRTYNFQRSSTFTPTGYKFFIDYVN-TFSRGIWAKDRLVIGNADVSGLQFGVSNISN 168

Query: 261 STV-GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAH 319
           +T+ G+LG+G   LE    S +         Y N PM+LKE G   K  YS++LN  +++
Sbjct: 169 TTINGILGVGYERLE----SVKGYSGAPNRTYPNLPMLLKESGKIDKVAYSVFLNHLNSN 224

Query: 320 NGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXX--XXXXX 377
             ++ FG VD  K+ G LY  P++N+YKS  + +P +F +TLQ L +             
Sbjct: 225 VSTVTFGGVDSEKYTGDLYKFPLVNIYKS--IPRPSKFHITLQALEVHGNYSSLNKTVSN 282

Query: 378 XKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFN 437
             +PAL D+G+    +P ++ E +A  + A F E  + YL  CP++ D+TK+VF+FG   
Sbjct: 283 TPLPALFDTGTNGMVVPPNVAENIASTIHATFDEKFSLYLFACPAEEDDTKLVFDFGDIQ 342

Query: 438 IETNLTTYTTP---ISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQANF 494
           IE  L  +  P   + ++ C + I+P  D +  LG  FL   YVVY+LED+E+++AQAN+
Sbjct: 343 IEAPLANFIVPAAELGTEQCGVAIIPE-DGTFTLGIPFLRSTYVVYNLEDYEVALAQANW 401

Query: 495 DVN-HEDIEVVSSSIP 509
             +    I  + S+IP
Sbjct: 402 KWDGKSKITPIISNIP 417

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 36/54 (66%), Gaps = 2/54 (3%)

Query: 62  DDGE--YELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKS 113
           +DGE  + + L N  + Y  ++EVG+P QK+ VL DTGS+DLW   SDN YC +
Sbjct: 35  NDGEKCFSMDLINNNDHYLAEIEVGTPPQKLKVLFDTGSADLWFQSSDNEYCAA 88

>SAKL0E15356g Chr5 (1283552..1285225) [1674 bp, 557 aa] {ON} weakly
           similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015W BAR1 Aspartyl protease secreted into the
           periplasmic space of mating type a cells, cleaves and
           inactivates alpha factor allowing cells to recover from
           alpha-factor-induced cell cycle arrest and to YLR121C
           uniprot|Q12303 Saccharomyces cerevisiae YLR121C YPS3
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YLR120C
           uniprot|P32329 Saccharomyces cerevisiae YLR120C YPS1
           Aspartic protease, attached to the plasma membrane via a
           glycosylphosphatidylinositol (GPI) anchor and to YDR144C
           uniprot|P53379 Saccharomyces cerevisiae YDR144C MKC7
           GPI- anchored aspartyl protease (yapsin) involved in
           protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 557

 Score =  189 bits (479), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 123/331 (37%), Positives = 177/331 (53%), Gaps = 31/331 (9%)

Query: 197 QSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
            +  C     F+ N S++  SNNT F   + D +FASG W +D IE+GS+ I   +  VA
Sbjct: 162 HAFPCYLADVFEVNYSTSIVSNNTDFFTQFYDYTFASGTWYQDTIEVGSIIIEKFNFGVA 221

Query: 257 NDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSP 316
            +TN+T+G LG+GL G E T   D +      + Y NFP  LK  G+ K+ +YS+Y    
Sbjct: 222 QETNATIGSLGLGLEGNEITNEGDYT------YTYENFPTKLKNSGMIKRVIYSIYAGKI 275

Query: 317 DAHNGSILFGAVDKSKFDG-SLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXX 375
           D  +GS+LFGAV+ S++ G +LYT+P++NV  +   S P++F VTLQ L +S        
Sbjct: 276 DTEDGSLLFGAVEHSRYVGDTLYTLPLVNV--NNASSDPVEFHVTLQNLVVSVNKTNTTI 333

Query: 376 XXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLM---DCPSKHDETKIVFN 432
              +  ALL++G+ + YLP  L        G   SE+  YY M   DC S   E    ++
Sbjct: 334 MSDRYAALLNTGAIVTYLPTHLFSDFIKKTG--LSESQKYYGMYVTDCSS---EISFSYD 388

Query: 433 FGGFNIETNLTTY-----TTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEI 487
           FGGF IE++L  Y      + I    C + I    +   +LG  F   AYVV+DLE  E+
Sbjct: 389 FGGFKIESSLNDYLFEIDESEIPGAKCAVTINSHDEKYLVLGSGFFSSAYVVFDLERLEV 448

Query: 488 SMAQA-----NFDV----NHEDIEVVSSSIP 509
           S+AQA     NF      ++ D+E+V  SIP
Sbjct: 449 SIAQAAHVYDNFTYSNIEDNPDVEIVIDSIP 479

 Score = 43.9 bits (102), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 21/56 (37%), Positives = 30/56 (53%), Gaps = 2/56 (3%)

Query: 58  FVKRDDGEYELSLRNR--QNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYC 111
           F+KRD    EL L NR      +V + +G   Q +  + DTG SD W+ G ++ YC
Sbjct: 82  FIKRDGSARELDLYNRAYSGLLNVIISIGKEGQNMFFVADTGLSDTWVVGQNSVYC 137

>TDEL0H02650 Chr8 (445052..446710) [1659 bp, 552 aa] {ON} Anc_7.182
           YIL015W
          Length = 552

 Score =  186 bits (471), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 118/305 (38%), Positives = 163/305 (53%), Gaps = 12/305 (3%)

Query: 199 IDCSRYGTFDKNQSSTYKSNNTA-FEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           IDC   GTFD N SS+++  +   F I Y D SFA G W ++ + L  ++IS +   VA+
Sbjct: 122 IDCKALGTFDYNGSSSFERLDIGRFYIKYSDESFADGFWAKEKLRLNGIDISTLQFGVAD 181

Query: 258 DTNSTVG-VLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSP 316
                VG VLGIG P  E+    D +        Y NFP VLK  G+     YS++LN  
Sbjct: 182 YATVPVGGVLGIGFPRRESVKGYDDA----PNEFYPNFPQVLKNEGVIGVAAYSMFLNEV 237

Query: 317 DAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXX--XX 374
            +  GSILFGAVD +K+ GSLYT P++N Y +  V +P    +TLQ LG  +        
Sbjct: 238 SSDAGSILFGAVDPTKYTGSLYTFPMVNEYPNV-VDKPATLAMTLQALGAKSDSSCKYKT 296

Query: 375 XXXXKIPALLDSGSTLAYLPEDLL-EMVADGLGARFSENLNYYLMDCPSKHDETKIVFNF 433
               K   LLDSG+TL   P ++  EM     G  ++E+   +  DCPS  D+T+ +F+F
Sbjct: 297 FTTTKQAVLLDSGTTLMTAPPEIAEEMAFFCWGPTYNESEGIFYFDCPSDDDDTEFIFDF 356

Query: 434 GGFNIETNLTTYTTPISSD-TCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQA 492
           G   I   L +     S D  C   + P+   S  LG  FL  AYVVYDL++++IS+AQA
Sbjct: 357 GDLKITLPLASLVISSSGDGHCGFGLTPAS-YSMTLGAIFLSSAYVVYDLDNYQISIAQA 415

Query: 493 NFDVN 497
            +D N
Sbjct: 416 KWDGN 420

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 33/46 (71%), Gaps = 1/46 (2%)

Query: 67  ELSLRNRQN-FYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYC 111
           E+ L++    +YS  LE+G+  Q++ VL D+GSSD+W++ S NPYC
Sbjct: 57  EIDLQHESGIYYSAILEIGTSHQELPVLFDSGSSDMWVSSSSNPYC 102

>KNAG0H02760 Chr8 (507659..509350) [1692 bp, 563 aa] {ON} Anc_7.182
           YIL015W
          Length = 563

 Score =  176 bits (447), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 106/308 (34%), Positives = 166/308 (53%), Gaps = 14/308 (4%)

Query: 199 IDCSRYGTFDKNQSSTYKS-NNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           +DCS+  T++ N+S++++  NN  F I YGD +FA G WG +  E G + I +V   +A+
Sbjct: 115 VDCSQIKTYNANRSTSFQELNNGRFYIIYGDKTFADGIWGTETFEFGGVKIPNVQFGLAD 174

Query: 258 DTNSTVG-VLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSP 316
              + +G VLGIG    E    S +   +     Y NFP VLK  GI     YSL L   
Sbjct: 175 YATTPIGGVLGIGFQRRE----SVKGYTNAPEVFYPNFPQVLKNEGIIDTVAYSLSL--- 227

Query: 317 DAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXX--X 374
              +  I+FGA+D++ + G + T P++N++ +  VS+P    +T+QGLG  N+       
Sbjct: 228 -GQSSHIMFGAIDRNSYIGDMVTFPMINMFPN-AVSKPATLSITIQGLGAQNKQECKFQT 285

Query: 375 XXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFG 434
               K PALLDSGSTL   P ++ + +A  +GA++SE+   Y ++CP+       +F+FG
Sbjct: 286 FSTTKYPALLDSGSTLISAPVEIADKMAAFIGAQWSESDGIYTLECPNDTTNIDYIFDFG 345

Query: 435 GFNIETNLTTYTTPISSDTCVLRI-LPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQAN 493
                  L+    P    + V    L   D+  +LGD FL    VV+DL+ ++IS+A++N
Sbjct: 346 DMKFTLPLSNLILPSQGGSNVCGFGLQRSDNEIVLGDVFLCSTLVVFDLDHYQISLAKSN 405

Query: 494 FDVNHEDI 501
              + EDI
Sbjct: 406 QKSSAEDI 413

 Score = 54.7 bits (130), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 40/59 (67%), Gaps = 1/59 (1%)

Query: 58  FVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSH 116
             KR+  +++L   + ++FY+  L++G P Q+ITV+ D+GS+D W+    NP+C S+S+
Sbjct: 39  LAKRNHLKFDLQFED-ESFYATTLKIGDPPQEITVIFDSGSADTWVMSRYNPFCLSSSN 96

>Smik_5.7 Chr5 (4489..5403) [915 bp, 304 aa] {ON} YIR039C (REAL)
          Length = 304

 Score =  167 bits (424), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 94/215 (43%), Positives = 127/215 (59%), Gaps = 5/215 (2%)

Query: 296 MVLKERGITKKNVYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPI 355
           M LK  G  +K  YSL+LN P AH GSILFGAVDKSK+ G LYT+P+L  Y +     P 
Sbjct: 1   MALKSHGKIEKIAYSLFLNEPKAHFGSILFGAVDKSKYSGQLYTLPMLQAYDTLDSVSPG 60

Query: 356 QFDVTLQGLGLSN-QXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLN 414
            F VT Q + + N           + P L DSG+T + LP ++   +      ++S    
Sbjct: 61  MF-VTAQSVAVLNGDSGNKTVSKVRFPVLFDSGTTYSSLPTEVAHAIGKSFDGKYSSGDQ 119

Query: 415 YYLMDCPSKHDETKIVFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSSAILGDAFLV 474
            Y  DC SK  +T +  +FGGFNI  N++ + T  + D C+L I  + DS  +LGDAFLV
Sbjct: 120 GYTFDC-SKVKDTLLSIDFGGFNISANISNFVTR-TKDHCLLNI-EAADSGFVLGDAFLV 176

Query: 475 HAYVVYDLEDFEISMAQANFDVNHEDIEVVSSSIP 509
            AYVV+DLE  E+S+AQA+FD   E+IEV+S  +P
Sbjct: 177 DAYVVFDLESHEVSIAQASFDDKKEEIEVISDRVP 211

>Suva_79.1 Chr79 complement(1..681) [681 bp, 227 aa] {ON} YIR039C
           (REAL)
          Length = 227

 Score =  162 bits (409), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 92/230 (40%), Positives = 136/230 (59%), Gaps = 9/230 (3%)

Query: 270 LPGLETTYSSDQSMVSGDR--HMYSNFPMVLKERGITKKNVYSLYLNSPDAHNGSILFGA 327
           LP +E T    ++++S D   ++Y NFPM LK +G  +K  YSL+LN P+A  GSILFGA
Sbjct: 1   LPSVEET-DEIENVMSPDTTPYVYDNFPMALKRQGKIEKIAYSLFLNEPNARFGSILFGA 59

Query: 328 VDKSKFDGSLYTIPILNVYK----SRGVSQPIQFDVTLQGLGLSNQXXXXXXXXXKIPAL 383
           VDKSK+ G LYT+P+L  Y     S G+    Q    L    + ++         + P L
Sbjct: 60  VDKSKYSGQLYTLPMLKAYNTLDSSAGMEITAQSVAILSVAIIDSKSGNKTVSEVQFPVL 119

Query: 384 LDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNLT 443
            DSG++ + LP ++ + +      ++S +   Y+ DC SK + T +  +FGGFNI  N++
Sbjct: 120 FDSGTSTSALPTEIADAIGRSFDGKYSSDNQGYIFDC-SKVNNTLLSIDFGGFNISANIS 178

Query: 444 TYTTPISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQAN 493
              TPI+ D C+L I  + DS  +LGDAFL+  YVV+DLE  E+S+AQA+
Sbjct: 179 NSVTPITKDHCLLNI-EADDSGYVLGDAFLIDTYVVFDLESHEVSVAQAS 227

>CAGL0J02288g Chr10 complement(223820..225445) [1626 bp, 541 aa]
           {ON} similar to uniprot|P12630 Saccharomyces cerevisiae
           YIL015w BAR1
          Length = 541

 Score =  165 bits (417), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 107/300 (35%), Positives = 162/300 (54%), Gaps = 16/300 (5%)

Query: 199 IDCSRYGTFDKNQSSTYKS-NNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           IDCS    +D ++S T+    N  F+I Y D ++ SG W  D I L   ++ D+   +A 
Sbjct: 100 IDCSGLVFYDMDKSQTFDYLKNVTFKIGYADTTYTSGIWIVDIITLPEGHLKDLQFGMAF 159

Query: 258 DTNSTV-GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSP 316
            TN+T  GVLGIG P +E+   +      G    Y NFP+ LK  G T    YS+  N  
Sbjct: 160 ATNATFSGVLGIGFPAMESV--NGYEFAPG--KFYPNFPLALKNAGFTNIAAYSIEYND- 214

Query: 317 DAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVS-QPIQFDVTLQGLGLSNQXXXXXX 375
           ++  GSILFG++D S+F G LYT P++N +   G++ +P    +TL G+G+         
Sbjct: 215 ESKKGSILFGSIDTSRFIGPLYTFPMINEFP--GIADEPSTLSLTLDGIGIDGSCEQWVI 272

Query: 376 XXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKH--DETKIVFNF 433
              K+PALLD+GSTL  LP  + + +A  L A +S++   +++ CPS      T + F F
Sbjct: 273 SNTKLPALLDTGSTLIELPHPITQSIASYLNATWSDDHGLFVLACPSDDFLTTTDLAFTF 332

Query: 434 GGFNIETNLTTYTT---PISSDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMA 490
           G  +++  L ++       S+  C L I  S     ILGD+FL H Y V+DL+++ IS+A
Sbjct: 333 GELHMKIPLRSFILLPDEESNGLCGLGIT-SSKGRVILGDSFLTHVYTVFDLDNYMISLA 391

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 48/96 (50%), Gaps = 13/96 (13%)

Query: 33  VKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQN-FYSVDLEVGSPSQKIT 91
           ++L+ +KR   ++    L KR A+          +L  R   N +Y   LE G+P Q I 
Sbjct: 20  LRLTIEKRIVSSHAS--LSKRSAV----------DLQFRRFNNLYYESVLEFGTPPQSIP 67

