Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F10186g5.441ON51951927250.0
TDEL0D026005.441ON52351816940.0
NDAI0B057105.441ON56348014540.0
Kpol_1062.255.441ON53350814370.0
NCAS0F034205.441ON52549814030.0
TBLA0A027905.441ON54752913870.0
SAKL0G02684g5.441ON53945213311e-179
TPHA0E017205.441ON53745712981e-174
CAGL0A02904g5.441ON50145912851e-173
Suva_2.5435.441ON51149812181e-163
Skud_4.6405.441ON51149812131e-162
YDR371W (CTS2)5.441ON51150412061e-161
Smik_4.6375.441ON51149811901e-158
KNAG0C048705.441ON45844611421e-152
KLLA0E02333g5.441ON48045111101e-147
KAFR0E038105.441ON49045611101e-147
Kwal_55.214025.441ON51646510831e-142
Ecym_45125.441ON52749510701e-140
KLTH0F15906g5.441ON51544410371e-135
ACL166W5.441ON4904969901e-129
YOL098C3.93ON103745751.7
TPHA0E025403.544ON88349741.9
NCAS0E003903.544ON97379714.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F10186g
         (519 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} simila...  1054   0.0  
TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {O...   657   0.0  
NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON} Anc_5...   564   0.0  
Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {O...   558   0.0  
NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.4...   545   0.0  
TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {O...   538   0.0  
SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} simila...   517   e-179
TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {O...   504   e-174
CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} simila...   499   e-173
Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W ...   473   e-163
Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371...   471   e-162
YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}  CTS2Puta...   469   e-161
Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371...   462   e-158
KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {O...   444   e-152
KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} simila...   432   e-147
KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {O...   432   e-147
Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {...   421   e-142
Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar...   416   e-140
KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]...   404   e-135
ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homo...   385   e-129
YOL098C Chr15 complement(132725..135838) [3114 bp, 1037 aa] {ON}...    33   1.7  
TPHA0E02540 Chr5 (539071..541722) [2652 bp, 883 aa] {ON} Anc_3.5...    33   1.9  
NCAS0E00390 Chr5 (65191..68112) [2922 bp, 973 aa] {ON} Anc_3.544...    32   4.2  

>ZYRO0F10186g Chr6 (823029..824588) [1560 bp, 519 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 519

 Score = 1054 bits (2725), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/519 (97%), Positives = 506/519 (97%)

Query: 1   MHWHNQPWFNHXXXXXXXXXXXXXEMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFKDHH 60
           MHWHNQPWFNH             EMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFKDHH
Sbjct: 1   MHWHNQPWFNHSIILAFIIASIVIEMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFKDHH 60

Query: 61  TVIGDEGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSD 120
           TVIGDEGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSD
Sbjct: 61  TVIGDEGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSD 120

Query: 121 FQMDLYKPLAVKLNQLQLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMA 180
           FQMDLYKPLAVKLNQLQLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMA
Sbjct: 121 FQMDLYKPLAVKLNQLQLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMA 180

Query: 181 VGGWSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELA 240
           VGGWSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELA
Sbjct: 181 VGGWSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELA 240

Query: 241 RKMRLKFDELEEVIFAGEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYH 300
           RKMRLKFDELEEVIFAGEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYH
Sbjct: 241 RKMRLKFDELEEVIFAGEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYH 300

Query: 301 GEWSPVTGYHCNLYDGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMA 360
           GEWSPVTGYHCNLYDGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMA
Sbjct: 301 GEWSPVTGYHCNLYDGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMA 360

Query: 361 AYGRGFTHVKASSNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFC 420
           AYGRGFTHVKASSNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFC
Sbjct: 361 AYGRGFTHVKASSNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFC 420

Query: 421 FDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTI 480
           FDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTI
Sbjct: 421 FDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTI 480

