Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F10208g5.442ON33233216750.0
TDEL0D025905.442ON33033213470.0
SAKL0G02706g5.442ON33233212921e-180
YDR372C (VPS74)5.442ON34534712881e-179
KAFR0D050605.442ON32633212851e-179
Smik_4.6385.442ON34634612831e-178
Skud_4.6415.442ON34634612831e-178
Suva_2.5445.442ON34634612751e-177
Kwal_55.213995.442ON32933212581e-175
KLTH0F15884g5.442ON32933212441e-172
KNAG0B042005.442ON34434412251e-169
CAGL0A02926g5.442ON32833412191e-169
Kpol_1016.25.442ON32833412121e-168
KLLA0E02355g5.442ON32432912111e-168
TBLA0A064805.442ON33433912121e-167
NCAS0F034305.442ON33233312051e-167
Ecym_45135.442ON33333111891e-164
NDAI0B057205.442ON36536511771e-162
TPHA0J026105.442ON32933611351e-156
ACL165C5.442ON33132911211e-154
Kpol_1062.245.442ON2762648791e-118
TBLA0A027805.442ON3872968111e-106
NCAS0H020905.442ON3452735338e-65
KLLA0E17425g3.211ON2493148731.8
SAKL0E09394g2.217ON898219686.6
KAFR0C051107.39ON89174678.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F10208g
         (332 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {O...   649   0.0  
TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.44...   523   0.0  
SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {O...   502   e-180
YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}...   500   e-179
KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON...   499   e-179
Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {...   498   e-178
Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {...   498   e-178
Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON...   495   e-177
Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C...   489   e-175
KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highl...   483   e-172
KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.4...   476   e-169
CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {O...   474   e-169
Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932...   471   e-168
KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {O...   471   e-168
TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON} Anc_5...   471   e-167
NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON...   468   e-167
Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {O...   462   e-164
NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa] ...   457   e-162
TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {O...   441   e-156
ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON} Synt...   436   e-154
Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON} (55671.....   343   e-118
TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.4...   317   e-106
NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {O...   209   8e-65
KLLA0E17425g Chr5 complement(1543158..1550639) [7482 bp, 2493 aa...    33   1.8  
SAKL0E09394g Chr5 complement(782108..784804) [2697 bp, 898 aa] {...    31   6.6  
KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7...    30   8.5  

>ZYRO0F10208g Chr6 complement(824737..825735) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/332 (96%), Positives = 320/332 (96%)

Query: 1   MSGLQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKXXXXXXX 60
           MSGLQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPK       
Sbjct: 1   MSGLQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKLTLMEEV 60

Query: 61  XXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDS 120
                RDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDS
Sbjct: 61  LLLGLRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDS 120

Query: 121 SKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGV 180
           SKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGV
Sbjct: 121 SKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGV 180

Query: 181 LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTI 240
           LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTI
Sbjct: 181 LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTI 240

Query: 241 ALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKE 300
           ALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKE
Sbjct: 241 ALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKE 300

Query: 301 VGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
           VGQELQQHPESTLQLEVLAGVFEVFSRMDMLL
Sbjct: 301 VGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332

>TDEL0D02590 Chr4 (497351..498343) [993 bp, 330 aa] {ON} Anc_5.442
           YDR372C
          Length = 330

 Score =  523 bits (1347), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/332 (77%), Positives = 287/332 (86%), Gaps = 2/332 (0%)

Query: 1   MSGLQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKXXXXXXX 60
           MS LQRRRVNRVDS   ++   +  E  E ++SK+VAYDPEE K+T+NV+ PK       
Sbjct: 1   MSNLQRRRVNRVDSGDESS--LQASEFNETTTSKRVAYDPEEAKITENVKNPKLTLMEEV 58

Query: 61  XXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDS 120
                RDKEGYLSFWNDNISYALRGCI+IELALRGKIR++DDSARKRFDVSERLIEV D+
Sbjct: 59  LLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRIIDDSARKRFDVSERLIEVVDA 118

Query: 121 SKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGV 180
           SKTGEVLLDE LQLMK DEPL+I NWIDLLSGETWN LKINYQLKQVRERLAKGLVDKGV
Sbjct: 119 SKTGEVLLDETLQLMKYDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 178

Query: 181 LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTI 240
           LRTEMKNFFLFDMATHPVTDTSCKEA+KRR+LSVLV RN+EL+YN+YF +  SFKLIRTI
Sbjct: 179 LRTEMKNFFLFDMATHPVTDTSCKEALKRRVLSVLVSRNMELSYNEYFPDTTSFKLIRTI 238

Query: 241 ALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKE 300
           ALICG+YRANVLENVLTSL YEKRD A+ RADEIL+Q+++YPFDLD  TESG+SINLNKE
Sbjct: 239 ALICGSYRANVLENVLTSLDYEKRDRALSRADEILEQYTQYPFDLDKATESGLSINLNKE 298

Query: 301 VGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
           V +EL Q+ +  LQLEV+AGVFEVFSRMDMLL
Sbjct: 299 VKEELSQNKDCPLQLEVVAGVFEVFSRMDMLL 330

>SAKL0G02706g Chr7 complement(222134..223132) [999 bp, 332 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 332

 Score =  502 bits (1292), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 247/332 (74%), Positives = 273/332 (82%)

Query: 1   MSGLQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKXXXXXXX 60
           MSGLQRRRVNR +S  +    T      E++  +KVAYDPEE KL +N  VPK       
Sbjct: 1   MSGLQRRRVNRTNSDYAEQPITSSDSNDENAKDRKVAYDPEEAKLKENTTVPKLTLMEEV 60

Query: 61  XXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDS 120
                +DKEGYLSFWNDNISYALRGCI+IELALR KIRV+DD ARKRFDVS+RLIEV D 
Sbjct: 61  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRDKIRVLDDPARKRFDVSDRLIEVIDG 120

Query: 121 SKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGV 180
           SKTGEVLLDEAL L+K DEPL I NWIDLLSGETWN LKINYQLKQVRERLAKGLVDKGV
Sbjct: 121 SKTGEVLLDEALNLIKNDEPLPIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 180

Query: 181 LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTI 240
           LRTEMKNFFLFDMATHP+TDTSCKEAIKRR+LSVLV RN+ELNYN+YFSE ++FK+IRT+
Sbjct: 181 LRTEMKNFFLFDMATHPITDTSCKEAIKRRVLSVLVSRNMELNYNEYFSENITFKIIRTL 240

Query: 241 ALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKE 300
           +LICGAY ANVLENVL SL Y+KRD A  RADEIL QFSE+PF LD  TESGIS+NLNKE
Sbjct: 241 SLICGAYGANVLENVLASLDYDKRDRAFSRADEILAQFSEFPFALDKATESGISVNLNKE 300