Query: 92  VLLDTGSSDLWITGSDNPYCKSNSHSSKKRDIGDNS 127
           ++LDTGSSDLW+T   NP C +       + + D S
Sbjct: 68  LVLDTGSSDLWVTLIGNPLCYNKGSGKPPKCLIDCS 103

>AGR240W Chr7 (1200736..1202094) [1359 bp, 452 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL015W (BAR1)
          Length = 452

 Score =  154 bits (388), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 101/318 (31%), Positives = 150/318 (47%), Gaps = 14/318 (4%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           SIDC    TF    S+T +     F I Y D +F  G W  D + +G  ++S +   V  
Sbjct: 98  SIDCRGIKTFCNESSTTLRILPNPFYIDYAD-TFVDGSWATDRLVIGGHDVSGMKFGVGR 156

Query: 258 DTNSTV-GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSP 316
            +N+ + GVLG+G   LE+     +         Y N P  LK  G  +K  YS+ L   
Sbjct: 157 TSNTELSGVLGVGHANLESV----RGYAGAPNATYPNLPRQLKLDGSVQKLAYSVSLQKT 212

Query: 317 DAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLS--NQXXXXX 374
              +G ILFGA+D SK+ G L+T PILN+     ++ P  F + LQG+ +          
Sbjct: 213 SERDGEILFGAIDTSKYVGKLHTFPILNIDPH--LNSPSNFYIALQGIDIQGGRSSTGRP 270

Query: 375 XXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFG 434
                  ALLD+G T   +   L E +   L A +      +++ CP++ D  +  FNFG
Sbjct: 271 LINSSFHALLDTG-TGGMVVSSLAEDIGAALNATYDTEQCVFVIQCPTEDDTRQFNFNFG 329

Query: 435 GFNIETNLTTYTTPIS---SDTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQ 491
              I   ++ +  P S   +  C L I+P    +  LG  FL   Y V++LED EISMA+
Sbjct: 330 ELQIAVPISNFVVPASGLETGQCALAIMPGTSETFALGIPFLKEVYTVFNLEDNEISMAR 389

Query: 492 ANFDVNHEDIEVVSSSIP 509
           AN +    DI  + + +P
Sbjct: 390 ANTNPQEPDIRPIPAGVP 407

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 21/49 (42%), Positives = 34/49 (69%)

Query: 63  DGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYC 111
           DG   + L +  + Y +++EVG+P QK+  +LDTGS+DLW+   +NP+C
Sbjct: 32  DGFLAMPLHHNDDHYDIEIEVGTPPQKLHAVLDTGSADLWLQAENNPFC 80

>SAKL0H00330g Chr8 complement(40564..42300) [1737 bp, 578 aa] {ON}
           weakly similar to uniprot|P12630 Saccharomyces
           cerevisiae YIL015W BAR1 Aspartyl protease secreted into
           the periplasmic space of mating type a cells, cleaves
           and inactivates alpha factor allowing cells to recover
           from alpha-factor-induced cell cycle arrest and to
           YLR121C uniprot|Q12303 Saccharomyces cerevisiae YLR121C
           YPS3 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YLR120C uniprot|P32329 Saccharomyces cerevisiae YLR120C
           YPS1 Aspartic protease, attached to the plasma membrane
           via a glycosylphosphatidylinositol (GPI) anchor and to
           YDR144C uniprot|P53379 Saccharomyces cerevisiae YDR144C
           MKC7 GPI- anchored aspartyl protease (yapsin) involved
           in protein processing; shares functions with Yap3p and
           Kex2p and to YIR039C uniprot|P40583 Saccharomyces
           cerevisiae YIR039C YPS6 Putative GPI-anchored aspartic
           protease, member on vGLC.1466.
          Length = 578

 Score =  147 bits (372), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 104/318 (32%), Positives = 165/318 (51%), Gaps = 20/318 (6%)

Query: 201 CSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTN 260
           C     F    SS++  N+  F + Y D S+A+G W +D    G  +  +V++A+ ++TN
Sbjct: 142 CKLVNVFYPEDSSSFVLNDLDFHVQYDDYSYANGTWSQDTFSFGYPSFYNVNIALVSETN 201

Query: 261 STVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSPDAHN 320
            TVG LG+GL   + T   D      D  +Y++    LK +G  +K  YS+Y +  +   
Sbjct: 202 LTVGSLGLGLRANQATNQGD------DPFVYNSLLYRLKTQGWIEKIAYSVYTSELNGTG 255

Query: 321 GSILFGAVDKSKFDGS-LYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXXK 379
           G I FG +    + G+ LYT+P++NV     + +P +F +TLQ L  S           K
Sbjct: 256 GGIFFGGLYHDLYKGNVLYTLPLVNV--DPELDEPARFHITLQNLTTSINGTNFSVLSEK 313

Query: 380 IPALLDSGSTLAYLPEDLLEMVADGLG-ARFSENLNYYLMDCPSKHDETKIVFNFGGFNI 438
            PALL +GS   YLPE+L +   D +   + +++ + Y++ C +       +++FGGF I
Sbjct: 314 YPALLSTGSMFTYLPEELFDSFVDEMDLEKGAKHKDLYVIPCDTN---ATFIYDFGGFEI 370

Query: 439 ETNLTTYTTPISS-----DTCVLRILPSGDSSAILGDAFLVHAYVVYDLEDFEISMAQAN 493
           ET L+ YT  + S     D C + + P   S   LG+ F    YV+++LED EISMA A+
Sbjct: 371 ETPLSGYTFKVESNRTADDMCAVMVKPHNKSYLTLGNGFFAATYVLFNLEDLEISMAPAS 430

Query: 494 --FDVNHEDIEVVSSSIP 509
               ++  D E + SSIP
Sbjct: 431 GIEYLDAFDYEYIESSIP 448

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 17/33 (51%), Positives = 25/33 (75%)

Query: 81  LEVGSPSQKITVLLDTGSSDLWITGSDNPYCKS 113
           + VG+PSQ I  LLDT SSD+W+  S++ +C+S
Sbjct: 82  MYVGTPSQAIRFLLDTDSSDIWLLNSNSTFCES 114

>Kpol_1063.22 s1063 (50979..51989) [1011 bp, 336 aa] {ON}
           (50979..51989) [1011 nt, 337 aa]
          Length = 336

 Score =  139 bits (351), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 77/208 (37%), Positives = 124/208 (59%), Gaps = 7/208 (3%)

Query: 197 QSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
            SI+C+++GT+ +++SST    +    I YGDGSFA GEW  D + +G  ++  V   ++
Sbjct: 110 HSINCTKFGTYTRDKSSTSNKLDHRLFIQYGDGSFADGEWITDTLTIGPYDLQSVQFGIS 169

Query: 257 NDTNSTV-GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNS 315
           N+ ++ + GVLG+G    E+    D S       +Y N P  LK++ IT  N +SL+LN+
Sbjct: 170 NNASTIISGVLGLGFLRTESIDGYDGS----PNKLYYNLPAYLKDQEITNTNAFSLFLNN 225

Query: 316 PDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGL-GLSNQXXXXX 374
            +  +G++LFG +D SKF G L T P++N+Y  + +++P  F +TLQ L G  N      
Sbjct: 226 SNDASGTVLFGGIDYSKFSGDLVTFPLVNIYP-KLINEPCTFTITLQQLYGKINGGKSIG 284

Query: 375 XXXXKIPALLDSGSTLAYLPEDLLEMVA 402
               K+PALLDSGS+L  +P ++ + +A
Sbjct: 285 LIKEKVPALLDSGSSLISMPIEITDEIA 312

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%)

Query: 76  FYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYC 111
           FYS  L  G+P Q +TVL+DTGSSDLW++  +N YC
Sbjct: 64  FYSTLLSFGNPVQNVTVLVDTGSSDLWVSSPNNIYC 99

>TBLA0D04580 Chr4 complement(1133223..1134410) [1188 bp, 395 aa]
           {ON} Anc_7.182 YIL015W
          Length = 395

 Score =  139 bits (351), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 100/332 (30%), Positives = 166/332 (50%), Gaps = 35/332 (10%)

Query: 198 SIDCSRYGTFDKNQSSTYKS--NNTAFEISYGDGSFASGEWGRDHIELGS---------- 245
           +IDC+ +  F+K+ S T+ +   N+ F+I Y D S+  G+WG D I + S          
Sbjct: 69  NIDCTGFTFFNKSNSKTFSNIYKNSIFQIGYQDASYTFGKWGVDSISINSSYSDSNEDTG 128

Query: 246 --LNISDVSMAVANDTNSTV-GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERG 302
              NI +   A+A ++N  V  VLG+G P  E                Y N P ++K+ G
Sbjct: 129 LYANIPNAQFAIATNSNVPVQAVLGLGFPRREAV----NGYKLATNKFYPNLPQLIKQHG 184

Query: 303 ITKKNVYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQ 362
            +     ++YL S + +N SI+FGA DK+++ G L+  P++N Y +    +P  F +TL 
Sbjct: 185 YSDNVTIAMYLGSNETYN-SIMFGAYDKTRYIGDLHNFPMVNQYPNV-TDKPATFAITLD 242

Query: 363 GLGLS---NQXXXXXXXX-XKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLM 418
            + +S   NQ          K   +LDSG++L   P+  +  +A  L A F    + YL+
Sbjct: 243 SMYISMDNNQSDNIYISNDEKYSVVLDSGTSLLSAPDHYVSKIAGLLNATFDNTTHMYLL 302

Query: 419 DCPSKHDETK-----IVFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSSA--ILGDA 471
             PS+ D T      I F F  FN+  N+  +  P   D+ V  ILP+ + +   +LGD 
Sbjct: 303 --PSETDLTLYKDMIINFKFMDFNVPINMLEFILPYD-DSYVFAILPTKNVNTGFVLGDI 359

Query: 472 FLVHAYVVYDLEDFEISMAQANFDVNHEDIEV 503
           FL H Y +++L+++ IS+  +N ++   + E+
Sbjct: 360 FLPHVYTIFNLDNYTISLGLSNQNITSNEREI 391

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/46 (47%), Positives = 31/46 (67%), Gaps = 1/46 (2%)

Query: 67  ELSLRN-RQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYC 111
           EL LR    ++Y  ++ +G+P Q I VL+DTGSSDLW+   +NP C
Sbjct: 20  ELPLRFIDDSYYETNILIGNPPQNIGVLVDTGSSDLWVNSPNNPNC 65

>Smik_6.351 Chr6 (563275..564492) [1218 bp, 405 aa] {ON} YPL154C
           (REAL)
          Length = 405

 Score =  104 bits (259), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 138/308 (44%), Gaps = 40/308 (12%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +D   SS+YK+N T F I YG GS   G   +D + +G L I     A A 
Sbjct: 124 SLACFLHSKYDHEASSSYKANGTEFAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEAT 182

Query: 258 DTNSTV-------GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYS 310
                        G+LG+G              +S D+ +   +  + ++    KK  + 
Sbjct: 183 SEPGLTFAFGKFDGILGLGY-----------DTISVDKVVPPFYNAIQQDLLDEKKFAFY 231

Query: 311 LYLNSPDAHN-GSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQ 369
           L   S D+ N G   FG +D+SKF G +  +P         V +   ++V  +G+GL ++
Sbjct: 232 LGDTSKDSENGGEATFGGIDESKFKGDITWLP---------VRRKAYWEVKFEGIGLGDE 282

Query: 370 XXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKI 429
                       A +D+G++L  LP  L EM+   LGA+       Y +DC ++     +
Sbjct: 283 YAELESHG----AAIDTGTSLITLPSGLAEMINAELGAKKGWT-GQYTLDCNTRDSLPDL 337

Query: 430 VFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSS-----AILGDAFLVHAYVVYDLED 484
           +FNF G+N       YT  +S  +C+  I P          AI+GDAFL   Y +YDL +
Sbjct: 338 IFNFNGYNYTIGPYDYTLEVSG-SCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGN 396

Query: 485 FEISMAQA 492
             + +A+A
Sbjct: 397 NAVGLAKA 404

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 63  DGEYELSLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDLWI 103
           +G +++ L N  N  Y  D+ +G+P Q   V+LDTGSS+LW+
Sbjct: 76  EGGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWV 117

>Skud_16.128 Chr16 complement(231348..232565) [1218 bp, 405 aa] {ON}
           YPL154C (REAL)
          Length = 405

 Score =  103 bits (258), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 138/308 (44%), Gaps = 40/308 (12%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +D   SS+YK+N T F I YG GS   G   +D + +G L I     A A 
Sbjct: 124 SLACFLHSKYDHEASSSYKANGTEFAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEAT 182

Query: 258 DTNSTV-------GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYS 310
                        G+LG+G              +S D+ +   +  + ++    KK  + 
Sbjct: 183 SEPGLTFAFGKFDGILGLGY-----------DTISVDKVVPPFYNAIQQDLLDEKKFAFY 231

Query: 311 LYLNSPDAHNGS-ILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQ 369
           L   S D+ NG    FG +D+SKF G +  +P         V +   ++V  +G+GL ++
Sbjct: 232 LGDTSKDSENGGEATFGGIDESKFKGDITWLP---------VRRKAYWEVKFEGIGLGDE 282

Query: 370 XXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKI 429
                       A +D+G++L  LP  L EM+   LGA+       Y +DC ++     +
Sbjct: 283 YAELEGHG----AAIDTGTSLITLPSGLAEMINAELGAKKGWT-GQYTLDCNTRDSLPDL 337

Query: 430 VFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSS-----AILGDAFLVHAYVVYDLED 484
           +FNF G+N       YT  +S  +C+  I P          AI+GDAFL   Y +YDL +
Sbjct: 338 IFNFNGYNFTIGPYDYTLEVSG-SCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGN 396

Query: 485 FEISMAQA 492
             + +A+A
Sbjct: 397 DAVGLAKA 404

 Score = 39.7 bits (91), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 28/42 (66%), Gaps = 1/42 (2%)

Query: 63  DGEYELSLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDLWI 103
           +G +++ L N  N  Y  D+ +G+P Q   V+LDTGSS+LW+
Sbjct: 76  EGGHDVPLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWV 117

>Suva_16.156 Chr16 complement(268862..270082) [1221 bp, 406 aa] {ON}
           YPL154C (REAL)
          Length = 406

 Score =  103 bits (256), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 87/308 (28%), Positives = 137/308 (44%), Gaps = 40/308 (12%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +D   SS+YK N T F I YG GS   G   +D + +G L I     A A 
Sbjct: 125 SLACFLHSKYDHEASSSYKPNGTEFAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEAT 183

Query: 258 DTNSTV-------GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYS 310
                        G+LG+G              +S D+ +   +  + ++    KK  + 
Sbjct: 184 SEPGLTFAFGKFDGILGLGY-----------DTISVDKVVPPFYNAIQQDLLDEKKFAFY 232

Query: 311 LYLNSPDAHNGS-ILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQ 369
           L   S D+ NG    FG +DKSKF G +  +P         V +   ++V  +G+GL ++
Sbjct: 233 LGDTSKDSENGGEATFGGIDKSKFKGDVTWLP---------VRRKAYWEVKFEGIGLGHE 283

Query: 370 XXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKI 429
                       A +D+G++L  LP  L EM+   +GA+   +   Y +DC ++     +
Sbjct: 284 FAELEGHG----AAIDTGTSLITLPSGLAEMINAEIGAKKGWS-GQYALDCNTRDGLPDL 338

Query: 430 VFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSS-----AILGDAFLVHAYVVYDLED 484
            FNF G+N       YT  +S  +C+  I P          AI+GDAFL   Y +YDL +
Sbjct: 339 TFNFNGYNFTIGPYDYTLEVSG-SCISAITPMDFPEPVGPLAIIGDAFLRKYYSIYDLGN 397

Query: 485 FEISMAQA 492
             + +A+A
Sbjct: 398 DAVGLAEA 405

 Score = 39.7 bits (91), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 1/46 (2%)