Query: 481 AKNENSVYHKPEALRYYLEKFGQDEFLSPFIIRIISKSH 519
           AKNENSVYHKPEALRYYLEKFGQDEFLSPFIIRIISKSH
Sbjct: 481 AKNENSVYHKPEALRYYLEKFGQDEFLSPFIIRIISKSH 519

>TDEL0D02600 Chr4 complement(498470..500041) [1572 bp, 523 aa] {ON}
           Anc_5.441 YDR371W
          Length = 523

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/518 (60%), Positives = 391/518 (75%), Gaps = 8/518 (1%)

Query: 4   HNQPWFNHXXXXXXXXXXXXXEMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFKDHHTVI 63
             +PW +H             EMCFY+KIF  SA+  V+D+V      +  Q   +   +
Sbjct: 2   QRRPWLSHTVIIIVILASIAVEMCFYKKIFHRSAQRKVVDYVQSQPQQA--QLVTNPGTV 59

Query: 64  GDEGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQM 123
               Y SGLYYS+WSPY PR HFPHDID S+VSHIYYAFFL+DG TG LK  DEWSD  M
Sbjct: 60  EPGQYLSGLYYSNWSPYSPRMHFPHDIDLSRVSHIYYAFFLVDGATGALKLGDEWSDVGM 119

Query: 124 DLYKPLAVKLNQL--QLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAV 181
           DLYKP+A+KLN+L  ++KND +     +LP GC+GELFY+R+  +      R FKV+M V
Sbjct: 120 DLYKPMAIKLNKLNPEVKND-LERQRRILPNGCLGELFYMRNANLFPNRNIRDFKVIMCV 178

Query: 182 GGWSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELAR 241
           GGWSNR+++PKMVR+P+RV+ FI+SC+ETMFKYGFDGIDLDWEFP++DGFEP+MYL+LA+
Sbjct: 179 GGWSNREEFPKMVRNPKRVDKFIDSCIETMFKYGFDGIDLDWEFPEDDGFEPQMYLQLAK 238

Query: 242 KMRLKFDELEEVIFAGEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHG 301
           +++ + +ELE+ IF    NHPKFQLSMATPAF +KL++LPI E+D+YID+WNMMTYDYHG
Sbjct: 239 RLKERMNELEDAIFGPNMNHPKFQLSMATPAFSEKLDILPITEMDKYIDIWNMMTYDYHG 298

Query: 302 EWSPVTGYHCNLYDGPVKV--HSQYKHDSSSDD-EGLDANSAISDMINRFGVDSRKITLG 358
           EWS  TGYHCNLY+G  K    +  KH  S++  EGLDA+SAI  M+N  GV+S KI LG
Sbjct: 299 EWSEKTGYHCNLYNGSTKSFDETHQKHIYSTESVEGLDAHSAIEHMLNVAGVNSHKICLG 358

Query: 359 MAAYGRGFTHVKASSNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSG 418
           MAAYGRGFT+V A S DKRFIDK FHGVGGAS+GEPGMWLYNQLPI+G+ E +DP+YVSG
Sbjct: 359 MAAYGRGFTNVVAQSTDKRFIDKPFHGVGGASDGEPGMWLYNQLPIQGTHELFDPDYVSG 418

Query: 419 FCFDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIK 478
           FC+   +KTFVGYD+VESV+ KA YV+E  L GGFWWESCGD+H +  RSLLNAFT  IK
Sbjct: 419 FCYSSTSKTFVGYDSVESVRFKAQYVREKNLAGGFWWESCGDDHANQSRSLLNAFTNEIK 478

Query: 479 TIAKNENSVYHKPEALRYYLEKFGQDEFLSPFIIRIIS 516
            ++K ++ +Y +   LRYY+ KFG D FLSPFI+ +++
Sbjct: 479 FVSKFDDLMYRQTPVLRYYVNKFGNDAFLSPFILNLLA 516