Query: 301 VGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
           V  E+ Q+P   LQLEV+AGVFEVFSRMD LL
Sbjct: 301 VQAEIAQNPGKDLQLEVVAGVFEVFSRMDTLL 332

>YDR372C Chr4 complement(1221112..1222149) [1038 bp, 345 aa] {ON}
           VPS74Protein required for Golgi localization of
           glycosyltransferases; binds the cytosolic domains of
           Golgi glycosyltransferases; binding to PtdIns4P required
           for Golgi targeting and function; tetramer formation
           required for function
          Length = 345

 Score =  500 bits (1288), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 248/347 (71%), Positives = 287/347 (82%), Gaps = 17/347 (4%)

Query: 1   MSGLQRRRVNRVDS-------SGSNNEPTRG-------LEAQEDS-SSKKVAYDPEEVKL 45
           MS LQRRRVNR DS       S +NN  T+G       ++  +D+ ++KK+AYDPEE KL
Sbjct: 1   MSTLQRRRVNRADSGDTSSIHSSANN--TKGDKIANIAVDGDDDNGTNKKIAYDPEESKL 58

Query: 46  TDNVEVPKXXXXXXXXXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSAR 105
            DN+ +P             RD+EGYLSFWND+ISYALRGCI+IELALRGKIR++DDSAR
Sbjct: 59  RDNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSAR 118

Query: 106 KRFDVSERLIEVTDSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLK 165
           KRFD+SERLIEV DSSKTGEVLLDE LQLMK DEPLSI+NWIDLLSGETWN LKINYQLK
Sbjct: 119 KRFDLSERLIEVIDSSKTGEVLLDETLQLMKNDEPLSISNWIDLLSGETWNLLKINYQLK 178

Query: 166 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYN 225
           QVRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEAIKRR+LSVLV RN+EL+YN
Sbjct: 179 QVRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYN 238

Query: 226 DYFSERVSFKLIRTIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDL 285
           +YF E  SFK+IRT+ALICG+Y ANVLENVLT+L YEKRD AI RA+EI+ QFS+YPFDL
Sbjct: 239 EYFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQYPFDL 298

Query: 286 DTQTESGISINLNKEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
           + +TE G+S+NLNKEV +E++ +P   LQLEV+AGVFEVFSRMDMLL
Sbjct: 299 EKETELGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 345

>KAFR0D05060 Chr4 complement(994966..995946) [981 bp, 326 aa] {ON}
           Anc_5.442 YDR372C
          Length = 326

 Score =  499 bits (1285), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 246/332 (74%), Positives = 273/332 (82%), Gaps = 6/332 (1%)

Query: 1   MSGLQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKXXXXXXX 60
           MS LQRRR NR DS+  ++E         +S  +KVAYDPEE KL DNV +PK       
Sbjct: 1   MSTLQRRRKNRSDSNADDSENV------SESQDRKVAYDPEEAKLRDNVSIPKLTLMEEV 54

Query: 61  XXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDS 120
                RD+EGYLSFWNDNISYALRGCI+IELALR KIR++DDSARKRFDVSERL+EV D 
Sbjct: 55  LLMGLRDREGYLSFWNDNISYALRGCILIELALRNKIRILDDSARKRFDVSERLVEVIDG 114

Query: 121 SKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGV 180
           SKTGEVLLDEALQLMK DEPL+I NWIDLLSGETWN LKINYQLKQVRERLAKGLVDKGV
Sbjct: 115 SKTGEVLLDEALQLMKNDEPLTIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGV 174

Query: 181 LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTI 240
           LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILS LV RN+ELNYN YF+E  SFK IR +
Sbjct: 175 LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRNMELNYNSYFAETTSFKYIRIV 234

Query: 241 ALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKE 300
           AL+C +Y ANVLENVL+SL YEKRD AI RA+EIL QF++YPFDL   TE GIS+NLNKE
Sbjct: 235 ALVCCSYGANVLENVLSSLDYEKRDRAISRAEEILAQFAQYPFDLSKNTELGISVNLNKE 294

Query: 301 VGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
           V  E+ ++P+ TLQLEV+AGV EVFSRMDMLL
Sbjct: 295 VENEVNENPQFTLQLEVIAGVIEVFSRMDMLL 326

>Smik_4.638 Chr4 complement(1141194..1142234) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  498 bits (1283), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 243/346 (70%), Positives = 283/346 (81%), Gaps = 14/346 (4%)

Query: 1   MSGLQRRRVNRVDSS-------GSNNEPTRG-------LEAQEDSSSKKVAYDPEEVKLT 46
           MS LQRRRVNR DS         +NN   +G       ++  ++ ++KK+AYDPEE KL 
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQPSANNINAKGDKIASVAVDDDDNGTNKKIAYDPEESKLR 60

Query: 47  DNVEVPKXXXXXXXXXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARK 106
           DN+ +P             RD+EGYLSFWND+ISYALRGCI+IELALRGKIR++DDSARK
Sbjct: 61  DNINIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCIIIELALRGKIRILDDSARK 120

Query: 107 RFDVSERLIEVTDSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQ 166
           RFD+SERLIEV D SKTGEVLLDE LQLMK DEPL+I+NWIDLLSGETWN LKINYQLKQ
Sbjct: 121 RFDLSERLIEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 167 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYND 226
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEAIKRR+LSVLV RN+EL+YN+
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 227 YFSERVSFKLIRTIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLD 286
           YF E  SFK+IRT+ALICG+Y ANVLENVLT+L YEKRD AI RA+EI+ QFS++PFDL+
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMAQFSQFPFDLE 300

Query: 287 TQTESGISINLNKEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
            +TE GIS+NLNKEV +E++ +P   LQLEV+AGVFEVFSRMDMLL
Sbjct: 301 KETELGISVNLNKEVKEEMESNPGHNLQLEVIAGVFEVFSRMDMLL 346

>Skud_4.641 Chr4 complement(1144004..1145044) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  498 bits (1283), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 243/346 (70%), Positives = 285/346 (82%), Gaps = 14/346 (4%)

Query: 1   MSGLQRRRVNRVDS-------SGSNNEPTRG-------LEAQEDSSSKKVAYDPEEVKLT 46
           MS LQRRRVNR DS       S SNN+ ++G       ++  +  ++KK+AYDPEE KL 
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSMSNNDNSKGDKIANIGIDDDDSGANKKIAYDPEESKLR 60

Query: 47  DNVEVPKXXXXXXXXXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARK 106
           DN+++P             RD+EGYLSFWND+ISYALRGCI+IELALRGKIR++DDSARK
Sbjct: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120

Query: 107 RFDVSERLIEVTDSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQ 166
           RFD+SERL+EV D SKTGEVLLDE LQLMK DEPL+I+NWIDLLSGETWN LKINYQLKQ
Sbjct: 121 RFDLSERLVEVVDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 167 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYND 226
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEAIKRR+LSVLV RN+EL+YN+
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 227 YFSERVSFKLIRTIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLD 286
           YF E  SFK+IRT+ALICG+Y ANVLENVLT+L YEKRD AI RA+EI+ QFS+YPFDL+
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAINRAEEIMAQFSQYPFDLE 300

Query: 287 TQTESGISINLNKEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
            +TE G+S+NLNKEV +E++ +    LQLEV+AGVFEVFSRMDMLL
Sbjct: 301 KETELGVSVNLNKEVKEEIENNTGHDLQLEVIAGVFEVFSRMDMLL 346

>Suva_2.544 Chr2 complement(971735..972775) [1041 bp, 346 aa] {ON}
           YDR372C (REAL)
          Length = 346

 Score =  495 bits (1275), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 242/346 (69%), Positives = 282/346 (81%), Gaps = 14/346 (4%)

Query: 1   MSGLQRRRVNRVDS-------SGSNNEPTRG-------LEAQEDSSSKKVAYDPEEVKLT 46
           MS LQRRRVNR DS       S SNN  + G       ++  ++  +KK+AYDPEE KL 
Sbjct: 1   MSTLQRRRVNRADSGDTSSMQSTSNNHNSSGDKTSNGPVDGDDNGINKKIAYDPEESKLR 60

Query: 47  DNVEVPKXXXXXXXXXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARK 106
           DN+++P             RD+EGYLSFWND+ISYALRGCI+IELALRGKIR++DDSARK
Sbjct: 61  DNIKIPTLTLMEEVLLMGLRDREGYLSFWNDSISYALRGCILIELALRGKIRILDDSARK 120

Query: 107 RFDVSERLIEVTDSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQ 166
           RFD+SERL+EV D SKTGEVLLDE LQLMK DEPL+I+NWIDLLSGETWN LKINYQLKQ
Sbjct: 121 RFDLSERLVEVIDGSKTGEVLLDETLQLMKNDEPLTISNWIDLLSGETWNLLKINYQLKQ 180

Query: 167 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYND 226
           VRERLAKGLVDKGVLRTEMKNFFLFDMATHP+ D SCKEAIKRR+LSVLV RN+EL+YN+
Sbjct: 181 VRERLAKGLVDKGVLRTEMKNFFLFDMATHPIADASCKEAIKRRVLSVLVSRNMELSYNE 240

Query: 227 YFSERVSFKLIRTIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLD 286
           YF E  SFK+IRT+ALICG+Y ANVLENVLT+L YEKRD AI RA+EI+  FS+YPFDL+
Sbjct: 241 YFPETTSFKIIRTLALICGSYGANVLENVLTTLEYEKRDKAISRAEEIMSHFSQYPFDLE 300

Query: 287 TQTESGISINLNKEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
             T+ G+S+NLNKEV +E++ +P   LQLEV+AGVFEVFSRMDMLL
Sbjct: 301 KDTDLGVSVNLNKEVKEEIENNPGHDLQLEVIAGVFEVFSRMDMLL 346

>Kwal_55.21399 s55 (820851..821840) [990 bp, 329 aa] {ON} YDR372C
           (VPS74) -  [contig 130] FULL
          Length = 329

 Score =  489 bits (1258), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 240/332 (72%), Positives = 279/332 (84%), Gaps = 3/332 (0%)

Query: 1   MSGLQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKXXXXXXX 60
           MSGLQRRRVN+ +S+  ++EP    EA+    SK+VAYDPEE  L DN  +PK       
Sbjct: 1   MSGLQRRRVNKSESN-YDSEPVISEEAE--GESKRVAYDPEEAMLKDNATIPKLNLMEEV 57

Query: 61  XXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDS 120
                +DKEGYLSFWNDNISYALRGCI+IELALRGKI+VV+DSARKRFDVSERL+EV ++
Sbjct: 58  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVVNDSARKRFDVSERLVEVINA 117

Query: 121 SKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGV 180
           +KTGEVLLDEAL LMK DEPL+I NWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGV
Sbjct: 118 TKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGV 177

Query: 181 LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTI 240
           LRTEMKNFFLFDM THP+TDTSCKEAIKRRILSVLV RN++LNYN+YF   VSFKL+RT+
Sbjct: 178 LRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPASVSFKLLRTL 237

Query: 241 ALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKE 300
           +LICGAY ANVLENVL SL YEKRD A  RADEIL QFS++PF LD QTE+GIS+N+NKE
Sbjct: 238 SLICGAYGANVLENVLCSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNINKE 297

Query: 301 VGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
           + +E+  + ++ L+LEV+AGVFEVFSRMD LL
Sbjct: 298 MQEEIDANSDALLRLEVVAGVFEVFSRMDTLL 329

>KLTH0F15884g Chr6 (1292767..1293756) [990 bp, 329 aa] {ON} highly
           similar to uniprot|Q06385 Saccharomyces cerevisiae
           YDR372C VPS74
          Length = 329

 Score =  483 bits (1244), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 238/332 (71%), Positives = 276/332 (83%), Gaps = 3/332 (0%)

Query: 1   MSGLQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKXXXXXXX 60
           MSGLQRRRVN+ +S  S+ +P   +  + D   K+VAYDPEE KL D+   PK       
Sbjct: 1   MSGLQRRRVNKSESI-SSQDPV--VNDETDGEGKRVAYDPEEAKLRDDTTTPKLNLMEEV 57

Query: 61  XXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDS 120
                +DKEGYLSFWNDNISYALRGCI+IELALRGKI+V++D ARKRFDVSERL+EV ++
Sbjct: 58  LLMGLKDKEGYLSFWNDNISYALRGCILIELALRGKIQVLNDPARKRFDVSERLVEVINA 117

Query: 121 SKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGV 180
           +KTGEVLLDEAL LMK DEPL+I NWIDLLSGETWN +KI+YQLKQVRERLAKGLVDKGV
Sbjct: 118 TKTGEVLLDEALNLMKNDEPLTIANWIDLLSGETWNFMKISYQLKQVRERLAKGLVDKGV 177

Query: 181 LRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTI 240
           LRTEMKNFFLFDM THP+TDTSCKEAIKRRILSVLV RN++LNYN+YF   V FKLIRT+
Sbjct: 178 LRTEMKNFFLFDMPTHPITDTSCKEAIKRRILSVLVSRNMQLNYNEYFPSSVRFKLIRTL 237