Query: 63  DGEYELSLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDLWITGSD 107
           +G +++ L N  N  Y  D+ +G+P Q   V+LDTGSS+LW+  ++
Sbjct: 77  EGGHDVPLTNYLNAQYYTDISLGNPPQNFKVILDTGSSNLWVPSTE 122

>YPL154C Chr16 complement(259714..260931) [1218 bp, 405 aa] {ON}
           PEP4Vacuolar aspartyl protease (proteinase A), required
           for the posttranslational precursor maturation of
           vacuolar proteinases; important for protein turnover
           after oxidative damage; synthesized as a zymogen,
           self-activates
          Length = 405

 Score =  102 bits (255), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 85/308 (27%), Positives = 138/308 (44%), Gaps = 40/308 (12%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +D   SS+YK+N T F I YG GS   G   +D + +G L I     A A 
Sbjct: 124 SLACFLHSKYDHEASSSYKANGTEFAIQYGTGSL-EGYISQDTLSIGDLTIPKQDFAEAT 182

Query: 258 DTNSTV-------GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYS 310
                        G+LG+G              +S D+ +   +  + ++    K+  + 
Sbjct: 183 SEPGLTFAFGKFDGILGLGY-----------DTISVDKVVPPFYNAIQQDLLDEKRFAFY 231

Query: 311 LYLNSPDAHN-GSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQ 369
           L   S D  N G   FG +D+SKF G +  +P         V +   ++V  +G+GL ++
Sbjct: 232 LGDTSKDTENGGEATFGGIDESKFKGDITWLP---------VRRKAYWEVKFEGIGLGDE 282

Query: 370 XXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKI 429
                       A +D+G++L  LP  L EM+   +GA+       Y +DC ++ +   +
Sbjct: 283 YAELESHG----AAIDTGTSLITLPSGLAEMINAEIGAKKGWT-GQYTLDCNTRDNLPDL 337

Query: 430 VFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSS-----AILGDAFLVHAYVVYDLED 484
           +FNF G+N       YT  +S  +C+  I P          AI+GDAFL   Y +YDL +
Sbjct: 338 IFNFNGYNFTIGPYDYTLEVSG-SCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLGN 396

Query: 485 FEISMAQA 492
             + +A+A
Sbjct: 397 NAVGLAKA 404

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 24/96 (25%), Positives = 45/96 (46%), Gaps = 5/96 (5%)

Query: 13  ANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRD----DGEYEL 68
           A V ++  +  E+ ++  ++         G+ Y          + F +      +G +++
Sbjct: 22  AKVHKAKIYKHELSDEMKEVTFEQHLAHLGQKYLTQFEKANPEVVFSREHPFFTEGGHDV 81

Query: 69  SLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDLWI 103
            L N  N  Y  D+ +G+P Q   V+LDTGSS+LW+
Sbjct: 82  PLTNYLNAQYYTDITLGTPPQNFKVILDTGSSNLWV 117

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score =  102 bits (253), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 88/305 (28%), Positives = 141/305 (46%), Gaps = 34/305 (11%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +D ++SS+YK N T F I YG GS   G   +D + +G LNI     A A 
Sbjct: 127 SLACYLHSKYDHDKSSSYKPNGTDFAIRYGTGSL-EGYISQDTLNIGDLNIPKQDFAEAT 185

Query: 258 DTNSTVGVLGI--GLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYL-- 313
                    G   G+ GL   Y S    +S ++ +   +  + +E    KK  ++ YL  
Sbjct: 186 SEPGLTFAFGKFDGILGL--AYDS----ISVNKVVPPFYNAIEQELLDEKK--FAFYLGD 237

Query: 314 -NSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXX 372
            N      G I  G +DK+KF G +  +P         V +   ++V  +G+GL +Q   
Sbjct: 238 ANKKSEDGGEITIGGIDKTKFKGDIDWLP---------VRRKAYWEVKFEGIGLGDQFAE 288

Query: 373 XXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFN 432
                    A +D+G++L  LP  L E++   +GA+       Y ++C ++ +   + FN
Sbjct: 289 LENHG----AAIDTGTSLIALPSGLAEIINTEIGAKKGWT-GQYTVECDARPNLPDLTFN 343

Query: 433 FGGFNIETNLTTYTTPISSDTCVLRILPSG-----DSSAILGDAFLVHAYVVYDLEDFEI 487
           F G N       YT  +S  +C+  I+P          AI+GDAFL   Y +YDLE+  +
Sbjct: 344 FNGKNFTIGPYDYTLEVSG-SCISAIMPMDFPEPVGPMAIIGDAFLRKYYSIYDLENNAV 402

Query: 488 SMAQA 492
            +A+A
Sbjct: 403 GLAEA 407

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 1/62 (1%)

Query: 43  ENYEESLLGKRDALPFVKRDDGEYELSLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDL 101
           E +   +   RD   F +  +  + + L N  N  Y  D+ +G+P Q   V+LDTGSS+L
Sbjct: 59  EKFNPEVSFSRDHPFFTQGKNSGHNIPLSNYLNAQYFADITLGTPPQSFKVILDTGSSNL 118

Query: 102 WI 103
           W+
Sbjct: 119 WV 120

>NCAS0C01360 Chr3 complement(249141..250361) [1221 bp, 406 aa] {ON}
           Anc_8.677
          Length = 406

 Score =  101 bits (251), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 84/305 (27%), Positives = 141/305 (46%), Gaps = 34/305 (11%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +D + SS+YK+N T F I YG GS   G   +D + +G L I     A A 
Sbjct: 125 SLACFLHSKYDHDASSSYKANGTKFAIQYGSGSL-EGYISQDTLNIGDLTIPKQDFAEAT 183

Query: 258 DTNSTVGVLGI--GLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYL-- 313
                    G   G+ GL   Y +    +S D+ +   +  +  E+G+  +  ++ YL  
Sbjct: 184 SEPGLTFAFGKFDGILGL--AYDT----ISVDKVVPPFYNAI--EQGLLDEKKFAFYLGD 235

Query: 314 -NSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXX 372
               + + G I  G +D+SKF G +  +P         V +   ++V  +G+ L +Q   
Sbjct: 236 TKKDEKNGGEITIGGIDESKFKGDIEWLP---------VRRKAYWEVKFEGIALGDQYAA 286

Query: 373 XXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFN 432
                    A +D+G++L  LP  L E++   +GA+       Y +DC ++     + FN
Sbjct: 287 LENHG----AAIDTGTSLITLPSGLAEIINTEIGAKKGWT-GQYTLDCDTRDGLPDLTFN 341

Query: 433 FGGFNIETNLTTYTTPISSDTCVLRILPSG-----DSSAILGDAFLVHAYVVYDLEDFEI 487
           F G N   +   YT  +S  +C+  I+P          AI+GDAFL   Y +YDL++  +
Sbjct: 342 FNGKNFTISPFDYTLEVSG-SCISAIMPMDFPEPMGPMAIVGDAFLRKYYSIYDLDNHAV 400

Query: 488 SMAQA 492
            +A+A
Sbjct: 401 GLAEA 405

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/52 (44%), Positives = 31/52 (59%), Gaps = 2/52 (3%)

Query: 57  PFVKRDDGEYELSLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDLWITGSD 107
           PF    DG + + L N  N  Y  D+ VG+P Q   V+LDTGSS+LW+  S+
Sbjct: 72  PFFAEGDG-HNVPLTNYLNAQYFADISVGTPPQNFKVILDTGSSNLWVPSSE 122

>KNAG0J01710 Chr10 (312872..314119) [1248 bp, 415 aa] {ON} Anc_8.677
           YPL154C
          Length = 415

 Score = 99.8 bits (247), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 87/305 (28%), Positives = 141/305 (46%), Gaps = 34/305 (11%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +D + SS+YK+N T F I YG GS   G   +D + +G L I     A A 
Sbjct: 134 SLACFLHEKYDHSASSSYKANGTDFSIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEAT 192

Query: 258 DTNSTVGVLGI--GLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLN- 314
                    G   G+ GL          +S D+ +   +  +  E+ +  +  ++ YL  
Sbjct: 193 SEPGLAFAFGKFDGILGLA------YDTISVDKVVPPFYNAL--EQDLLDEAKFAFYLGD 244

Query: 315 -SPDAHN-GSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXX 372
            + DA + G  +FG VDKSK+ G +  +P         V +   ++V L+GLGL ++   
Sbjct: 245 TNKDAEDGGEAIFGGVDKSKYTGDVTWLP---------VRRKAYWEVKLEGLGLGDEYAE 295

Query: 373 XXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFN 432
                    A +D+G++L  LP  L E++   +GA+       Y ++C ++     + FN
Sbjct: 296 LESHG----AAIDTGTSLITLPSGLAEIINSEIGAKKGWT-GQYTLECNTRDQLPDLTFN 350

Query: 433 FGGFNIETNLTTYTTPISSDTCVLRILPSGDSS-----AILGDAFLVHAYVVYDLEDFEI 487
           F G+N       YT  +S  +C+  I P          AI+GDAFL   Y +YDLE   +
Sbjct: 351 FNGYNFTIGPYDYTLEVSG-SCISAITPMDFPEPVGPLAIVGDAFLRKYYSIYDLEHNAV 409

Query: 488 SMAQA 492
            +A+A
Sbjct: 410 GLAKA 414

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 52/111 (46%), Gaps = 18/111 (16%)

Query: 13  ANVARSAAFSQEVEEQTPKIVKLSFDKRHGENY--------EESLLGKRDALPFVK---R 61
           A V ++  F +E+ E+   I      +  G+ Y         E    K    PF K   +
Sbjct: 23  AKVHKAKLFKREITEEMEAIPFEQHVQHLGQKYLNQYEKAFPEVSFSKHH--PFFKGSAQ 80

Query: 62  DDGE----YELSLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDLWITGSD 107
           D  E    +E+ L N  N  Y  D+ +G+P Q+  V+LDTGSS+LW+  S+
Sbjct: 81  DSFEVAKGHEVPLSNYLNAQYYTDITLGTPPQQFKVILDTGSSNLWVPSSE 131

>TBLA0B03830 Chr2 complement(880233..881474) [1242 bp, 413 aa] {ON}
           Anc_8.677 YPL154C
          Length = 413

 Score = 97.4 bits (241), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 84/307 (27%), Positives = 138/307 (44%), Gaps = 38/307 (12%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  ++ ++SSTYK+N +AF I YG GS   G   +D +E+G L I+    A A 
Sbjct: 132 SLACYLHSKYNHDESSTYKANGSAFAIQYGSGSL-EGYISQDVMEIGDLKITKQDFAEAT 190

Query: 258 DTNSTVGVLGI--GLPGLETTYSSDQSMVSGDRHMYSNFPMVLK--ERGITKKNVYSLYL 313
                    G   G+ GL     +   +V          P V     +G+  +  ++ YL
Sbjct: 191 SEPGISFAFGKFDGILGLAYDTIAVNRVV----------PPVYNAINQGLLDEPKFAFYL 240

Query: 314 NSPDA---HNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQX 370
                   + G  +FG +D++KF+G +  +P         V +   ++V L+GLGL  + 
Sbjct: 241 GDASKSKDNGGEAVFGGIDETKFEGDITWLP---------VRRKAYWEVKLEGLGLGEEY 291

Query: 371 XXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIV 430
                      A +D+G++L  LP  L E++   +GA+       Y ++C  +     + 
Sbjct: 292 TELENHG----AAIDTGTSLITLPSGLAEIINSEIGAKKGWT-GQYTIECDKRASLPDMT 346

Query: 431 FNFGGFNIETNLTTYTTPISSDTCVLRILPSG-----DSSAILGDAFLVHAYVVYDLEDF 485
           F F G+N   +   YT  +S  +C+  I P          AI+GDAFL   Y VYDL + 
Sbjct: 347 FTFDGYNFTISPYDYTLEVSG-SCISAITPMDFPEPVGPMAIIGDAFLRKYYSVYDLGND 405

Query: 486 EISMAQA 492
            + +A A
Sbjct: 406 AVGLAPA 412

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 63  DGEYELSLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKKR 121
           +G +E+ L N  N  Y  D+++G+P Q   V+LDTGSS+LW+   +        HS    
Sbjct: 84  NGGHEVPLSNYMNAQYFADIKIGTPPQSFKVVLDTGSSNLWVPSKECGSLACYLHSKYNH 143

Query: 122 D 122
           D
Sbjct: 144 D 144

>Kwal_26.8802 s26 (949063..950301) [1239 bp, 412 aa] {ON} YPL154C
           (PEP4) - vacuolar proteinase A [contig 68] FULL
          Length = 412

 Score = 96.7 bits (239), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 87/312 (27%), Positives = 136/312 (43%), Gaps = 48/312 (15%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +  + SS+YK+N T+F I YG GS   G   +D + +G L I     A A 
Sbjct: 131 SLACFLHSKYSHDASSSYKANGTSFAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEAT 189

Query: 258 DTNSTV-------GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLK--ERGITKKNV 308
                        G+LG+G      T S D+ +           P V K    G+  +  
Sbjct: 190 SEPGLAFAFGKFDGILGLGY----DTISVDKVV-----------PPVYKAINDGLLDEPR 234

Query: 309 YSLYLNSPD---AHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLG 365
           ++ YLN+ D      G + FG +D SK+ G +  +P+      R     ++FD    G+G
Sbjct: 235 FAFYLNNADDSEESTGEVTFGGIDSSKYKGDITWLPV-----RRKAYWEVKFD----GIG 285

Query: 366 LSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHD 425
           L ++            A +D+G++L  LP  L E++   +GA+       Y +DC S+  
Sbjct: 286 LGDEYAELQGTG----AAIDTGTSLIALPSGLAEVLNSEIGAKKGWT-GQYTVDCESRDQ 340

Query: 426 ETKIVFNFGGFNIETNLTTYTTPISSDTCVLRILPSG-----DSSAILGDAFLVHAYVVY 480
              + F F G N       YT  +S  +C+    P          AI+GDAFL   Y +Y
Sbjct: 341 LPDLTFTFNGKNFTITAYDYTLEVSG-SCISAFTPMDFPEPVGPLAIIGDAFLRKFYSIY 399

Query: 481 DLEDFEISMAQA 492
           DL +  + +AQA
Sbjct: 400 DLGNNAVGLAQA 411

 Score = 37.4 bits (85), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 64  GEYELSLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDLWI 103
           G +++ L N  N  Y  ++ +G+P Q   V+LDTGSS+LW+
Sbjct: 84  GGHDVPLSNYLNAQYFTEISLGTPPQSFKVILDTGSSNLWV 124

>KLTH0D11264g Chr4 (920981..922234) [1254 bp, 417 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 417

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 87/312 (27%), Positives = 138/312 (44%), Gaps = 48/312 (15%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +  + SS+YK+N T F I YG GS   G   +D + +G L I     A A 
Sbjct: 136 SLACFLHSKYSHDASSSYKANGTNFAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEAT 194

Query: 258 DTNSTV-------GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLK--ERGITKKNV 308
                        G+LG+G      T + D+ +           P V K    G+  +  
Sbjct: 195 SEPGLAFAFGKFDGILGLGY----DTIAVDKVV-----------PPVYKAINDGLLDEPR 239

Query: 309 YSLYLNSPD---AHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLG 365
           ++ YLN+ D      G + FG +D SK+ G++  +P+      R     ++FD    G+G
Sbjct: 240 FAFYLNNADDSEESTGEVTFGGIDSSKYKGNITWLPV-----RRKAYWEVKFD----GIG 290

Query: 366 LSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHD 425
           L ++            A +D+G++L  LP  L E++   +GA+   +   Y +DC S+  
Sbjct: 291 LGDEYAELEGTG----AAIDTGTSLIALPSGLAEVLNAEIGAKKGWS-GQYTVDCESRDQ 345