>NDAI0B05710 Chr2 (1389267..1390958) [1692 bp, 563 aa] {ON}
           Anc_5.441 YDR371W
          Length = 563

 Score =  564 bits (1454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/480 (56%), Positives = 354/480 (73%), Gaps = 36/480 (7%)

Query: 65  DEGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMD 124
           +  + SG+YYS WSPY PR HFPHDID +K++H+YY+FFL++G TG++  SDEWSD +MD
Sbjct: 90  NNTFVSGVYYSSWSPYKPRYHFPHDIDLTKITHVYYSFFLVNGATGDVTCSDEWSDLKMD 149

Query: 125 LYKPLAVKLNQLQLK------------NDDVHASMGVLPKGCVGELFYLRHTGILDRDKG 172
           LYKPL++KLN L               N+ +      LP GCVGELFYL+        K 
Sbjct: 150 LYKPLSLKLNTLHQNDKVLHDKNKTRLNETIEKMKKQLPLGCVGELFYLK--------KF 201

Query: 173 RHFKVMMAVGGWSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFE 232
           ++FK++M++GGWSNR+ +P MVRD  ++  FI S VE MFKYGFDGIDLDWEFP++DGFE
Sbjct: 202 QNFKLIMSIGGWSNREHFPSMVRDDNKLNQFIESSVEQMFKYGFDGIDLDWEFPEDDGFE 261

Query: 233 PRMYLELARKMRLKFDELEEVIFAGEP----------NHPKFQLSMATPAFKDKLNVLPI 282
           P  YLE+ +++R + D+LE  IF              +HPKF+LS+ATPAF +KLN+LPI
Sbjct: 262 PGKYLEIVQRLRKRMDKLEHDIFQKSKISPHDYDHDYHHPKFELSVATPAFIEKLNILPI 321

Query: 283 KELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYDGPVK--VHSQYKHDSSSDDEGLDANSA 340
           KE+++YID WNMMTYDY+G+WS  TGYHCNLY+G     +++QYKH+ +S ++GL+AN A
Sbjct: 322 KEMNKYIDYWNMMTYDYYGDWSEETGYHCNLYEGGNNGTINAQYKHEHTSSNKGLNANDA 381

Query: 341 ISDMINRFGVDSRKITLGMAAYGRGFTHVKASSNDKRFIDKSFHGVGGASEGEPGMWLYN 400
           I+ M+    V SRK+ LG+AAYGRGFT VK + ND+ FI+K F GVGGAS GEPGMWLYN
Sbjct: 382 INYMLYNNNVSSRKLVLGLAAYGRGFTKVKVNKNDELFINKKFDGVGGASAGEPGMWLYN 441

Query: 401 QLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGD 460
           QLPIK SKE +DP YVS FC+D KTKTFVGYDNV+++KVKA YV++  L GGFWWESCGD
Sbjct: 442 QLPIKNSKEMFDPNYVSAFCYDPKTKTFVGYDNVDTMKVKAKYVQDRHLAGGFWWESCGD 501

Query: 461 NHIDPQRSLLNAFTGR--IKTIAKNENS--VYHKPEALRYYLEKFGQDEFLSPFIIRIIS 516
           +H  P+RSLLNAFT +  +K + K E+S  +Y +P+ ++YYL  FG D FLSPF I+I+S
Sbjct: 502 DHKHPERSLLNAFTNQLEVKHLMKYEDSHLIYEQPDTIKYYLNYFGNDGFLSPFFIQIMS 561

>Kpol_1062.25 s1062 complement(56775..58376) [1602 bp, 533 aa] {ON}
           complement(56775..58376) [1602 nt, 534 aa]
          Length = 533

 Score =  558 bits (1437), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/508 (53%), Positives = 363/508 (71%), Gaps = 21/508 (4%)