Query: 241 ALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKE 300
           +LICGAY ANVLENVL+SL YEKRD A  RADEIL QFS++PF LD QTE+GIS+NLNKE
Sbjct: 238 SLICGAYGANVLENVLSSLDYEKRDRAFSRADEILAQFSQFPFALDKQTETGISVNLNKE 297

Query: 301 VGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
           V +E+  + +++LQLE +AGVFEVFSRMD LL
Sbjct: 298 VQEEVVSNQDASLQLECVAGVFEVFSRMDTLL 329

>KNAG0B04200 Chr2 (799881..800915) [1035 bp, 344 aa] {ON} Anc_5.442
           YDR372C
          Length = 344

 Score =  476 bits (1225), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 237/344 (68%), Positives = 272/344 (79%), Gaps = 12/344 (3%)

Query: 1   MSGLQRRRVNRVDS------SGSNNE--PTRGLEAQE----DSSSKKVAYDPEEVKLTDN 48
           MS LQRRRVNR DS      SG      P+   +A+E       ++KVAYDPEE KL DN
Sbjct: 1   MSTLQRRRVNRSDSNEGETVSGGKTAAAPSASNDAEEYEETSGPTRKVAYDPEEAKLRDN 60

Query: 49  VEVPKXXXXXXXXXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRF 108
             VPK            RD+EGYLSFWNDNISYALRGCI+IELALR KIR++DDSARKRF
Sbjct: 61  YTVPKLTLMEEVLLMGLRDREGYLSFWNDNISYALRGCIMIELALRKKIRILDDSARKRF 120

Query: 109 DVSERLIEVTDSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVR 168
           D+SERL+EV D SKTGEVLLDE LQLMK DEPL+I NWIDLLSGETWN +KINYQLKQVR
Sbjct: 121 DISERLVEVVDGSKTGEVLLDETLQLMKNDEPLTIANWIDLLSGETWNLMKINYQLKQVR 180

Query: 169 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYF 228
           ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTD+SCKEAIKRRILS +V RN+EL++N YF
Sbjct: 181 ERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSTVVSRNMELSFNSYF 240

Query: 229 SERVSFKLIRTIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQ 288
            E  SFK IRT+AL+C  Y A+VLENVL+SL YE+RD A+ RA+E+L++F +YPFDL+ Q
Sbjct: 241 PESTSFKYIRTVALVCSTYGASVLENVLSSLDYEQRDRAVSRAEELLEKFGQYPFDLEKQ 300

Query: 289 TESGISINLNKEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
            +SGIS NLNKE  +E+ + P S L LEV+AGV EVFSRMDMLL
Sbjct: 301 GDSGISCNLNKEAQREVDESPNSALYLEVVAGVIEVFSRMDMLL 344

>CAGL0A02926g Chr1 complement(304789..305775) [987 bp, 328 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372c
          Length = 328

 Score =  474 bits (1219), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 235/334 (70%), Positives = 276/334 (82%), Gaps = 8/334 (2%)

Query: 1   MSGLQRRRVNRVDSSGSNNEPTRGLEAQED--SSSKKVAYDPEEVKLTDNVEVPKXXXXX 58
           MS LQRRRVN+ +++      + G+E +ED  +SS K+AYDPEE KL ++ + P      
Sbjct: 1   MSTLQRRRVNKSENA------SNGIEDREDDGTSSGKIAYDPEESKLQNDSKQPTLTLME 54

Query: 59  XXXXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVT 118
                  RD+EGYLSFWND+ISYALRGCI+IELALR KIR++D  AR RFD+SERLIEV 
Sbjct: 55  EVLLMGLRDREGYLSFWNDSISYALRGCILIELALRNKIRILDAPARMRFDISERLIEVI 114

Query: 119 DSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDK 178
           DSSKTGEVLLDE LQLM  DEPLSI NWIDLLSGETWN LKINYQLKQVRERLAKGLVDK
Sbjct: 115 DSSKTGEVLLDETLQLMVNDEPLSIANWIDLLSGETWNLLKINYQLKQVRERLAKGLVDK 174

Query: 179 GVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIR 238
           GVLRTEMKNFFLFDMATHPV+D+SCKEAIKRRILSVLV RN+E++YN YF E  +FKLIR
Sbjct: 175 GVLRTEMKNFFLFDMATHPVSDSSCKEAIKRRILSVLVSRNMEISYNSYFPESTNFKLIR 234

Query: 239 TIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLN 298
           T++LI GAY ANVLENV++SL Y+KRD AI RA+EIL QFS+YPFDL  +++ GIS+NLN
Sbjct: 235 TVSLIAGAYGANVLENVISSLEYDKRDKAITRAEEILAQFSQYPFDLQKESKDGISVNLN 294

Query: 299 KEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
           KE+ +EL+ +P S L+LEV+AGVFEVFSRMDMLL
Sbjct: 295 KELQEELESNPGSDLKLEVIAGVFEVFSRMDMLL 328

>Kpol_1016.2 s1016 (4946..5932) [987 bp, 328 aa] {ON} (4946..5932)
           [987 nt, 329 aa]
          Length = 328

 Score =  471 bits (1212), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 231/334 (69%), Positives = 269/334 (80%), Gaps = 8/334 (2%)

Query: 1   MSGLQRRRVNRV--DSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKXXXXX 58
           MS LQRRR+NR+  D++ S+N+       +E S S K+AYDPEE KL D+V VP      
Sbjct: 1   MSSLQRRRLNRINSDTAESSNDD------EERSKSTKIAYDPEEAKLKDDVTVPTLTLME 54

Query: 59  XXXXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVT 118
                   DK+GYLSFWNDNISY LRGCI+IELALR KIR++DD ARKRFD+SERL+EV 
Sbjct: 55  EVVLLGLGDKDGYLSFWNDNISYTLRGCIIIELALRNKIRILDDPARKRFDLSERLVEVV 114

Query: 119 DSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDK 178
           D SKTGEVLLDEALQLMK DEPLSI NWIDLLSGETWN  KINYQLKQVRER++KGLVDK
Sbjct: 115 DGSKTGEVLLDEALQLMKNDEPLSIANWIDLLSGETWNFFKINYQLKQVRERISKGLVDK 174

Query: 179 GVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIR 238
           GVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILS LV R +ELNYN+YF E   +K+IR
Sbjct: 175 GVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSALVSRTMELNYNEYFPETTQYKVIR 234

Query: 239 TIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLN 298
           TIALIC +Y ANVLENVL+SL YEKRDNAI R++ IL +F++YPF LD  ++  +SINL+
Sbjct: 235 TIALICSSYAANVLENVLSSLEYEKRDNAIARSESILSEFAQYPFKLDKASDIKVSINLS 294