Query: 426 ETKIVFNFGGFNIETNLTTYTTPISSDTCVLRILPSG-----DSSAILGDAFLVHAYVVY 480
              + F F G N   +   YT  +S  +C+    P          AI+GDAFL   Y VY
Sbjct: 346 LPDLTFTFNGKNFTISAYDYTLEVSG-SCISAFTPMDFPEPVGPLAIIGDAFLRKFYSVY 404

Query: 481 DLEDFEISMAQA 492
           DL +  + +AQA
Sbjct: 405 DLGNNAVGLAQA 416

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 27/41 (65%), Gaps = 1/41 (2%)

Query: 64  GEYELSLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDLWI 103
           G +++ L N  N  Y  ++ +G+P Q   V+LDTGSS+LW+
Sbjct: 89  GGHDVPLSNYLNAQYFTEITLGTPPQSFKVILDTGSSNLWV 129

>SAKL0H06512g Chr8 complement(573927..575141) [1215 bp, 404 aa] {ON}
           highly similar to uniprot|P07267 Saccharomyces
           cerevisiae YPL154C PEP4 Vacuolar aspartyl protease
           (proteinase A) required for the posttranslational
           precursor maturation of vacuolar proteinases synthesized
           as a zymogen self-activates
          Length = 404

 Score = 94.7 bits (234), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 84/304 (27%), Positives = 140/304 (46%), Gaps = 33/304 (10%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +D + SS+YK+N ++F I YG GS   G   +D + +G L I     A A 
Sbjct: 124 SLACFLHAKYDHDSSSSYKANGSSFAIQYGSGSL-EGYISQDTLSIGDLTIPKQDFAEAT 182

Query: 258 DTNSTVGVLGI--GLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNS 315
                    G   G+ GL   Y S    +S D+ +   +  +    G+  +  +S YL +
Sbjct: 183 SEPGLAFAFGKFDGILGL--AYDS----ISVDKVVPPVYNAI--HNGLLDEPKFSFYLGN 234

Query: 316 PD--AHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXX 373
            D     G   FG +D SK++G++  +P+      R     ++FD    G+GL ++    
Sbjct: 235 ADKSTDGGEATFGGIDSSKYEGNITWLPV-----RRKAYWEVKFD----GIGLGDEYAIL 285

Query: 374 XXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNF 433
                   A +D+G++L  LP  L E++   +GA+   +   Y ++C ++     +  NF
Sbjct: 286 DGHG----AAIDTGTSLIALPSGLAEILNAEIGAKKGWS-GQYSVECDTRDSLPDLTLNF 340

Query: 434 GGFNIETNLTTYTTPISSDTCVLRILPSG-----DSSAILGDAFLVHAYVVYDLEDFEIS 488
           GG+N       YT  +S  +C+    P          AI+GDAFL   Y VYDL +  + 
Sbjct: 341 GGYNFTITPYDYTLEVSG-SCISAFTPMDFPEPVGPLAIIGDAFLRKHYSVYDLGNDAVG 399

Query: 489 MAQA 492
           +A+A
Sbjct: 400 LAKA 403

 Score = 37.4 bits (85), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 25/100 (25%), Positives = 45/100 (45%), Gaps = 5/100 (5%)

Query: 13  ANVARSAAFSQEVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRD----DGEYEL 68
           A V ++    Q++E+Q             G+ Y  +         F K      +  +++
Sbjct: 22  AKVHKAKIHKQKLEDQLEGATFEQHITSLGQKYLSAYQKAYPEAEFAKEHQFYAEAGHDV 81

Query: 69  SLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDLWITGSD 107
            L N  N  Y  ++ +G+P Q   V+LDTGSS+LW+  ++
Sbjct: 82  PLTNYLNAQYYTEISLGTPPQNFKVILDTGSSNLWVPSAE 121

>Suva_9.187 Chr9 (310921..311922) [1002 bp, 333 aa] {ON} YIL015W
           (REAL)
          Length = 333

 Score = 93.2 bits (230), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 88/152 (57%), Gaps = 9/152 (5%)

Query: 359 VTLQGLGLSNQXXXXXXX--XXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYY 416
           +T+QGLG  N+           K P LLDSG++L   P+ + + +A  + A +S +   Y
Sbjct: 1   MTIQGLGAQNKSSCQHETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNASYSADEGIY 60

Query: 417 LMDCPSKHDETKIVFNFGGFNIETNLTTYTTPISSDT----CVLRILPSGDSSAILGDAF 472
           ++DCP    + +  F+FG   I   LT+    +S +T    C   + P+ D S +LGD F
Sbjct: 61  ILDCPESTYDVEYTFDFGDLQINVPLTSLI--LSPETEGGYCGFAVQPTND-SMVLGDVF 117

Query: 473 LVHAYVVYDLEDFEISMAQANFDVNHEDIEVV 504
           L  AYVV+DL++++IS+AQAN++ +++  ++V
Sbjct: 118 LSSAYVVFDLDNYKISLAQANWNASNDSKQLV 149

>TPHA0D01260 Chr4 (262523..263782) [1260 bp, 419 aa] {ON} Anc_8.677
           YPL154C
          Length = 419

 Score = 92.8 bits (229), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 89/314 (28%), Positives = 141/314 (44%), Gaps = 51/314 (16%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELG-SLNISDVSMAVA 256
           S+ C  +  +D ++S+TY+ N T F I YG GS   G   RD + +G  L I +   A A
Sbjct: 137 SLACYLHSKYDHDESTTYEKNGTKFTIQYGSGSM-DGYISRDTLIIGDDLVIPEQDFAEA 195

Query: 257 NDTNSTVGVLGI--GLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYL- 313
                     G   G+ GL    + D   V+    +   F   +K+ GI  +N ++ YL 
Sbjct: 196 TSEPGLAFAFGKFDGILGL----AYDTIAVN---KVVPPFYNAIKQ-GILDENKFAFYLG 247

Query: 314 --NSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFD--------VTLQG 363
             N  +   G   FG  DKSKF G +  +P+      R     ++FD         +L G
Sbjct: 248 DTNKDNKSGGEATFGGYDKSKFTGDITWLPV-----RRKAYWEVKFDSIALGDEVASLDG 302

Query: 364 LGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSK 423
            G                A +D+G++L  LP  L E++   +GA+ S +   Y +DC ++
Sbjct: 303 YG----------------AAIDTGTSLITLPSGLAEVINTQIGAKKSWS-GQYTIDCDTR 345

Query: 424 HDETKIVFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSS-----AILGDAFLVHAYV 478
                + FNF G+N   +   YT  +S  +C+  I P          AI+GDAFL   Y 
Sbjct: 346 DALPDMTFNFNGYNFTVSPYDYTLEMSG-SCISAITPMDFPEPVGPLAIIGDAFLRKYYS 404

Query: 479 VYDLEDFEISMAQA 492
           +YDL++  + +A++
Sbjct: 405 IYDLDNNAVGLAKS 418

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 1/60 (1%)

Query: 64  GEYELSLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKKRD 122
           G + + L N  N  Y  D+ +G+P Q   V+LDTGSS+LW+   D        HS    D
Sbjct: 90  GSHNVPLSNYLNAQYYTDISLGTPKQNFKVILDTGSSNLWVPSKDCTSLACYLHSKYDHD 149

>Suva_9.186 Chr9
           (310161..310220,310267..310332,310362..310451,
           310470..310622,310626..310658,310662..310688,
           310692..310742,310746..310787,310807..310833,
           310840..311922) [1632 bp, 543 aa] {OFF} YIL015W (PSEUDO)
          Length = 543

 Score = 93.6 bits (231), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 90/160 (56%), Gaps = 9/160 (5%)

Query: 351 VSQPIQFDVTLQGLGLSNQXXXXXXX--XXKIPALLDSGSTLAYLPEDLLEMVADGLGAR 408
           V  P    +T+QGLG  N+           K P LLDSG++L   P+ + + +A  + A 
Sbjct: 203 VDVPATLAMTIQGLGAQNKSSCQHETFMTTKYPVLLDSGTSLLNAPKSIADKMASFVNAS 262

Query: 409 FSENLNYYLMDCPSKHDETKIVFNFGGFNIETNLTTYTTPISSDT----CVLRILPSGDS 464
           +S +   Y++DCP    + +  F+FG   I   LT+    +S +T    C   + P+ D 
Sbjct: 263 YSADEGIYILDCPESTYDVEYTFDFGDLQINVPLTSLI--LSPETEGGYCGFAVQPTND- 319

Query: 465 SAILGDAFLVHAYVVYDLEDFEISMAQANFDVNHEDIEVV 504
           S +LGD FL  AYVV+DL++++IS+AQAN++ +++  ++V
Sbjct: 320 SMVLGDVFLSSAYVVFDLDNYKISLAQANWNASNDSKQLV 359

>Kpol_1072.15 s1072 complement(35798..36997) [1200 bp, 399 aa] {ON}
           complement(35798..36997) [1200 nt, 400 aa]
          Length = 399

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 84/304 (27%), Positives = 139/304 (45%), Gaps = 33/304 (10%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +D + SSTY+SN + F I YG GS   G   +D + +G L I     A A 
Sbjct: 119 SLACYLHSKYDHSLSSTYRSNGSDFVIQYGSGSL-KGYISQDTLTIGDLIIPQQDFAEAT 177

Query: 258 DTNSTVGVLGI--GLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNS 315
                    G   G+ GL   Y S    +S ++ +   +  +   RG+  K +++ YL  
Sbjct: 178 AEPGLAFAFGKFDGILGL--AYDS----ISVNKAVPPLYNAI--HRGLLDKPMFAFYLGD 229

Query: 316 PDA--HNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXX 373
             +  + G   FG  D S+F+G +  +P+      R     +QFD    G+ L ++    
Sbjct: 230 EKSSKNGGEATFGGYDPSRFEGEIKWLPV-----RRKAYWEVQFD----GIKLGDKFMKL 280

Query: 374 XXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNF 433
                   A +D+G++L  LP  + + + + +GA+ S N   Y +DC  +    K+  NF
Sbjct: 281 EGHG----AAIDTGTSLITLPSQIADFLNNEIGAKKSWN-GQYTIDCKKRESLPKLTLNF 335

Query: 434 GGFNIETNLTTYTTPISSDTCVLRILPSGDSS-----AILGDAFLVHAYVVYDLEDFEIS 488
              N   +   YT  IS  +C+  I P          +I+GDAFL   Y +YDLE+  + 
Sbjct: 336 YNHNFTIDPFDYTLEISG-SCISAITPMDFPQPVGPLSIIGDAFLRRFYSIYDLENNAVG 394

Query: 489 MAQA 492
           +A++
Sbjct: 395 LAKS 398

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 21/27 (77%)

Query: 77  YSVDLEVGSPSQKITVLLDTGSSDLWI 103
           Y  D+ +G+P QK  V+LDTGSS+LW+
Sbjct: 86  YYTDVSIGTPPQKFKVILDTGSSNLWV 112

>ZYRO0F07392g Chr6 (598584..599840) [1257 bp, 418 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 418

 Score = 92.4 bits (228), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 85/309 (27%), Positives = 133/309 (43%), Gaps = 43/309 (13%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +D + SS+YK N T F I YG GS   G   +D + LG L+I+    A A 
Sbjct: 138 SLACFLHSKYDHDSSSSYKPNGTEFAIRYGSGSL-EGYISQDTLNLGDLSITKQDFAEAT 196

Query: 258 DTNSTV-------GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYS 310
                        G+LG+G          D   V G    + N      ++G+  +  ++
Sbjct: 197 SEPGLQFAFGKFDGILGLGY---------DTISVDGVVPPFYN----AWKQGLLDEPKFA 243

Query: 311 LYL--NSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSN 368
            YL  +      G   FG VD SK++G +  +PI      R     ++FD    G+GL  
Sbjct: 244 FYLGRDGESQDGGVATFGGVDDSKYEGEITWLPI-----RRKAYWEVKFD----GIGLGE 294

Query: 369 QXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETK 428
           +            A +D+G++L  LP  L E++   +GA+ S     Y ++C ++     
Sbjct: 295 EYAELENHG----AAIDTGTSLIALPSGLAEIINAEIGAKKSWT-GQYTVECEARSSLPN 349

Query: 429 IVFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDSS-----AILGDAFLVHAYVVYDLE 483
           + F  GG N E     Y   +S   C+  I P          AI+GD+FL   Y +YDL 
Sbjct: 350 MTFTLGGHNFELTAYDYILEVSGQ-CISAIFPMDFPEPVGPLAIIGDSFLRKYYSIYDLG 408

Query: 484 DFEISMAQA 492
           +  + +A A
Sbjct: 409 NNAVGLADA 417

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%)

Query: 77  YSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKKRD 122
           Y  ++ +G+P Q   V+LDTGSS+LW+  ++        HS    D
Sbjct: 105 YYTEVSLGTPPQNFKVILDTGSSNLWVPSTECSSLACFLHSKYDHD 150

>KLLA0D05929g Chr4 (507555..508784) [1230 bp, 409 aa] {ON} highly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A)
           required for the posttranslational precursor maturation
           of vacuolar proteinases synthesized as a zymogen
           self-activates
          Length = 409

 Score = 90.5 bits (223), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 83/304 (27%), Positives = 133/304 (43%), Gaps = 33/304 (10%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +D   SSTYK+N + F I YG GS   G   RD + +G L I D   A A 
Sbjct: 129 SLACFLHTKYDHEASSTYKANGSEFAIQYGSGSL-EGYVSRDLLTIGDLVIPDQDFAEAT 187

Query: 258 DTNSTVGVLGI--GLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNS 315
                    G   G+ GL   Y S    +S +R +   +  +  +  +    V++ YL  
Sbjct: 188 SEPGLAFAFGKFDGILGL--AYDS----ISVNRIVPPVYNAI--KNKLLDDPVFAFYLGD 239

Query: 316 PDAHN--GSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXX 373
            D     G   FG +D+ K+ G +  +P         V +   ++V  +G+GL  +    
Sbjct: 240 SDKSEDGGEASFGGIDEEKYTGEITWLP---------VRRKAYWEVKFEGIGLGEEYATL 290

Query: 374 XXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNF 433
                   A +D+G++L  LP  L E++   +GA+   +   Y +DC S+     +  NF
Sbjct: 291 EGHG----AAIDTGTSLIALPSGLAEILNAEIGAKKGWS-GQYSVDCESRDSLPDLTLNF 345

Query: 434 GGFNIETNLTTYTTPISSDTCVLRILPSGDSS-----AILGDAFLVHAYVVYDLEDFEIS 488
            G+N       YT  +S  +C+    P          AI+GDAFL   Y +YD+    + 
Sbjct: 346 NGYNFTITAYDYTLEVSG-SCISAFTPMDFPEPVGPLAIIGDAFLRKYYSIYDIGHDAVG 404

Query: 489 MAQA 492
           +A+A
Sbjct: 405 LAKA 408

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 63  DGEYELSLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDLWITGSD 107
           +G + + L N  N  Y  ++ +GSP Q   V+LDTGSS+LW+  ++
Sbjct: 81  EGSHSVPLTNYLNAQYFTEITLGSPPQSFKVILDTGSSNLWVPSAE 126

>Kpol_1013.6 s1013 (10059..11267) [1209 bp, 402 aa] {ON}
           (10059..11267) [1209 nt, 403 aa]
          Length = 402

 Score = 88.6 bits (218), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 80/304 (26%), Positives = 136/304 (44%), Gaps = 33/304 (10%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +D + SSTYK N T F I YG GS   G   +D +++G L I     A A 
Sbjct: 122 SLACYLHAKYDHSDSSTYKKNGTTFSIQYGSGSM-EGYISQDVLQIGDLVIPGQDFAEAT 180

Query: 258 DTNSTVGVLGI--GLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYL-- 313
                    G   G+ GL          ++ +R +   +  + K+  +  + ++S YL  
Sbjct: 181 SEPGLAFAFGKFDGILGLA------YDTIAVNRVVPPFYNAINKK--LVDEPIFSFYLGD 232

Query: 314 NSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXX 373
           ++     G + FG  D S F G +  +P+      R     ++FD     + L N+    
Sbjct: 233 DTKSEDGGQVTFGGYDSSLFTGDITWLPV-----RRKAYWEVKFDA----IALGNEVADL 283

Query: 374 XXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNF 433
                   A +D+G++L  LP  L E++   +GA+ S +   +++DC ++     + F F
Sbjct: 284 VNHG----AAIDTGTSLITLPSGLAEVINSQIGAKKSWS-GQWIVDCKTRDTLPDMTFTF 338

Query: 434 GGFNIETNLTTYTTPISSDTCVLRILPSGDSS-----AILGDAFLVHAYVVYDLEDFEIS 488
            G+N       YT  +S  +C+  I P    +     AI+GDAFL   Y +YD+ +  + 
Sbjct: 339 DGYNFTITPYDYTLEVSG-SCISAITPMDFPAPVGPLAIVGDAFLRRYYSIYDVGNNAVG 397

Query: 489 MAQA 492
           +A A
Sbjct: 398 LAAA 401

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%), Gaps = 3/52 (5%)

Query: 57  PFVKRDDGEYELSLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDLWITGSD 107
           PF K  +G + + L N  N  Y  D+ +G+P+Q   V+LDTGSS+LW+   D
Sbjct: 70  PFFK--NGGHNIPLSNYLNAQYYTDITLGTPAQSFKVILDTGSSNLWVPSVD 119

>KAFR0H02420 Chr8 complement(462759..464009) [1251 bp, 416 aa] {ON}
           Anc_8.677 YPL154C
          Length = 416

 Score = 88.2 bits (217), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 79/292 (27%), Positives = 122/292 (41%), Gaps = 29/292 (9%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +D   SSTY  N T F I YG G+   G    D + +G L I     A A 
Sbjct: 132 SLACFLHNKYDHRVSSTYVRNGTRFAIRYGSGAL-EGYMSNDTVTVGDLQIPKQDFAEAT 190

Query: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSP- 316
                   L       +  +      +S +R +   +  V   RG+     ++ YL    
Sbjct: 191 SEPG----LAFAFGKFDGIFGLAFDTISVNRAVPPFYNAV--NRGLLDAPQFAFYLGDKR 244

Query: 317 -DAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXX 375
                G + FG  D+++F G++  +P         V +   ++V   G+   +Q      
Sbjct: 245 LRKEGGEVTFGGYDETRFTGNITWLP---------VRREAYWEVDFNGISFGSQYAPLTA 295

Query: 376 XXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGG 435
                 A +D+G++L  LP  L E++   +GAR + +   Y++DC  +     I FN GG
Sbjct: 296 TG----AAIDTGTSLITLPSGLAEILNAQIGARKNWS-GQYVLDCSRRSTLPDITFNLGG 350

Query: 436 FNIETNLTTYTTPISSDTCVLRILPSGDSS-----AILGDAFLVHAYVVYDL 482
            N       YT   +S TC+  I+P          AI+GDAFL   Y VYDL
Sbjct: 351 SNFSIGPYDYTLE-ASGTCISAIVPMDFPEPVGPLAIIGDAFLRRWYSVYDL 401

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 47/108 (43%), Gaps = 22/108 (20%)

Query: 24  EVEEQTPKIVKLSFDKRHG----------ENYEESLLGKRDALPFVKR-------DDGEY 66
           + +E T  I KLSFD+             E      +  RD  PF K            +
Sbjct: 29  QKQELTDDISKLSFDQHMAHLGSKYVTAFEKAHPDTVLSRDH-PFFKNFIDKHFDAQQNH 87

Query: 67  ELSLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKS 113
           E+ L N  N  Y  D+ +GSP Q   V++DTGSS+LW+   D   C S
Sbjct: 88  EVPLNNYLNAQYFADISIGSPGQTFRVIMDTGSSNLWVPSVD---CNS 132

>TDEL0A06230 Chr1 (1091257..1092483) [1227 bp, 408 aa] {ON}
           Anc_8.677 YPL154C
          Length = 408

 Score = 86.7 bits (213), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/308 (26%), Positives = 134/308 (43%), Gaps = 37/308 (12%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +D + SS+YK N T F I YG GS   G   +D + +G L I     A A 
Sbjct: 124 SLACFLHSKYDHSASSSYKPNGTDFAIQYGSGSL-EGYISQDTLSVGDLVIPKQDFAEAT 182

Query: 258 DTNSTVGVLGI--GLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLN- 314
                    G   G+ GL        + +S D+ +   +  +  ++ +  +  ++ YL  
Sbjct: 183 SEPGLAFAFGKFDGILGLA------YNTISVDKVVPPFYNAI--DQDLLDEPRFAFYLGD 234

Query: 315 -----SPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQ 369
                      G   FG +DKSKF G +  +P         V +   ++V  +G+GL ++
Sbjct: 235 SSDSEDSSVSGGVATFGGIDKSKFKGEISWLP---------VRRKAYWEVKFEGIGLGDE 285

Query: 370 XXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKI 429
                       A +D+G++L  LP  L E++   +GA+   +   Y +DC ++     +
Sbjct: 286 FAILDGHG----AAIDTGTSLITLPSGLAEIINSEIGAKKGWS-GQYTVDCETRSSLPDL 340

Query: 430 VFNFGGFNIETNLTTYTTPISSDTCVLRILPSG-----DSSAILGDAFLVHAYVVYDLED 484
            FNF G N       YT  +S  +C+  I P          AI+GD FL   Y VYDL +
Sbjct: 341 TFNFSGKNYTIGPYDYTLEVSG-SCISAITPMDFPEPVGPLAIVGDTFLRRFYSVYDLGN 399

Query: 485 FEISMAQA 492
             + +A+A
Sbjct: 400 NAVGLAKA 407

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 43/85 (50%), Gaps = 21/85 (24%)

Query: 24  EVEEQTPKIVKLSFDKRHGENYEESLLGKRDALPFVKRDDGEYELSLRNRQNF-YSVDLE 82
           + E+  P+I   SF ++H               PF   D+  +++ L N  N  Y  D+ 
Sbjct: 57  QYEKAYPEI---SFSRKH---------------PFFAEDN--HDVPLTNYLNAQYYTDIS 96

Query: 83  VGSPSQKITVLLDTGSSDLWITGSD 107
           +G+P+Q   V+LDTGSS+LW+   D
Sbjct: 97  LGTPAQNFKVILDTGSSNLWVPSVD 121

>ACR144W Chr3 (603306..604532) [1227 bp, 408 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 408

 Score = 82.8 bits (203), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/316 (25%), Positives = 124/316 (39%), Gaps = 53/316 (16%)

Query: 197 QSIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVA 256
           +++ C  +  +D ++SSTYK N T   ++YG GS   G    D   +  L I        
Sbjct: 125 RAMACRLHKRYDHDRSSTYKENGTLTGVTYGSGSIM-GYVSEDTFRISDLEIPGQQFTET 183

Query: 257 NDTNSTV-------GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFP--MVLKERGITKKN 307
            D   +V       G+LG+  P L                 Y   P    L E+ + K+ 
Sbjct: 184 TDEPGSVFVFAAFDGILGLAYPSLG----------------YGVTPPFQQLMEKKLVKEP 227

Query: 308 VYSLYLN--SPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQG-- 363
           V+ +YL+       NG ++ G  D++KF G +  +P+      R     + FD    G  
Sbjct: 228 VFGMYLDDMKTGEGNGQLVLGGYDETKFKGEIAWLPV-----RRQAYWEVVFDSVTVGDD 282

Query: 364 -LGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPS 422
            + L N             A +DSG++L   P +L       L     +      +DC +
Sbjct: 283 NIPLENYG-----------AAIDSGTSLITFPSELFNQFISKLSGVTKDRQGNVYVDCAN 331

Query: 423 KHDETKIVFNFGG--FNIETNLTTYTTPISSDTCVLRILP----SGDSSAILGDAFLVHA 476
           K     + F FGG  F+I       + P  S  C+  I+     S    AI+GD FL   
Sbjct: 332 KQTAPPLTFGFGGHKFSISGEDYIISVPGQSARCMPAIVQLDIDSAGKVAIIGDVFLRRY 391

Query: 477 YVVYDLEDFEISMAQA 492
           Y +YD  +  + +A A
Sbjct: 392 YSIYDFGNNAVGLATA 407

 Score = 46.6 bits (109), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 58  FVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHS 117
           F K +DG          N Y+ D+ +G+P Q   V++DTGSS LW+ G +   C++ +  
Sbjct: 74  FAKNNDGHVSELANLANNIYAADVTIGTPPQDFRVVVDTGSSTLWVPGKE---CRAMACR 130

Query: 118 SKKR 121
             KR
Sbjct: 131 LHKR 134

>AGR407C Chr7 complement(1475317..1476123) [807 bp, 268 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
           (PEP4)
          Length = 268

 Score = 79.7 bits (195), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 84/299 (28%), Positives = 128/299 (42%), Gaps = 54/299 (18%)

Query: 212 SSTYKSNNTAFEISYGDGS----FASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLG 267
           SSTYKS+    E++ G GS     ++   G     LG    ++ + +V     S  GV G
Sbjct: 5   SSTYKSSGEEVELASGTGSMQGYLSTDVLGMGDAVLGEQGFAEATSSVLPFIASYQGVFG 64

Query: 268 IGLPGLETTYSSDQSMVSGDRHMYSNFPMV--LKERGITKKNVYSLYLNSPDAH--NGSI 323
           +G           + +  G +      P +  + ERG  K  ++ ++L    AH   G I
Sbjct: 65  LG----------HRELAKGGQ-----VPPIYNMMERGQLKDPMFGIFLPKNLAHINEGEI 109

Query: 324 LFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQF------DVTLQGLGLSNQXXXXXXXX 377
           +FG  D +KF GSL  +PI      +G  + ++F      + T+QG GL           
Sbjct: 110 IFGGYDSTKFAGSLEWLPITK----KGFWE-VEFNSISTGESTVQGEGLG---------- 154

Query: 378 XKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFN 437
               A+LD+GS+L  LP ++ +     L A         +  C ++    +IVF  GG  
Sbjct: 155 ----AILDTGSSLTLLPTEIFDKFNGALEAALGSKTGGRV-SCSARETAPEIVFELGGKK 209

Query: 438 IETNLTTYTTPISSDTCVLRILP--SGDSS--AILGDAFLVHAYVVYDLEDFEISMAQA 492
                  Y  P  S+ C++ I P  SG  S   ILG  FL   Y VYDL    + +A+A
Sbjct: 210 FAITGNEYIMPAGSE-CMVTIRPQASGAQSNVVILGTPFLRKFYSVYDLGSDRVGLAEA 267

>CAGL0M02211g Chr13 complement(264202..265449) [1248 bp, 415 aa]
           {ON} similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154c PEP4 aspartyl protease Saccharopepsin precursor
          Length = 415

 Score = 80.1 bits (196), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 82/309 (26%), Positives = 134/309 (43%), Gaps = 35/309 (11%)

Query: 198 SIDCSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVAN 257
           S+ C  +  +D +QSSTY  +     ISYG GS   G    D++++G L I +       
Sbjct: 124 SLACFLHNKYDHSQSSTYIKDGRPLSISYGSGSI-EGYISEDNLQIGDLTIQNQKFG--- 179

Query: 258 DTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYL---N 314
           +T S  G L       +         ++ D      +  +  ++ +  ++ +S YL   N
Sbjct: 180 ETTSEPG-LAFAFGKFDGILGLAYDTIAQDDITPPFYSAI--QQHLLDESKFSFYLKSVN 236

Query: 315 SPDAHNGS------ILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSN 368
            P A  GS         G VD SKF G L  IP+        V +   ++V L  + L +
Sbjct: 237 DPAAEGGSASDGGVFTLGGVDSSKFKGDL--IPL-------HVRRQAYWEVPLNAIKLGD 287

Query: 369 QXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETK 428
           Q            A +D+G++L  LP D+ E++   +GA+       Y ++C ++     
Sbjct: 288 QSTGKLENTG---AAIDTGTSLITLPSDMAEIINAQIGAKKGWT-GQYTLECSTRAKLPD 343

Query: 429 IVFNFGGFNIETNLTTYTTPISSDTCVLRILPSG-----DSSAILGDAFLVHAYVVYDLE 483
           + F   G +   +   YT  +S  +C+  I P          AILGDAFL   Y V+DL+
Sbjct: 344 LTFTLDGHDFVLSPFEYTLEVSG-SCISVITPMDFPEPIGRMAILGDAFLRRYYSVFDLD 402

Query: 484 DFEISMAQA 492
              +S+A+A
Sbjct: 403 ANVVSLAEA 411

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 58/114 (50%), Gaps = 16/114 (14%)

Query: 7   LKCTLLANVARSAAFSQEV--EEQTPKIVKLSFD-------KRHGENYEESLLG---KRD 54
           L   LL + A +  F  E+  E+ T ++++L F+        ++   YE++  G    RD
Sbjct: 11  LALMLLGDYADAKVFQAELKKEKLTKEMLELGFEAHVQQLGHKYVSQYEKANPGTVLPRD 70

Query: 55  ALPFVKRDDGEYELSLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDLWITGSD 107
            L +    D  + + L N  +  Y  D+ +G+P QK  V+LDTGSS+LW+   D
Sbjct: 71  HLFY---PDQVHNVPLSNYMDAQYFADISLGTPPQKFKVILDTGSSNLWVPSVD 121

>Smik_5.6 Chr5 (4120..4488) [369 bp, 123 aa] {ON} YIR039C (REAL)
          Length = 123

 Score = 73.6 bits (179), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 57/95 (60%), Gaps = 1/95 (1%)

Query: 201 CSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTN 260
           C+ +GTF    SST+K N+T F+ +YGDG++  G +G D + LG++ +   S  VAN+T 
Sbjct: 30  CAYWGTFSARNSSTFKCNDTQFDETYGDGTYYRGTYGTDVVSLGNITLESFSFGVANNTE 89

Query: 261 STVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFP 295
           +  G+LGI LP  E T+S   +  +     Y NFP
Sbjct: 90  NQGGILGISLPAGENTHSLGGAYNT-TPFEYENFP 123

>Ecym_2396 Chr2 complement(769479..770726) [1248 bp, 415 aa] {ON}
           similar to Ashbya gossypii ACR144W ACR143W
          Length = 415

 Score = 78.6 bits (192), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 70/306 (22%), Positives = 125/306 (40%), Gaps = 42/306 (13%)

Query: 201 CSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTN 260
           C  +  FD ++SS+Y  N++ F +SYG GS   G    D +++G L I +   A A    
Sbjct: 137 CLNHARFDHDRSSSYAKNDSRFSVSYGKGSM-EGFVSYDTLKIGDLTIKNQGFAEATVEP 195

Query: 261 STV-------GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYL 313
            +        G+LG+   GL               H+   F   +  +G+  + V++ YL
Sbjct: 196 GSAFVYGQFDGILGLAYDGLAV------------NHIVPPFYEAV-HQGLLDEPVFAFYL 242

Query: 314 NSP---DAHNGSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQX 370
           +     D+  G ++FG  D++KF G +  +P++         +   ++V L  + L +Q 
Sbjct: 243 SDEKKGDSLAGEVVFGGYDETKFTGEISWLPVI---------RKAYWEVELNSITLGSQK 293

Query: 371 XXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIV 430
                        LD+G++    P +L +      GA    +  + +  C S      + 
Sbjct: 294 FQLQNYG----GALDTGTSFITFPSELYQEFVSKTGATVDPDDGHIIAPC-SGSGFPDLT 348