Query: 299 KEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
           K V  E+ Q+P S LQLE +AGVF+VFS+MDM+L
Sbjct: 295 KLVEDEIAQNPGSALQLEAVAGVFDVFSKMDMIL 328

>KLLA0E02355g Chr5 complement(217222..218196) [975 bp, 324 aa] {ON}
           highly similar to uniprot|Q06385 Saccharomyces
           cerevisiae YDR372C VPS74
          Length = 324

 Score =  471 bits (1211), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 232/329 (70%), Positives = 258/329 (78%), Gaps = 7/329 (2%)

Query: 4   LQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKXXXXXXXXXX 63
           LQRRRVN+ D+       T  +   ++    K+ YD +E KL DN  VPK          
Sbjct: 3   LQRRRVNKGDT-------TESIPQIDNEHDHKIVYDEQEAKLRDNTSVPKLTLMEEVLLM 55

Query: 64  XXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDSSKT 123
             +DK+GYLSFWNDNISYALRGCI+IELALRGKIR VDD ARKR+DVSERLIEV D SKT
Sbjct: 56  GLKDKQGYLSFWNDNISYALRGCILIELALRGKIRCVDDPARKRYDVSERLIEVIDGSKT 115

Query: 124 GEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGVLRT 183
           GEVLLDE+L LMK D P SI  WIDLLSGETWN LKINYQLKQVRERLAKGLVDKGVLRT
Sbjct: 116 GEVLLDESLSLMKNDPPTSIVGWIDLLSGETWNLLKINYQLKQVRERLAKGLVDKGVLRT 175

Query: 184 EMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTIALI 243
           EMKNFFLFDMATHP+TDT+CKE+IKRRILS+LV RN EL YN YF + VSFK IRT++LI
Sbjct: 176 EMKNFFLFDMATHPITDTTCKESIKRRILSILVSRNAELTYNTYFPQDVSFKYIRTLSLI 235

Query: 244 CGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKEVGQ 303
           CGAY ANVLENVL +L YE RD    RADEIL QFSE+PF LD QT +G+S+NLNKE+ Q
Sbjct: 236 CGAYGANVLENVLATLDYEVRDTGFARADEILAQFSEFPFPLDKQTSTGVSVNLNKEISQ 295

Query: 304 ELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
           EL  HP S LQLEV+AGVFEVFSRMD LL
Sbjct: 296 ELNNHPGSDLQLEVVAGVFEVFSRMDTLL 324

>TBLA0A06480 Chr1 (1593225..1594229) [1005 bp, 334 aa] {ON}
           Anc_5.442 YDR372C
          Length = 334

 Score =  471 bits (1212), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 234/339 (69%), Positives = 273/339 (80%), Gaps = 12/339 (3%)

Query: 1   MSGLQRRRVN-RVDSSGS------NNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPK 53
           MS LQRRR   R DS GS      +NEPT        + S++VAYDPEE K+ +N+ VP+
Sbjct: 1   MSTLQRRRKQARSDSVGSSGTDSNDNEPT-----NRQAESRRVAYDPEEDKIRNNMSVPQ 55

Query: 54  XXXXXXXXXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSER 113
                       RDKEGYLSFWNDNISYALRGCI+IELALRGKIR++DD ARKRF++SER
Sbjct: 56  LTLMEEVVLLGLRDKEGYLSFWNDNISYALRGCIIIELALRGKIRILDDPARKRFELSER 115

Query: 114 LIEVTDSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAK 173
           L+EV DSSKTGEVLLDEALQ+M+ DEPL+I+NW+DLLSGETWN  KINYQLKQVRER++K
Sbjct: 116 LVEVVDSSKTGEVLLDEALQIMRNDEPLAISNWVDLLSGETWNVFKINYQLKQVRERISK 175

Query: 174 GLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVS 233
           GLVDKGVLRTEMKNFFLFDMATHPVTD+SCKEAIKRRILS+LV R  E  YNDYF E  S
Sbjct: 176 GLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAIKRRILSILVNRTAEFTYNDYFPETTS 235

Query: 234 FKLIRTIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGI 293
           FK IRTI+LIC AY ANVLENVL SL Y+KRDN + RA+E+L+QFS+YPFDL+ QTE G 
Sbjct: 236 FKYIRTISLICSAYGANVLENVLNSLEYQKRDNGLNRAEELLEQFSQYPFDLEKQTEFGT 295

Query: 294 SINLNKEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
           SINLN  V +E++  P++ L LEV+AGVFEVFS+MD+LL
Sbjct: 296 SINLNALVKEEIEADPKNALFLEVVAGVFEVFSKMDLLL 334

>NCAS0F03430 Chr6 complement(690870..691868) [999 bp, 332 aa] {ON}
           Anc_5.442 YDR372C
          Length = 332

 Score =  468 bits (1205), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 233/333 (69%), Positives = 269/333 (80%), Gaps = 2/333 (0%)

Query: 1   MSGLQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTD-NVEVPKXXXXXX 59
           MS LQRRRVN+ DS       T  +E   D+ +K VAYDPEE ++ +   +VP       
Sbjct: 1   MSTLQRRRVNKDDSDNETGSVTPNVERDSDNDNK-VAYDPEEARMRNVGGQVPVLTLMEE 59

Query: 60  XXXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTD 119
                 RDKEGYLSFWNDNISYALRGCI+IELALRGKI+++DDSARKRF++SERL++V D
Sbjct: 60  VLLMGLRDKEGYLSFWNDNISYALRGCILIELALRGKIQILDDSARKRFELSERLVQVID 119

Query: 120 SSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKG 179
            +KTGEVLLDE LQLMK DEPLSI +WIDLLSGETWN +KINYQLKQVRERLAKGLVDKG
Sbjct: 120 GTKTGEVLLDETLQLMKNDEPLSIASWIDLLSGETWNIMKINYQLKQVRERLAKGLVDKG 179

Query: 180 VLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRT 239
           VLRTEMKNFFLFDMATHPVTD+SCKEAIKRR+LS+LV RN+EL+YN+YF E   FK+IRT
Sbjct: 180 VLRTEMKNFFLFDMATHPVTDSSCKEAIKRRVLSILVSRNMELSYNNYFPETTRFKIIRT 239

Query: 240 IALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNK 299
           IALICGAY ANVLEN+L SL +E  DNAI RADE++ QFS++PFDL+T T  GIS+NLN+
Sbjct: 240 IALICGAYGANVLENLLGSLDFEMSDNAIARADELIAQFSKFPFDLETPTALGISVNLNR 299