Query: 431 FNFGGFNIETNLTTYTTPISSDTCVLRILP----SGDSSAILGDAFLVHAYVVYDLEDFE 486
           F   G +   + + Y       TC + I P          I+GD FL   Y +YDL    
Sbjct: 349 FELAGRSFTISSSDYVVQWDDTTCAVAITPLDLGGAGKMVIIGDVFLRRWYSIYDLSKNA 408

Query: 487 ISMAQA 492
           + +A++
Sbjct: 409 VGLAKS 414

 Score = 34.7 bits (78), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 27/47 (57%), Gaps = 3/47 (6%)

Query: 75  NFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKKR 121
           N Y  ++ +G+P Q   V++DTGSS+LW+    N  C S +  +  R
Sbjct: 99  NQYYSEIGLGTPPQSFKVVMDTGSSNLWVP---NKNCVSEACLNHAR 142

>YDR349C Chr4 complement(1172386..1174176) [1791 bp, 596 aa] {ON}
           YPS7Putative GPI-anchored aspartic protease, member of
           the yapsin family of proteases involved in cell wall
           growth and maintenance; located in the cytoplasm and
           endoplasmic reticulum
          Length = 596

 Score = 77.4 bits (189), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 130/289 (44%), Gaps = 41/289 (14%)

Query: 238 RDHIEL--GSLNISDVSMAVANDTN-STVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNF 294
           RD+++   GSL+IS+VS      +N  T G+LG+         + D S  +   +  S  
Sbjct: 161 RDNVQFNSGSLSISNVSFFDIQSSNFKTSGLLGLSGKVTNPGNAIDSSQYTEQSYFLS-- 218

Query: 295 PMVLKERGITKKNVYSLYL----------NSPDAHNGSILFGAVDKSKFDGSL------- 337
             +LK+  I + + YSL+L            P ++ G +L G VD S F G+L       
Sbjct: 219 --LLKDADIIESSSYSLWLAGDTSTYKTYRDPISNCGKLLLGGVDPSLFTGTLGKFDLIP 276

Query: 338 YTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDL 397
           Y  P+ N      V  PI     +  +  S Q           PALLDS S+++YLP   
Sbjct: 277 YVDPVSNAVS---VGYPIVPLGPIYIVSNSGQSLNMTSKDFLSPALLDSTSSVSYLPTST 333

Query: 398 LEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNL-----TTYTTPISS- 451
           +  +A  + A + E+L+ +L+ C        + F      IE  L     +TY T  +S 
Sbjct: 334 IIQIAVQIAATYVESLDRWLVQCSIADMGVSLGFRLRELTIEIPLRDLLSSTYDTSTNSS 393

Query: 452 -------DTCVLRILPSGDSSA-ILGDAFLVHAYVVYDLEDFEISMAQA 492
                  + C L +  + ++   ILG+AF+ + Y+  DLED  I++AQA
Sbjct: 394 MFFSSGQEACFLTLYANTNTGVNILGEAFIKNIYMAMDLEDNTIAIAQA 442

>Ecym_1324 Chr1 complement(662306..664036) [1731 bp, 576 aa] {ON}
           similar to Ashbya gossypii ACR150W
          Length = 576

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 82/297 (27%), Positives = 128/297 (43%), Gaps = 43/297 (14%)

Query: 227 GDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSMVSG 286
           GD +    +W   H    +L+I + S   A  +N   G LG+G   L  T        S 
Sbjct: 142 GDPTNTQVQWFGKH----TLSIPEFSFFRAEHSNIVDGSLGLGARILSGTAEDSSGFDSS 197

Query: 287 DRHMYSNFPMVLKERGITKKNVYSLYLNSPDA----------HNGSILFGAVDKSKFDGS 336
              +      +LK     K   YS++L + ++            G++L GAVD + F G+
Sbjct: 198 FFFL-----DMLKNANFIKSTSYSIWLGNDNSTLNASRLASSDVGTLLLGAVDPNYFIGN 252

Query: 337 LYTIPILNVYKSRGV----SQPIQFDVTLQGLGLSNQXXXXXXXXXK---IPALLDSGST 389
            Y   +L    S+      S PI   V L  + + N               P LLD   T
Sbjct: 253 FYRFKMLPFRDSKTETTFNSLPI---VPLTKVDIVNAKGTAVNVTQPGFMEPVLLDPRYT 309

Query: 390 LAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNLTTYT--- 446
           ++YLP +L+  +A    A + ++L+ +L+DC   + + KI F FG   I+  L+ +    
Sbjct: 310 ISYLPIELILQIAMQTNAVYVKSLDLWLVDCDVANFDAKIRFQFGDLKIDVPLSHFVSSG 369

Query: 447 ---TPISSD-------TCVLRILPSGDSS-AILGDAFLVHAYVVYDLEDFEISMAQA 492
              +PI+S        TC L + P+  S  +ILG  FL   Y+  DLE   ++MAQA
Sbjct: 370 YVGSPIASTQLGASNMTCQLNVYPNYSSGFSILGGTFLRSVYLSVDLEGNSVAMAQA 426

>KLLA0F22088g Chr6 (2064310..2065986) [1677 bp, 558 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 558

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 82/300 (27%), Positives = 140/300 (46%), Gaps = 45/300 (15%)

Query: 244 GSLNISDVSMAVANDTNSTV-GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERG 302
           G L I+  S  +AN+T S V G LG+  P +    S   S ++ D   Y  F   LK  G
Sbjct: 146 GWLTINSTSFILANETGSLVHGALGLSGP-ISVPASDSVSSLNFDDSYY--FLTHLKNAG 202

Query: 303 ITKKNVYSLYLNSPDAHN----------GSILFGAVDKSKFDGSLYT---IPILNV---Y 346
           + + + YSL++N+   H+          G++L G+VD   +DG L +   IP  +    Y
Sbjct: 203 VIETSSYSLWVNNASNHSVDGQINRANAGTLLLGSVDPKYYDGDLISFGSIPFKDESSGY 262

Query: 347 KSRGVSQPIQFDVTLQGLGLSN---QXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVAD 403
            S G   PI   V +  + ++N   +           P  + S    +YLP  L+  V+ 
Sbjct: 263 LSTGY--PI---VPMSRVSIANSEQEAVNLTDSSFLQPVFIHSRYLYSYLPLSLIIQVSI 317

Query: 404 GLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNLT-----TYTTPISS------- 451
              A + E+L+ +L+ C      + ++F FG  NI          TY    +S       
Sbjct: 318 QTNAVYVESLDRWLVACDIGDMGSNLIFEFGNLNISVPTVDFLGATYNMYSNSSLRFTNG 377

Query: 452 -DTCVLRILPS-GDSSAILGDAFLVHAYVVYDLEDFEISMAQANFDVNHEDIEVVSSSIP 509
            + C L++ P+   S ++LG +F+ +AY+V+D+++  I++AQA  D   E +E  +++ P
Sbjct: 378 KEACYLKMYPNYATSFSVLGQSFIKNAYIVHDVDNSNIALAQAASD---EAVEKAANNSP 434

>Skud_4.618 Chr4 complement(1101382..1103142) [1761 bp, 586 aa] {ON}
           YDR349C (REAL)
          Length = 586

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 82/285 (28%), Positives = 126/285 (44%), Gaps = 39/285 (13%)

Query: 240 HIELGSLNISDVSMAVANDTN-STVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVL 298
             E GSL+IS+VS      +N  + G+LG  L G  T   +D  + S     YS F  +L
Sbjct: 155 QFESGSLSISNVSFFNIESSNFKSSGLLG--LSGKVTNPGTD--IDSSQYTEYSYFLSLL 210

Query: 299 KERGITKKNVYSLYL----------NSPDAHNGSILFGAVDKSKFDGSL-------YTIP 341
           K+    +   YSL+L            P  + G +L G VD S F G+L       Y  P
Sbjct: 211 KDANFIESPSYSLWLAGDTSTYKTYRDPILNCGKLLLGGVDPSLFTGTLGQFDLIPYADP 270

Query: 342 ILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMV 401
           + N      +  PI     +  +  S +           PALLDS S+++YLP   +  +
Sbjct: 271 VTNAIT---IGYPIVPLGPIYIVSNSGESLNMTSKDFLSPALLDSTSSVSYLPTSTIIQI 327

Query: 402 ADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNL-----TTYTTPISS----- 451
           A  + A + E+L+ +L+ C        + F      IE  L     +TY T  +S     
Sbjct: 328 AVQIAATYVESLDRWLVQCSMADMGVTLAFRLRDLFIEIPLRDLLSSTYDTSTNSSMLFS 387

Query: 452 ---DTCVLRILPSGDSSA-ILGDAFLVHAYVVYDLEDFEISMAQA 492
              + C L +  + ++   ILG+AF+ + Y+  DLED  I++AQA
Sbjct: 388 SGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIAIAQA 432

>Kwal_55.20034 s55 (223867..225648) [1782 bp, 593 aa] {ON} YDR349C
           (YPS7) - GPI-anchored aspartic protease [contig 157]
           FULL
          Length = 593

 Score = 73.2 bits (178), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 94/209 (44%), Gaps = 19/209 (9%)

Query: 303 ITKKNVYSLYLNSPDAHN-GSILFGAVDKSKFDGSLYTIPILNVYKSR-GVSQ---PIQF 357
           + +   YS  L+S    N G ++FG VD+S + G L  I  L  Y  R GV+    PI  
Sbjct: 222 VIESYAYSSALDSVAVENCGILIFGGVDRSLYTGDLVKIDTLPYYNVRTGVTSRGYPIVP 281

Query: 358 DVTLQGLGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYL 417
            V +     S Q           P LLD+     YLP DL+  +A    A + E+LN +L
Sbjct: 282 LVKVDVKSKSGQVKNLTSEYFLEPVLLDTRYRYNYLPLDLIVKIATQANAYYVESLNRWL 341

Query: 418 MDCPSKHDETKIVFNFGGFNIETNLTTYTTPISSDT-------------CVLRILPSGD- 463
           + C        I+F+FG   I+  L+    P    T             C LR LP+ D 
Sbjct: 342 LACDVGKLGASILFDFGEVVIDVPLSDLMGPTYDSTTNGTLYFSNADQACELRFLPNSDL 401

Query: 464 SSAILGDAFLVHAYVVYDLEDFEISMAQA 492
             +ILG  F+ + Y+  +L+  ++++AQA
Sbjct: 402 GFSILGGPFIKNVYLAAELQSNQVALAQA 430

>Smik_4.613 Chr4 complement(1098592..1100382) [1791 bp, 596 aa] {ON}
           YDR349C (REAL)
          Length = 596

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 79/285 (27%), Positives = 128/285 (44%), Gaps = 33/285 (11%)

Query: 237 GRDHIELGSLNISDVSMAVANDTN-STVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFP 295
           G      GSL+IS+VS      +N  T G+LG+         ++D S  +   +  S   
Sbjct: 162 GNVQFNSGSLSISNVSFFSVESSNFKTSGLLGLSGKITNPGSAADSSHYTEQSYFLS--- 218

Query: 296 MVLKERGITKKNVYSLYL----------NSPDAHNGSILFGAVDKSKFDGSLYT---IPI 342
            +LK+  + +   YSL+L            P  + G +L G VD S F G+L     IP 
Sbjct: 219 -LLKDVNLIESPSYSLWLAGDTSTYQTHRDPIYNCGKLLLGGVDPSLFTGTLGKFDLIPY 277

Query: 343 LN-VYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMV 401
           ++ V  +     PI     +  +  S Q           PALLDS S+++YLP + +  +
Sbjct: 278 VDPVSSAVSTGYPIVPLGPIYIVSNSGQSLNMTSKDFLSPALLDSTSSVSYLPTNTIIQI 337

Query: 402 ADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNL-----TTYTTPISS----- 451
           A  + A + E+L+ +L+ C   +    + F      IE  L     +TY T  +S     
Sbjct: 338 AVQIAATYVESLDRWLVQCSMANMGVSLGFTLRELVIEIPLRDLLSSTYDTSTNSSMFFS 397

Query: 452 ---DTCVLRILPSGDSSA-ILGDAFLVHAYVVYDLEDFEISMAQA 492
              + C L +  + ++   ILG+AF+ + Y+  DLED  I++AQA
Sbjct: 398 SGQEACFLTLYANTNTGLNILGEAFMKNIYMAMDLEDNTIAIAQA 442

>KLTH0E02596g Chr5 (235803..237593) [1791 bp, 596 aa] {ON} weakly
           similar to uniprot|Q66RD4 Saccharomyces cerevisiae
           YDR349C YPS7 Putative GPI-anchored aspartic protease
           located in the cytoplasm and endoplasmic reticulum
          Length = 596

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/202 (30%), Positives = 90/202 (44%), Gaps = 24/202 (11%)

Query: 313 LNSPDAHNG--SILFGAVDKSKFDGSLY---TIPILNVYK---SRGVSQPIQFDVTLQGL 364
           L SP+  NG   ++FGAVD S + G      TIP  N      SRG   PI     +   
Sbjct: 231 LESPEPSNGCGKVIFGAVDTSLYTGDFVKFDTIPFHNARTGETSRGY--PIIPLTKVNVQ 288

Query: 365 GLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKH 424
             S +           P L+DS     YLP +++  +A    A + E+LN +L+ C    
Sbjct: 289 SKSGETKNMTSDSFLEPVLIDSRFRYNYLPLEIIVQIAMQANAYYVESLNRWLLACDVGR 348

Query: 425 DETKIVFNFGGFNIETNLTTYTTP-ISSDT------------CVLRILPSGDSS-AILGD 470
               I+F FG  +I   L     P   SDT            C L++LPS  S   +LG 
Sbjct: 349 LGASIIFEFGNLSINVPLNNLMGPTFDSDTNGTLHFSNKQQACELKLLPSTASGFNVLGG 408

Query: 471 AFLVHAYVVYDLEDFEISMAQA 492
           AF+ + Y+  +LE  ++++AQA
Sbjct: 409 AFIKNVYMAAELESNQVALAQA 430

>Suva_2.520 Chr2 complement(929574..931370) [1797 bp, 598 aa] {ON}
           YDR349C (REAL)
          Length = 598

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 95/206 (46%), Gaps = 29/206 (14%)

Query: 316 PDAHNGSILFGAVDKSKFDGSL-------YTIPILNVYKSRGVSQPIQFDVTLQGLGLSN 368
           PD   G +L G VD S F G+L       Y  P+ NV  +     PI     +  +  S 
Sbjct: 251 PDC--GKLLLGGVDPSLFTGTLGKFDLIPYVDPVSNVVST---GYPIVPLGPIYIISNSG 305

Query: 369 QXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETK 428
           Q           PALLDS S+++YLP   +  +A  + A + E+L+ +L++C        
Sbjct: 306 QSMNMTSKDFLSPALLDSTSSVSYLPTSTIIQIAVQIAATYVESLDRWLVECSMADMGVT 365

Query: 429 IVFNFGGFNIETNL-----TTYTTPISS--------DTCVLRILPSGDSSA-ILGDAFLV 474
           + F F    I+  L     +TY T  +S        + C L +  + ++   ILG+AF+ 
Sbjct: 366 LGFMFRSLTIKIPLSDLLSSTYDTTTNSSMFFSSGQEACFLTLYANTNTGVNILGEAFMK 425

Query: 475 HAYVVYDLEDFEISMAQANFDVNHED 500
           + Y+  DLED  I++AQA    N ED
Sbjct: 426 NIYMAVDLEDNSIAIAQAK---NIED 448

>NDAI0C04610 Chr3 complement(1052297..1054126) [1830 bp, 609 aa]
           {ON} Anc_5.401 YDR349C
          Length = 609

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 75/284 (26%), Positives = 123/284 (43%), Gaps = 35/284 (12%)

Query: 241 IELGS--LNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMVL 298
           I LG+  L +S+VS   A+DT     +  +GL G  T   +D    + D     +F   L
Sbjct: 154 INLGTNYLGVSNVSFINADDT-VPYAMGSLGLSGKITGTGTDIDSSNFDNSY--DFLDRL 210

Query: 299 KERGITKKNVYSLYLNSPDAHNGS------------ILFGAVDKSKFDGSLYTIPILNVY 346
            +  +   + YSL+L     +NG+            ++ GAVD + F GS     +L   
Sbjct: 211 YQTNLIDSHSYSLWLAMNQTYNGTRVQNSVTSSFGKLILGAVDPTLFTGSFLQFEMLPAL 270

Query: 347 KSRGVSQPIQFDVTLQG----LGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMVA 402
           +S   ++ I + +   G    +  S +           P  LDS  T  YLP +++  VA
Sbjct: 271 ESDSATETIGYPIIPMGPIYVVSKSGEMANVTSKDFLEPVFLDSTYTSTYLPLNMIIQVA 330

Query: 403 DGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNL-----TTYTTPISS------ 451
             +GA + E+L  +L+ C   +    + F F   +I   L     TTY +  ++      
Sbjct: 331 IQIGAMYVESLERWLVPCNIANQHATLDFTFQDVSIRVPLTDLLGTTYDSSTNTSMHFST 390

Query: 452 --DTCVLRILPSGDSSA-ILGDAFLVHAYVVYDLEDFEISMAQA 492
             + C L+I  +  +   ILG  FL H Y+  DL+   I++AQA
Sbjct: 391 GDEACYLKIFSNQMTGYNILGRPFLKHVYMAVDLDGNNIAIAQA 434

>Suva_62.1 Chr62 complement(3..758) [756 bp, 252 aa] {ON} YIR039C
           (REAL)
          Length = 252

 Score = 64.7 bits (156), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 48/76 (63%), Gaps = 7/76 (9%)

Query: 201 CSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTN 260
           CS +GTF+ N SST+K N T F+++YG        +G D + LG++ +S+ +  V+NDT 
Sbjct: 165 CSYWGTFNPNISSTFKYNETIFDLTYG-------TYGTDVVSLGNITLSNYTFGVSNDTT 217

Query: 261 STVGVLGIGLPGLETT 276
            + G+LGI LP  E T
Sbjct: 218 MSYGILGISLPSEEIT 233

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 27/37 (72%)

Query: 77  YSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKS 113
           Y V++++G+P Q   + LDTGSSD+ +  +D+ +CKS
Sbjct: 94  YVVEMQIGTPPQTAYLELDTGSSDMCVNEADSAHCKS 130

>ACR143W Chr3 (601369..602550) [1182 bp, 393 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL154C (PEP4);
           Tandem gene duplication in this genome
          Length = 393

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 69/308 (22%), Positives = 124/308 (40%), Gaps = 50/308 (16%)

Query: 201 CSRYGTFDKNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSM----AVA 256
           C     +    SST+K+ +    + Y  G  A      D +      I +       A+ 
Sbjct: 119 CRTRNRYRSGASSTFKATDKTLRLQYVKGD-AKARVSYDTLYFAGAKIENQGFGEAEAIG 177

Query: 257 NDTNSTV--GVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMV--LKERGITKKNVYSLY 312
           +D +     G++GIG P +                 Y   P +  L + G  K  ++ +Y
Sbjct: 178 DDFSGARFDGIIGIGYPSIG----------------YGIKPPINTLIDSGGLKDPMFGIY 221

Query: 313 LNSPDAHN---GSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQ 369
           +++    N   G I+ G  +  KF G +  +P+L         +   ++  L    + N 
Sbjct: 222 ISNAQNRNSPVGEIVLGGYNTQKFKGDIKWLPVL---------RKAFWETDLSAFKVGN- 271

Query: 370 XXXXXXXXXKIPALLDSGSTLAYLPEDLL-EMVADGLGARFSENLNYYLMDCPSKHDETK 428
                     + A+ D+GS+   +PED   + V+   GA   +  +Y  +DC + +    
Sbjct: 272 ---FALDVQGLTAVFDTGSSFIIMPEDTYTDFVSQFPGASHDDGTDY--VDCSTVNSGPD 326

Query: 429 IVFNFGGFNIETNLTTYTTPISSDTCVLRILPSGDS----SAILGDAFLVHAYVVYDLED 484
           +  +FGG  ++ +   Y   +  +TC+L +  SG+S      ILGD FL   Y +Y+  D
Sbjct: 327 LTLDFGGVALKLSARDYVMQLGRNTCILAV--SGNSRVTGEVILGDTFLRRYYTIYNFGD 384

Query: 485 FEISMAQA 492
             I +A A
Sbjct: 385 NTIGVASA 392

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 64  GEYELSLRNRQNF-YSVDLEVGSPSQKITVLLDTGSSDLWITGSDNPYCKSNSHSSKKR 121
           G++  ++ N +NF YSVD+ +G+P+Q   V LDTGSS LWI  SD   C S    ++ R
Sbjct: 69  GKFSANVYNFENFQYSVDITLGTPAQNFRVALDTGSSLLWIP-SDR--CTSQICRTRNR 124

>ACR150W Chr3 (614407..616068) [1662 bp, 553 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR349C (YPS7)
          Length = 553

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 101/224 (45%), Gaps = 30/224 (13%)

Query: 298 LKERGITKKNVYSLYLNSPDAHN----------GSILFGAVDKSKFDGSLY------TIP 341
           +++ G+     YSL+  + +             G+++ GAVD   + G+ Y      ++ 
Sbjct: 196 MRDAGLISSRSYSLWFGNDNTSAVDLPTVLEDIGTLMLGAVDPRLYYGNFYQYDGVPSVD 255

Query: 342 ILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEMV 401
           I +   +RG   PI     +Q LG   +           P LL+S    ++LP+ +++ +
Sbjct: 256 IASGQHTRG-GYPIVPLTRVQLLGTEGRQLNLTDDTFAEPVLLNSRFMTSFLPKSIVQQI 314

Query: 402 ADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIE---------TNL---TTYTTPI 449
           A    A F+++ N  +++C    +E    F+FG   +E         TNL   T+   P 
Sbjct: 315 ARQTNAVFTKSSNRLIVECSLLKEEASFRFHFGELVVEVPLSDFIGPTNLRAGTSILAPD 374

Query: 450 SSDTCVLRILPS-GDSSAILGDAFLVHAYVVYDLEDFEISMAQA 492
           +++TC L+++PS G   ++LG   L   Y+  D E   + MA A
Sbjct: 375 TNETCYLKLMPSTGMGFSMLGMPILRKLYIAADTESGAVGMALA 418

>TDEL0E02230 Chr5 (427831..429552) [1722 bp, 573 aa] {ON} Anc_5.401
           YDR349C
          Length = 573

 Score = 61.6 bits (148), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 100/228 (43%), Gaps = 35/228 (15%)

Query: 298 LKERGITKKNVYSLYLNSPD-------------AHNGSILFGAVDKSKFDG---SLYTIP 341
           L   GI K   YSL+  +               A  G ++ GAVD S + G   S   IP
Sbjct: 199 LMNLGIIKTPSYSLWFGADTVPYDRRKLASGTMADCGKLILGAVDPSLYTGILRSFKMIP 258

Query: 342 ILN-VYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEM 400
            ++ V +++  + PI    T+     + +           P LLDS  +  YLP D +  
Sbjct: 259 FIDPVSQAQSNNYPILPLGTIYINSANGKSLNMTSEEFVEPVLLDSRYSTTYLPIDAIVQ 318

Query: 401 VADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNL-----TTYTTPISS---- 451
           +A  +GA F E+L+ +L+ C     +  + F FG   I   L     TTY  P S+    
Sbjct: 319 IAVQIGATFVESLDKWLVACSVAKLDVSLDFTFGNIEIRVPLEDFLVTTY-DPKSNTSLH 377

Query: 452 -----DTCVLRILPSGDSSA--ILGDAFLVHAYVVYDLEDFEISMAQA 492
                + C L ++ S D +   +LG  FL + Y+  D+ED  I++AQA
Sbjct: 378 FSTGEEACFLAMV-SKDKTGYNVLGGPFLKNLYMAVDIEDSSIAIAQA 424

>YGL258W-A Chr7 (9162..9395) [234 bp, 77 aa] {ON} Putative protein
           of unknown function
          Length = 77

 Score = 53.9 bits (128), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 28/54 (51%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 296 MVLKERG-ITKKNVYSLYLNSPDAHNGSILFGAVDKSKFDGSLYTIPILNVYKS 348
           M  + +G I KK  YSL+LN P+ H GSILFGAVDKSK+   L T P+   Y +
Sbjct: 1   MAFERQGKIEKKISYSLFLNGPNVHFGSILFGAVDKSKYAEELCTHPMRQAYNT 54

>KAFR0E04080 Chr5 (818320..820110) [1791 bp, 596 aa] {ON} Anc_5.401
           YDR349C
          Length = 596

 Score = 60.1 bits (144), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 71/286 (24%), Positives = 120/286 (41%), Gaps = 39/286 (13%)

Query: 238 RDHIELGSLNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSMVSGDRHMYSNFPMV 297
            DH+ + +++  D + A    T+   GVLG+G     +  SS++   SG+          
Sbjct: 186 NDHLWVKNVSFLDSTTA----TSLYSGVLGLG----GSITSSNEYENSGNYDSSYFIFNK 237

Query: 298 LKERGITKKNVYSLYLNSPDAH-------------NGSILFGAVDKSKFDGSLYTIPILN 344
            KE  IT+ N YSL+L   ++               G +L G +D + + GSLY   ++ 
Sbjct: 238 FKEANITQSNSYSLWLVEDESSLTTTSTKFEEEGTFGKLLLGVIDPALYRGSLYQFDMIP 297

Query: 345 VYKSRGVSQPIQFDVTLQGL----GLSNQXXXXXXXXXKIPALLDSGSTLAYLPEDLLEM 400
                 +     + +   G+      S             P LLDS     YLPE+ +  
Sbjct: 298 YVDPESLVSSQGYPILPMGVIYVKSESGARLNVTSKDFLEPVLLDSSQQGNYLPENAIIQ 357

Query: 401 VADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIET---NLTTYTTPISSDT---- 453
           +A  +GA + E+++ +L+ C        ++F F G  I+    NL T T    S++    
Sbjct: 358 IAIQIGATYIESMDRWLVSCDMASYGASVLFTFDGLEIDVPLENLLTNTFETGSNSSIYY 417

Query: 454 ------CVLRILPSGDSSA-ILGDAFLVHAYVVYDLEDFEISMAQA 492
                 C L I  + +    +LG AF  + Y+  DLE   +++AQA
Sbjct: 418 SDGETACALTIYDNANMGYNLLGSAFFRNTYIAVDLEGNTVAIAQA 463

 Score = 32.0 bits (71), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 26/53 (49%), Gaps = 8/53 (15%)

Query: 71  RNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSD--------NPYCKSNS 115
           +N Q  Y V+  VG P Q+ +++LDT    LW+   +        N  C +NS
Sbjct: 68  KNLQGRYYVNASVGEPQQEQSLVLDTTEPYLWVISGNVEMNCTDTNNVCNANS 120

>ZYRO0A06578g Chr1 (533368..535530) [2163 bp, 720 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 720

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 81/315 (25%), Positives = 132/315 (41%), Gaps = 48/315 (15%)

Query: 209 KNQSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGI 268
           KNQSS +  NNT       DGS   G     H    SL +S+ S    NDT S+ GVLG+
Sbjct: 265 KNQSS-HTINNTQ-----NDGS---GALYNSH----SLTLSNSSFFEINDTTSSKGVLGL 311

Query: 269 GLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYL------------NSP 316
           G    +     D S       +  +    L++ GI +   YSL+L            N P
Sbjct: 312 GGKINDKGTDIDSSQFDSSFFLLES----LRDNGIIESLSYSLWLGGDTRPYYDVGRNVP 367

Query: 317 DAHN-GSILFGAVDKSKFDGSLYTIPILNVYKSR----GVSQPIQFDVTLQGLGLSNQXX 371
           D  N G ++ G VD   + G L     L    SR        P+    T+  +  +    
Sbjct: 368 DEINCGKLILGGVDPYYYSGPLKKFNNLIFLDSRTDMLSRGYPVLPMRTINVVSATGNSI 427

Query: 372 XXXXXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVF 431
                    P LLDS  + ++LP + +  +A  + A + + ++ +++ C        I F
Sbjct: 428 NVTNENFLTPVLLDSRYSFSHLPAETIVQIAVQVNAIYMKEVDMFVVSCKIADMGVNIQF 487

Query: 432 NFGGFNIETN-----LTTYTTPISS--------DTCVLRILPSGDSS-AILGDAFLVHAY 477
            FG  +I+       ++T+    +S        + C + ++ S ++   ILG +FL + Y
Sbjct: 488 EFGDVSIDVPFKDFLMSTHNPETNSTMKFSGGDEACFMTMVSSEETGFNILGTSFLRNVY 547

Query: 478 VVYDLEDFEISMAQA 492
           +  D +D  I++AQA
Sbjct: 548 LAVDHDDQSIAIAQA 562

>CAGL0A02431g Chr1 complement(261812..263575) [1764 bp, 587 aa] {ON}
           similar to uniprot|Q06325 Saccharomyces cerevisiae
           YDR349c YPS7
          Length = 587

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 112/263 (42%), Gaps = 30/263 (11%)

Query: 272 GLETTYSSDQSMVSGDRHMYSNFPM-VLKERGITKKNVYSLYLNS---------PDAHN- 320
           GL  T +SD  +  GD   +S F +  LKE  +   + YSL+L S          DA+  
Sbjct: 178 GLGGTLNSDTEL-EGDFINHSFFFLDALKEARLINSSSYSLWLGSQKRNGFADTSDANEA 236

Query: 321 GSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQG----LGLSNQXXXXXXX 376
           G ++FGAVD +  +G      ++     +       + V   G       S +       
Sbjct: 237 GYLIFGAVDPNLVEGEFRKFDMIPYIHPQTGKVAYGYPVVPMGPIYITSSSGRSLNVTTD 296

Query: 377 XXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGF 436
               P LLD    L+YLP   +  +A  + A + E+L+ +L+ C        + F+FG  
Sbjct: 297 GFSAPVLLDPSFALSYLPTKAIIQIAIQIAAVYVESLDLWLVSCDVASSGATVDFSFGDL 356

Query: 437 NIETNL-------------TTYTTPISSDTCVLRILPSGDSSA-ILGDAFLVHAYVVYDL 482
            I+  L             TT       + CVL++ P+  +   +LG AF+ +AY+  DL
Sbjct: 357 TIKVPLSDLLASTHDQSTNTTLHFNTGQEACVLQLYPNTFTGYNVLGQAFMKNAYLAVDL 416

Query: 483 EDFEISMAQANFDVNHEDIEVVS 505
           E   ++M QA    + E  E+++
Sbjct: 417 EGKGVAMGQAANFKSGERKEIIT 439

>Smik_67.1 Chr67 (653..982) [330 bp, 110 aa] {ON} YGL259W (REAL)
          Length = 110

 Score = 52.0 bits (123), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 50  LGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNP 109
           +G +D     KRDD     +L N    Y V +E+G+P Q   + LDTGSSD+++  +D+P
Sbjct: 41  MGSQDVSNVFKRDD-VLNSTLINAVGMYVVKVEIGTPPQTAYLQLDTGSSDMYVNDADSP 99

Query: 110 YCKSNSHSS 118
           YC   S+ S
Sbjct: 100 YCVLMSYGS 108

>TPHA0E01920 Chr5 (393982..395856) [1875 bp, 624 aa] {ON} Anc_5.401
           YDR349C
          Length = 624