Query: 300 EVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
           EV QEL   P   LQLEV+AGV EVFSRMD LL
Sbjct: 300 EVQQELADTPGYDLQLEVIAGVIEVFSRMDTLL 332

>Ecym_4513 Chr4 complement(1023828..1024829) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ACL165C
          Length = 333

 Score =  462 bits (1189), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 226/331 (68%), Positives = 269/331 (81%), Gaps = 2/331 (0%)

Query: 4   LQRRRVNRVDSSGSNNEPT--RGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKXXXXXXXX 61
           LQRRRVN+ +  G++ E T  +  E ++D  S KVAYDPE+ KL +N + P         
Sbjct: 3   LQRRRVNKAEVGGTSVELTQRKHGEDEDDKGSHKVAYDPEDQKLRENTKEPTLTLMEEVL 62

Query: 62  XXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDSS 121
               +DKEGYLSFWND+ISY+LRGCI+IELALRGKIRVV+D+ARKRFD+SERL+EV ++S
Sbjct: 63  LMGLKDKEGYLSFWNDSISYSLRGCILIELALRGKIRVVEDAARKRFDLSERLVEVIETS 122

Query: 122 KTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGVL 181
           KTGE LLDE L LMK +EPLSI NWIDLLSGETWN LKI+YQLKQVRERLAKGLVDKGVL
Sbjct: 123 KTGEALLDETLSLMKSNEPLSIVNWIDLLSGETWNLLKISYQLKQVRERLAKGLVDKGVL 182

Query: 182 RTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTIA 241
           RTEMKNFFLFDMATHPV D+SCKE+IKRR+LSVLVPRN+ L+Y +YF E V+FK +RTIA
Sbjct: 183 RTEMKNFFLFDMATHPVADSSCKESIKRRMLSVLVPRNVSLDYTEYFPESVAFKYLRTIA 242

Query: 242 LICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKEV 301
           LICGAY ANVLENVL+SL YEKR+    RA+EIL QFS+YPF LD   E+GIS+NL  +V
Sbjct: 243 LICGAYGANVLENVLSSLDYEKRERGFSRAEEILTQFSQYPFALDKDVETGISVNLYNQV 302

Query: 302 GQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
            +E+ ++P + LQLEV+AGVFEVFSRMD  L
Sbjct: 303 KEEIGKNPGTGLQLEVVAGVFEVFSRMDNFL 333

>NDAI0B05720 Chr2 complement(1391179..1392276) [1098 bp, 365 aa]
           {ON} Anc_5.442 YDR372C
          Length = 365

 Score =  457 bits (1177), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 238/365 (65%), Positives = 269/365 (73%), Gaps = 33/365 (9%)

Query: 1   MSGLQRRR-------VNRVDSSGSNNEPTRGLEAQEDS---------SSKKVAYDPEEVK 44
           MS LQRRR          VD    NN+ +R L +   +          S K+AYDPEE K
Sbjct: 1   MSTLQRRRRPQDGSNKGMVDVDSDNNDSSRILGSNNSNNNVSNSNTFGSSKIAYDPEEAK 60

Query: 45  L-----------------TDNVEVPKXXXXXXXXXXXXRDKEGYLSFWNDNISYALRGCI 87
           L                  +N   P             RDKEGYLSFWNDNISYALRGCI
Sbjct: 61  LLNNNNINNNNSGSNSRGGNNAVTPTLTLMEEVLLMGLRDKEGYLSFWNDNISYALRGCI 120

Query: 88  VIELALRGKIRVVDDSARKRFDVSERLIEVTDSSKTGEVLLDEALQLMKCDEPLSITNWI 147
           +IELALRGKIR++DDSARKRFD+SERLIEV D SKTGEVLLDE LQLMK DEPL+I NWI
Sbjct: 121 LIELALRGKIRILDDSARKRFDLSERLIEVKDGSKTGEVLLDETLQLMKNDEPLTIANWI 180

Query: 148 DLLSGETWNPLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAI 207
           DLLSGETWN +KINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTD+SCKEAI
Sbjct: 181 DLLSGETWNIMKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDSSCKEAI 240

Query: 208 KRRILSVLVPRNLELNYNDYFSERVSFKLIRTIALICGAYRANVLENVLTSLGYEKRDNA 267
           KRR+LSVLV RN+E NYN+YF +   FK+IRTIALICGAY ANVLENVL+SL YEK DNA
Sbjct: 241 KRRVLSVLVSRNMEFNYNEYFPQNTFFKIIRTIALICGAYGANVLENVLSSLDYEKSDNA 300

Query: 268 IGRADEILKQFSEYPFDLDTQTESGISINLNKEVGQELQQHPESTLQLEVLAGVFEVFSR 327
           I RADE++ QFS++PFDL+  T + +S+NLN+ V QEL ++P   LQLEV+AGV EVFSR
Sbjct: 301 IARADELIAQFSKFPFDLEKTTNTNVSVNLNRLVQQELDENPGYDLQLEVIAGVIEVFSR 360

Query: 328 MDMLL 332
           MD LL
Sbjct: 361 MDTLL 365

>TPHA0J02610 Chr10 complement(579213..580202) [990 bp, 329 aa] {ON}
           Anc_5.442 YDR372C
          Length = 329

 Score =  441 bits (1135), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 216/336 (64%), Positives = 263/336 (78%), Gaps = 11/336 (3%)

Query: 1   MSGLQRRRVNRV----DSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKXXX 56
           MSG+QRRR+NR+    +S  S+N+ +R       S+  KVA+DPEE K+ D+V VPK   
Sbjct: 1   MSGVQRRRINRISNEDESDHSDNDQSR-------SNVSKVAFDPEEAKIKDDVSVPKLTL 53

Query: 57  XXXXXXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIE 116
                     D EGYLSFWNDNISY LRGCI+IELALRGKIR++DDSARK FD+SERLIE
Sbjct: 54  MEEVVLLGLGDSEGYLSFWNDNISYVLRGCILIELALRGKIRIIDDSARKSFDLSERLIE 113

Query: 117 VTDSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLV 176
           V D+SKTGEVLLDE LQLMK DEP SI +WIDLLSGETWN  K+NYQLKQVRERL+KGLV
Sbjct: 114 VIDASKTGEVLLDETLQLMKNDEPQSIVSWIDLLSGETWNFFKVNYQLKQVRERLSKGLV 173

Query: 177 DKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKL 236
           DKGVLRTEMKNFFLFDMATHPV D+SCKE++KRRI+S LV R L L YN+YF E  +FK+
Sbjct: 174 DKGVLRTEMKNFFLFDMATHPVADSSCKESLKRRIMSTLVDRTLSLQYNEYFPESTTFKV 233