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 84/193 (43%), Gaps = 22/193 (11%)

Query: 321 GSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGL------SNQXXXXX 374
           G+++ GAVD+  ++G L    +L    +  V++ + + + +  +G       S       
Sbjct: 249 GNLVLGAVDQRYYEGRLVQFDMLPALLNN-VTEAVTYGLPIIPMGPIYIENSSGTQLNLT 307

Query: 375 XXXXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFG 434
                 P LLDS  T A LP + +  +A  L A + E    ++++C        + FNF 
Sbjct: 308 TTNFLEPVLLDSRYTNARLPLNTVIQIATQLNAAYVEEFGSWIVECSLAEMNVNLNFNFQ 367

Query: 435 GFNIETNL---------TTYTTPI-----SSDTCVLRILPSGDSS-AILGDAFLVHAYVV 479
           G  I  +L         +T   PI     S D C L + P+ D    ILG  FL + Y+ 
Sbjct: 368 GLTIPVSLNDFLSRVINSTTGEPIKFSESSEDACALAVYPNTDIGFNILGGPFLKNIYLA 427

Query: 480 YDLEDFEISMAQA 492
            D E   +++A+A
Sbjct: 428 IDNEGRSVAIAKA 440

>NCAS0F03150 Chr6 complement(630327..632264) [1938 bp, 645 aa] {ON}
           Anc_5.401 YDR349C
          Length = 645

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 95/234 (40%), Gaps = 33/234 (14%)

Query: 297 VLKERGITKKNVYSLYLNS---------------PDAHNGSILFGAVDKSKFDGSLYTIP 341
           +L E G+     YSL+L +               P  +NG +L G+VD S F    Y   
Sbjct: 215 MLAESGLIDSQSYSLWLGNGAERDTQLSSQRTPDPQYNNGKLLLGSVDPSLFKEPFYQFD 274

Query: 342 ILNVYKSRGVSQPIQFDVT-LQGLGLSNQXXXXXXXXXK---IPALLDSGSTLAYLPEDL 397
           +L         +   F V  +  + + ++         +    P LL+S     YLP + 
Sbjct: 275 VLPYVDPNTQIESFSFPVIPMNAIYIVSKTGTGTNVTSEDFLEPVLLNSNFRSNYLPLNS 334

Query: 398 LEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNLTTY-------TTPIS 450
           +  +A  +GA + E+L+ +L+ C   ++     F F   NI+  L  +       TT  S
Sbjct: 335 IIQIAIQVGATYVESLDRWLLPCSIANENVHFEFTFDKLNIKAPLIDFLESTFDSTTNTS 394

Query: 451 ------SDTCVLRILPSGDSS-AILGDAFLVHAYVVYDLEDFEISMAQANFDVN 497
                 S+ C L++ P+       LG  FL   Y+  + E   + MAQA  ++N
Sbjct: 395 MHFSDNSEACFLKLYPNTYVGFNALGRPFLKSVYLAVEQEGRIVGMAQAVQEMN 448

>KNAG0C05140 Chr3 (999304..1001100) [1797 bp, 598 aa] {ON} Anc_5.401
           YDR349C
          Length = 598

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 57/222 (25%), Positives = 104/222 (46%), Gaps = 33/222 (14%)

Query: 303 ITKKNVYSLYLN---------SPDAHNGSI----LFGAVDKSKFDGSLYTIPILNVYKSR 349
           + K   YSL+L          +PDA NGS+    + GAVD S ++G  +    ++  +  
Sbjct: 213 LIKSKSYSLWLGNCRRTIDTITPDADNGSVAGKLILGAVDPSLYEGEFFQFNTISYIEPS 272

Query: 350 GVSQPIQFDVTLQG-LGLSNQXXXXXXXXXKI---PALLDSGSTLAYLPEDLLEMVADGL 405
                  + +   G + +++Q         +    PALLDS    ++LP + +  +A  +
Sbjct: 273 HNLSTFGYPILPMGPIYMTSQAGRRLNMTSEQYLQPALLDSSFVGSFLPANTIIQIAIQI 332

Query: 406 GARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNLTTYTT----PISSDT-------- 453
           GA + E+LN +++ C        I F F G +I+  L+   T    P ++ T        
Sbjct: 333 GAIYIESLNRWVVPCSVASMGAHIDFTFDGLDIKVPLSDLLTSSKDPATNSTMHFAEGES 392

Query: 454 -CVLRILPSGDSSA--ILGDAFLVHAYVVYDLEDFEISMAQA 492
            C L +L S ++    +LG +F+ +AY+  DL+  ++++AQA
Sbjct: 393 ACFL-MLYSNNAMGFNVLGTSFIKNAYIAVDLDGTKVAIAQA 433

>SAKL0G07524g Chr7 (624810..626708) [1899 bp, 632 aa] {ON} similar
           to uniprot|Q66RD4 Saccharomyces cerevisiae YDR349C YPS7
           Putative GPI-anchored aspartic protease located in the
           cytoplasm and endoplasmic reticulum
          Length = 632

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 46/181 (25%), Positives = 79/181 (43%), Gaps = 18/181 (9%)

Query: 321 GSILFGAVDKSKFDGSLY---TIPILNV-YKSRGVSQPIQFDVTLQGLGLSNQXXXXXXX 376
           G ++ GAVD S + G      TIP  +V   +     PI     +     S Q       
Sbjct: 246 GKLVLGAVDPSLYTGDFVRFDTIPFHDVDTGATSFGYPIVPLTKVSVKASSGQTLNVTSP 305

Query: 377 XXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGF 436
               P LLD+    ++LP  L+  +A    A + E+L+ +L+ C        ++F F G 
Sbjct: 306 DFAEPVLLDTRYLYSFLPLKLIIQIAIQTNAYYVESLDRWLVSCSVGDLNASMIFEFNGL 365

Query: 437 NIETNLTTYTT----PISSDT---------CVLRILPS-GDSSAILGDAFLVHAYVVYDL 482
           +I+  +  + +     +S+ T         C L++ P+     ++LG AF+ +AY+  DL
Sbjct: 366 SIDVPIKDFLSNSYDSVSNSTLHFSNGNSACYLKMYPNYATGFSVLGAAFVKNAYIAADL 425

Query: 483 E 483
           E
Sbjct: 426 E 426

>Kpol_1059.33 s1059 (70588..72576) [1989 bp, 662 aa] {ON}
           (70588..72576) [1989 nt, 663 aa]
          Length = 662

 Score = 50.8 bits (120), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 77/301 (25%), Positives = 122/301 (40%), Gaps = 43/301 (14%)

Query: 225 SYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGIGLPGLETTYSSDQSMV 284
           SYG+ S      G   ++ G LNIS  SM+  +  NS  G L IG  GL     S  S +
Sbjct: 147 SYGNHS------GLVEVDHGHLNIS--SMSFFSTYNS--GGLSIGSLGLGGNVESRNSDL 196

Query: 285 SGDRHMYSNFPMV-LKERGITKKNVYSLYLN--------------SPDAHNGSILFGAVD 329
              ++  S F +  LKE G+ +   YSL+L               S ++  G ++ GAV+
Sbjct: 197 DSGQYDGSFFLLEELKEAGLIEGRGYSLWLGGDNTSLVEQEGTVYSSESIAGRLILGAVN 256

Query: 330 KSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQG----LGLSNQXXXXXXXXXKIPALLD 385
            +  DG   +  +L       +     + +   G    +  S             P LLD
Sbjct: 257 PNLIDGKFVSFNMLPYQNPDTLEMSNGYPILPMGPINIISKSGASLNMTSNNYLQPVLLD 316

Query: 386 SGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETNLTTY 445
           S  T + LP + +  +A  + A + E LN +++ C    +   + F+FG   I+  L  +
Sbjct: 317 SRYTNSRLPIEAIIQIAIQIDASYVEQLNSWVVSCSILKESVVLEFSFGPLRIKVPLKQF 376

Query: 446 -TTPISSDTCVLRILPSGDSSA-------------ILGDAFLVHAYVVYDLEDFEISMAQ 491
               I  DT   R L +GD +              ILG  F+   Y+  D E   I++ Q
Sbjct: 377 LKKAIDPDTGNARTLSNGDQACILSLYPNHDIGYNILGAPFMKSIYLAVDNEGGTIALGQ 436

Query: 492 A 492
           +
Sbjct: 437 S 437

>YGL259W Chr7 (8470..8967) [498 bp, 165 aa] {ON}  YPS5Protein with
           similarity to GPI-anchored aspartic proteases such as
           Yap1p and Yap3p
          Length = 165

 Score = 47.8 bits (112), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 50  LGKRDALPFVKRDDGEYELSLRNRQNFYSVDLEVGSPSQKITVLLDTGSSDLWITGSDNP 109
           +G +D     KR++     ++ N    Y V +E+G+P Q + + LDTGSSD+ +  +D  
Sbjct: 41  IGTQDVSTVFKRNE-VLNTTVINGIGVYVVKMEIGTPPQTVYLQLDTGSSDMIVNNADIA 99

Query: 110 YCKSNSHSS 118
           YCKS S  S
Sbjct: 100 YCKSMSDGS 108

>TBLA0H01680 Chr8 (385315..387144) [1830 bp, 609 aa] {ON} Anc_5.401
           YDR349C
          Length = 609

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/190 (25%), Positives = 78/190 (41%), Gaps = 18/190 (9%)

Query: 321 GSILFGAVDKSKFDGSLYTIPILNVY-KSRGVSQ---PIQFDVTLQGLGLSNQXXXXXXX 376
           G I+FG VD S  DG+  +  ++     S G++    PI     +  +  S +       
Sbjct: 266 GLIVFGGVDSSLIDGTFQSFTMIPYEDTSDGLTTSGYPILPMGPIYIIANSGRTLNLTTL 325

Query: 377 XXKIPALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGF 436
               P LLDS  T + LP   +  VA  L A + E+L+ +++ C          F+FG  
Sbjct: 326 DFLEPVLLDSRITNSRLPASFIIQVAIQLEAMYLESLDRWVVPCSLADYNVNFDFSFGSV 385

Query: 437 NIETNLTTYTTP-------------ISSDTCVLRILPSGDSS-AILGDAFLVHAYVVYDL 482
            I   L  +  P              + D C L + P+ D    ILG  FL +A +  D 
Sbjct: 386 RIRVPLEDFLVPSGLTGDNKTIHFSQNEDACYLAMYPNTDIGFNILGTPFLKNAVIAVDH 445

Query: 483 EDFEISMAQA 492
              +I++ +A
Sbjct: 446 SSSQIAIGKA 455

>Ecym_4614 Chr4 complement(1197114..1198559) [1446 bp, 481 aa] {ON}
           similar to Ashbya gossypii ABL123C
          Length = 481

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 40/134 (29%), Positives = 60/134 (44%), Gaps = 27/134 (20%)

Query: 379 KIPALLDSGSTLAYLPE-DLLEM-------VADGLGARFSENLNYYLMDCPSKHDETKIV 430
           K   ++DSGST   LP+ D L++       + DG         NY+ + C S  D T   
Sbjct: 306 KRSGIIDSGSTFLVLPKVDALDIHSYLPGSITDG---------NYFAVFCNSTVDLT--- 353

Query: 431 FNFGGFNIETNLTTYT-TPISSDT-----CVLRILPSG-DSSAILGDAFLVHAYVVYDLE 483
           F  G  N     ++Y   P    +     CV  I      SS ILGD F+ + Y V+D++
Sbjct: 354 FELGNKNWTIPASSYLGEPYQEGSKYYGYCVSNIEGQAIHSSWILGDVFIKNFYTVFDMD 413

Query: 484 DFEISMAQANFDVN 497
           + ++  A  N +VN
Sbjct: 414 NQQVGFALKNSNVN 427

>ABL123C Chr2 complement(164739..166223) [1485 bp, 494 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YPL154C
          Length = 494

 Score = 36.6 bits (83), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 79/313 (25%), Positives = 125/313 (39%), Gaps = 59/313 (18%)

Query: 211 QSSTYKSNNTAFEISYGDGSFASGEWGRDHIELGSLNISDVSMAVANDTNSTVGVLGI-- 268
            S++    ++ F I Y  G+ A G      + +  L I D    VA    S +    +  
Sbjct: 141 HSNSCTVTDSIFTIFYRSGT-AHGPLYTGTLSINGLKIQDFRFGVAIGVPSLLDAYALSG 199

Query: 269 --GLPGLETTYSSDQSMVSGDRHMYSNFPMVLKERGITKKNVYSLYLNSP------DAHN 320
             GLP   T   SD S+V           ++   + I KK+   L  + P      D +N
Sbjct: 200 IFGLPSDPT--DSDTSVVG----------LLQGSKLINKKSFSVLLSHIPSESRNLDDNN 247

Query: 321 GSILFGAVDKSKFDGSLYTIPILNVYKSRGVSQPIQFDVTLQGLGLSNQXXXXXXXXXKI 380
           G I+FG    + ++G L   P++   ++  +       +  + + L             I
Sbjct: 248 GLIVFGEPLGALYEGELSYTPLVPNPQNHWLVAIKAAYIGSERVELPTAKNPSIDKNIGI 307

Query: 381 PA-LLDSGSTLAYLP-EDLLEM-------VADG----LGARFSENLNYYLMDCPSKHDET 427
            + ++D+GSTL  LP ED L +       ++DG    +    SE ++  L    SKH+ T
Sbjct: 308 RSGIIDTGSTLVVLPQEDALALHSYFDDSISDGKNFAIYCNSSEPIHLEL----SKHNWT 363

Query: 428 KIVFNFGGFNIETNLTTYTTPISSDT-----CVLRILPSGD--SSAILGDAFLVHAYVVY 480
            +  NF G            P   D+     CV  I   GD  SS ILG+ FL   Y V+
Sbjct: 364 ILPSNFVG-----------EPYPKDSPYNGYCVSNI-QGGDISSSWILGEVFLQDLYTVF 411

Query: 481 DLEDFEISMAQAN 493
           D+E  ++  A  N
Sbjct: 412 DIEGRQVGFANRN 424

>SAKL0D01408g Chr4 (112123..113643) [1521 bp, 506 aa] {ON} weakly
           similar to uniprot|P07267 Saccharomyces cerevisiae
           YPL154C PEP4 Vacuolar aspartyl protease (proteinase A),
           required for the posttranslational precursor maturation
           of vacuolar proteinases; synthesized as a zymogen,
           self-activates
          Length = 506

 Score = 32.3 bits (72), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 54/126 (42%), Gaps = 25/126 (19%)

Query: 382 ALLDSGSTLAYLPEDLLEMVADGLGARFSENLNYYLMDCPSKHDETKIVFNFGGFNIETN 441
           +++DSG+TL  LP+     +    G   ++  N+ +M C S    T          +E +
Sbjct: 317 SIIDSGTTLLILPKQDALDIHTYFGNSITDGTNFAIM-CNSTQTLT----------LEFD 365

Query: 442 LTTYTTP--------ISSDT-----CVLRILPSG-DSSAILGDAFLVHAYVVYDLEDFEI 487
              +T P         S D+     CV  I     D + ILGD FL   Y V+D+E+  +
Sbjct: 366 NKNWTIPSEKYLGDKYSQDSAYYGYCVSNIQGLDIDDAWILGDVFLEGIYAVFDVENQRL 425

Query: 488 SMAQAN 493
             A+ N
Sbjct: 426 GFAEGN 431

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,840,407
Number of extensions: 2241132
Number of successful extensions: 6428
Number of sequences better than 10.0: 150
Number of HSP's gapped: 6189
Number of HSP's successfully gapped: 256
Length of query: 580
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 465
Effective length of database: 40,294,809
Effective search space: 18737086185
Effective search space used: 18737086185
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)