Query: 237 IRTIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISIN 296
           IRT++LI  AY ANVLENVL +L YEKRD A+ RA+ +L  F  YPF L  + ++ ISIN
Sbjct: 234 IRTVSLIITAYSANVLENVLNTLEYEKRDKALSRAENLLNNFGNYPFKLVNEPDNRISIN 293

Query: 297 LNKEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
           LN+ V  E++ +P++ LQLEVLAGVF+VF++MD+++
Sbjct: 294 LNQLVEDEIKANPKTALQLEVLAGVFDVFAKMDVII 329

>ACL165C Chr3 complement(66499..67494) [996 bp, 331 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR372C
          Length = 331

 Score =  436 bits (1121), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 216/329 (65%), Positives = 255/329 (77%)

Query: 4   LQRRRVNRVDSSGSNNEPTRGLEAQEDSSSKKVAYDPEEVKLTDNVEVPKXXXXXXXXXX 63
           LQRRRVN+   + +    +     +E+  + KVAYDPEE KL +N   P           
Sbjct: 3   LQRRRVNKTAGNETVGGASLNRSDEEEGMTHKVAYDPEEQKLRENTREPTLTLMEEVLLM 62

Query: 64  XXRDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDSSKT 123
             +DKEGYLSF N+NISYALRGCI+IELALRG+I+VVDD+ R+RFD SERLIEV D SKT
Sbjct: 63  GLKDKEGYLSFLNENISYALRGCILIELALRGRIQVVDDAMRRRFDPSERLIEVVDGSKT 122

Query: 124 GEVLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGVLRT 183
           GE LLDEAL LMK  EPL+I NW+DLLSGETWN LKINYQL+QVRERLAKGLVDKGVLRT
Sbjct: 123 GEALLDEALTLMKGSEPLTIVNWMDLLSGETWNFLKINYQLRQVRERLAKGLVDKGVLRT 182

Query: 184 EMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTIALI 243
           EMKNFFLFDM THPV DTSCKE+IKRRILSVLVPRN+EL Y + F E V+FK +RTIALI
Sbjct: 183 EMKNFFLFDMPTHPVADTSCKESIKRRILSVLVPRNVELQYTELFPETVAFKYLRTIALI 242

Query: 244 CGAYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKEVGQ 303
           C A+ ANVLE VL++L YEKRD    RA+E+L QFS+YPF LD   E+GIS+NLN+ V +
Sbjct: 243 CSAHGANVLEKVLSTLDYEKRDRGFSRAEELLVQFSQYPFALDKDIETGISVNLNRLVQE 302

Query: 304 ELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
           EL ++P + L LEV+AGV +V+SRMD LL
Sbjct: 303 ELDRNPGTALNLEVVAGVLKVYSRMDDLL 331

>Kpol_1062.24 s1062 (55671..56501) [831 bp, 276 aa] {ON}
           (55671..56501) [831 nt, 277 aa]
          Length = 276

 Score =  343 bits (879), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 203/264 (76%)

Query: 66  RDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKRFDVSERLIEVTDSSKTGE 125
           RDKEGYLSFWN+N+S+ LRGCI+IELA RG I+V+DD +RKRFD+S+RLIEV +  KTGE
Sbjct: 10  RDKEGYLSFWNENLSFVLRGCILIELAFRGNIQVIDDPSRKRFDLSDRLIEVVNPKKTGE 69

Query: 126 VLLDEALQLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGVLRTEM 185
            LLDE LQ+MK +E  SI+ WIDLLSGETWN  KIN QLKQVRER++KGLVDKG+LRTEM
Sbjct: 70  FLLDETLQMMKSEESQSISTWIDLLSGETWNIFKINLQLKQVRERISKGLVDKGILRTEM 129

Query: 186 KNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTIALICG 245
           KNFFLFDMATHPV D  CKE IK+RILSVL+P+   +  ++YF E V  + +RTIALI  
Sbjct: 130 KNFFLFDMATHPVEDLKCKEMIKKRILSVLLPQTAVILADEYFPETVQLRCLRTIALILS 189

Query: 246 AYRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISINLNKEVGQEL 305
           AY  +VLENV + L Y+K+D+   R  EIL Q S YPF+ D ++ + I+ NLN+ V  EL
Sbjct: 190 AYAGSVLENVASDLDYQKKDDLFVRTSEILDQSSVYPFEFDNKSSTNIATNLNQLVENEL 249

Query: 306 QQHPESTLQLEVLAGVFEVFSRMD 329
            +     L+LE +AGVFEVF +MD
Sbjct: 250 SKDKNLNLKLETIAGVFEVFLKMD 273

>TBLA0A02780 Chr1 (670848..672011) [1164 bp, 387 aa] {ON} Anc_5.442
           YDR372C
          Length = 387

 Score =  317 bits (811), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 152/296 (51%), Positives = 207/296 (69%), Gaps = 1/296 (0%)

Query: 38  YDPEEVKLTDNVEVPKXXXXXXXXXXXXRDKEGYLSFWNDNISYALRGCIVIELALRGKI 97
           +DPEE    + + +P             +DK+GYLSFWNDNISY LRGCI+IELALR KI
Sbjct: 92  FDPEESISNNEIILPPLNLMEEIVLLGLKDKQGYLSFWNDNISYVLRGCILIELALRKKI 151

Query: 98  RVVDDSARKRFDVSERLIEVT-DSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSGETWN 156
           +V+DD  R  +DVS R+IEV    +KTG  LLDEAL +M  + P SI NWIDLLSGETWN
Sbjct: 152 KVIDDPVRNMYDVSARIIEVVMPITKTGNHLLDEALNMMAKERPESIMNWIDLLSGETWN 211

Query: 157 PLKINYQLKQVRERLAKGLVDKGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLV 216
             K N QLK VRER++KGLVDKG+L+    NF  FDM+THP+ D   KE++K+RI S+LV
Sbjct: 212 VFKNNLQLKNVRERVSKGLVDKGILKNNTSNFLFFDMSTHPLVDIGSKESVKQRIFSILV 271

Query: 217 PRNLELNYNDYFSERVSFKLIRTIALICGAYRANVLENVLTSLGYEKRDNAIGRADEILK 276
           P++  L YN+YF E V+FK+IR++ LIC AY A+VL++ L ++ Y+  DNA  +A+++ +
Sbjct: 272 PKHSYLLYNNYFPENVTFKIIRSLCLICCAYGADVLDDTLLTMNYDDSDNAFKKAEKLFE 331

Query: 277 QFSEYPFDLDTQTESGISINLNKEVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
             S++P +LD +  SG+ +++ K++  EL QH   +L LEV+AGV +V  RMD LL
Sbjct: 332 TISDFPINLDQREGSGVPVDIIKDLQSELLQHSGESLYLEVVAGVLQVILRMDSLL 387

>NCAS0H02090 Chr8 complement(405561..406598) [1038 bp, 345 aa] {ON}
           Anc_5.442 YDR372C
          Length = 345

 Score =  209 bits (533), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 112/273 (41%), Positives = 171/273 (62%), Gaps = 15/273 (5%)

Query: 66  RDKEGYLSFWNDNISYALRGCIVIELALRGKIRVVDDSARKR-FDVSERLIEVTDSSKTG 124
           +DKEGY+S W+  +SY LR C++IELALRGKI+ V +  +K+     E  IEV D S TG
Sbjct: 77  KDKEGYVSDWDGKLSYVLRCCVIIELALRGKIQAVAEGKKKKDLAPHECKIEVIDGSITG 136

Query: 125 EVLLDEALQLMKCDEP-LSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGVLRT 183
           + LLD+ L LMK ++   S+++WI LLSGE+ N LK +YQL  VR+R+ + LV+ G+L  
Sbjct: 137 DPLLDQTLGLMKKEKKNYSVSHWIKLLSGESMNFLKASYQLLHVRKRIERILVETGILSK 196

Query: 184 EMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTIALI 243
           + K      + THP+ D  CK AI+ R+  +L    ++L    YF + VS++++RTI L 
Sbjct: 197 QTKKLAAIGLDTHPIKDIKCKNAIRSRMQYILTANKVDLPSTKYFPDTVSYRVLRTIVLA 256

Query: 244 CGAYRANVLENVLTSLGYEKRDNAI----GRADEILKQFSEYPFDLDTQTESGISINLNK 299
           C AY A++L+      G+ + +N      GRA  +L  FS++PF+L+      +  +LN+
Sbjct: 257 CAAYGADILDK-----GFFQTENETVIGKGRARVLLSLFSKFPFELN----QAVQPDLNE 307

Query: 300 EVGQELQQHPESTLQLEVLAGVFEVFSRMDMLL 332
           +V +EL +HPE   QLEV+AG  +V + +D +L
Sbjct: 308 KVSKELHEHPEEASQLEVVAGAIDVINTIDTVL 340

>KLLA0E17425g Chr5 complement(1543158..1550639) [7482 bp, 2493 aa]
           {ON} similar to uniprot|P35194 Saccharomyces cerevisiae
           YBL004W UTP20 Possible snoRNA-binding protein based on
           computational analysis of large-scale protein-protein
           interaction data
          Length = 2493

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 66/148 (44%), Gaps = 26/148 (17%)

Query: 164 LKQVRERLAKGLVD----KGVLRTEMKNFFLFDMATHPVTDTSCKEAIKRRILSVLVPRN 219
           LKQ  E +   L++    K VL    K+F  F +       TS +  +  ++L++LVPR 
Sbjct: 488 LKQEDEEIIMHLLERVFQKDVLSDFEKDFVGFLLQALTFKITSSESVMAAKLLNILVPRI 547

Query: 220 LELNYNDYFSERVSFKL---------IRTIALIC-----------GAYRANVLENVLTSL 259
           +EL  + YF E +S  L         +++++ I               R   L+ +++ L
Sbjct: 548 IELQNSRYFIEGISHVLSYLEDDTDILKSLSKILPILTDNLLLPDKTIRYETLKFIISVL 607

Query: 260 GYEKRDNAIGRADEILKQFSEYPFDLDT 287
             EK+ N++ +    L+   E P DL T
Sbjct: 608 --EKQGNSVPQLFYDLRILEEIPLDLHT 633

>SAKL0E09394g Chr5 complement(782108..784804) [2697 bp, 898 aa] {ON}
           similar to uniprot|P40462 Saccharomyces cerevisiae
           YIL137C RBF108 Hypothetical ORF
          Length = 898

 Score = 30.8 bits (68), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 39/219 (17%), Positives = 87/219 (39%), Gaps = 37/219 (16%)

Query: 133 QLMKCDEPLSITNWIDLLSGETWNPLKINYQLKQVRERLAKGLVDKGVLRTEMK------ 186
           Q++  D   SI+  I + + ++  P +++Y+     E +   L    +  T++       
Sbjct: 515 QMLLTDRSTSISYPITMFNADSQGPYRVSYESACCYEEINAALSQGTLSATDLYRIFQDL 574

Query: 187 NFFLFDMATHPVTDTSCKEAIKRRILSVLVPRNLELNYNDYFSERVSFKLIRTIALICGA 246
           +FF+ D+        +    +   I S  V  NL+ N   Y    +  ++++TI      
Sbjct: 575 SFFIGDVKYQKEIHITGVVTLLEHIASEKV--NLKKNPQYYHGLSIGLEILQTIE----- 627

Query: 247 YRANVLENVLTSLGYEKRDNAIGRADEILKQFSEYPFDLDTQTESGISI----------- 295
                  +++T  G+   ++       + K+ S +P D    + S   +           
Sbjct: 628 ------RSIITYKGFSSTNSCESIIKPLFKKLS-WPEDFSKSSHSHYELEVMSQLLFASK 680

Query: 296 ------NLNKEVGQELQQHPESTLQLEVLAGVFEVFSRM 328
                 +L++   +++ Q P  ++ LE++  VF V SR+
Sbjct: 681 DEQEVFDLSRRYFKKILQGPNQSIPLEIVGSVFSVVSRL 719

>KAFR0C05110 Chr3 (1013807..1016482) [2676 bp, 891 aa] {ON} Anc_7.39
           YOR353C
          Length = 891

 Score = 30.4 bits (67), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (52%), Gaps = 7/74 (9%)

Query: 95  GKIRVVDDSARKRFDVSERLIEVTDSSKTGEVLLDEALQLMKCDEPLSITNWIDLLSG-E 153
           GK  + D  A K  D+++   +  D SK    +LDE LQL+  ++PL +  ++  +   +
Sbjct: 723 GKQVLTDSLASKIRDLTDTCCQAMDLSK----ILDERLQLLLNNDPLIVEKYLSTVEKLK 778

Query: 154 TWNPLKINYQLKQV 167
           TW   KIN  LK +
Sbjct: 779 TWE--KINAFLKSI 790

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.377 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,460,204
Number of extensions: 1327372
Number of successful extensions: 4466
Number of sequences better than 10.0: 31
Number of HSP's gapped: 4565
Number of HSP's successfully gapped: 31
Length of query: 332
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 222
Effective length of database: 40,868,139
Effective search space: 9072726858
Effective search space used: 9072726858
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)