Query: 25  EMCFYRKIFK-SSAEHDVLDHVHEVGDGSLQQFKDHHTVIGDEGYTSGLYYSDWSPYPPR 83
           E   Y+K  K  S E  + D ++E      + F ++     D GY  G+YYS+WSPY PR
Sbjct: 24  ESFLYQKFLKHGSKEESIEDSINESQIVYGKSFPNN----PDSGYDVGVYYSNWSPYTPR 79

Query: 84  KHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQLQLKNDDV 143
            H PHD+DFS+++H+YYAFF++D  TG L +SD WSDF+MD YKPLA+KL +LQL +   
Sbjct: 80  LHLPHDMDFSRLTHVYYAFFVVDSKTGALTTSDNWSDFEMDCYKPLAMKLKKLQLDHFFN 139

Query: 144 HASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQWPKMVRDPRRVENF 203
                 LP GC+GELFYLRH+ + D +  R FK++M+VGGWSNR+ +P+M+RD ++++ F
Sbjct: 140 PKFKNGLPMGCIGELFYLRHSQLFDSNNSRKFKLIMSVGGWSNREAFPRMIRDSKKLDAF 199

Query: 204 INSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDELEEVIF--AGEPNH 261
           +NSC+E MF YGFDGI+LDWEFP++D  EP+MYLEL +K++ K +ELE+ IF  +G  NH
Sbjct: 200 VNSCIENMFNYGFDGIELDWEFPKDDKLEPKMYLELVKKLKWKQNELEQKIFNNSGNGNH 259

Query: 262 ---PKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYD--- 315
              PKF LS+A PAFK+KL++L ++E+D Y+DVWNMMTYDYHGEWS  TGYH NLY    
Sbjct: 260 SKRPKFHLSIAAPAFKEKLDILLMREMDHYVDVWNMMTYDYHGEWSEKTGYHSNLYSPQE 319

Query: 316 --------GPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFT 367
                         ++   D   D+  L+ + AI+ +I ++ ++ +KI LGMAAYGRGFT
Sbjct: 320 TRNEDDDDDDRDEDNEDDDDDEDDESNLNGDYAINYVIKKYHINPKKINLGMAAYGRGFT 379

Query: 368 HVKASSNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKT 427
            V ASS D RFI+K + GVGGASEGEPGMWLYNQLPIK S EE+DP+YVS FC+D K+KT
Sbjct: 380 KVNASSQDTRFINKPYRGVGGASEGEPGMWLYNQLPIKNSLEEFDPDYVSAFCYDKKSKT 439

Query: 428 FVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAKNENSV 487
           FVGYDN +S+KVKA YVKE  L+GGFWWESCGD+H +P++SLLNAFT  I ++ +   ++
Sbjct: 440 FVGYDNRDSMKVKAQYVKEHNLKGGFWWESCGDDHKNPEKSLLNAFTDEIGSVTEKNETM 499

Query: 488 YHKPEALRYYLEKFGQDEFLSPFIIRII 515
           +   E L+YYL+  G   FLS FI++++
Sbjct: 500 FTNIEVLKYYLKTKGDTGFLSTFIMKLL 527

>NCAS0F03420 Chr6 (689091..690668) [1578 bp, 525 aa] {ON} Anc_5.441
           YDR371W
          Length = 525

 Score =  545 bits (1403), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/498 (53%), Positives = 350/498 (70%), Gaps = 13/498 (2%)

Query: 25  EMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQ----FKDHHTVIGDEGYTSGLYYSDWSPY 80
           +MC ++  FK  A  D++      G    +Q      +     G++GY SGLYYS WSPY
Sbjct: 27  QMCLHKLYFKQKATQDLIQSHFRNGTIPNRQEIDYLMNQTNSNGEKGYLSGLYYSSWSPY 86

Query: 81  PPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQLQLKN 140
            PR HFPHDID ++VSHIYYAFFL+D  TG+L  SDEWSD QMDLYKPL+VKL+ L L +
Sbjct: 87  KPRFHFPHDIDLTRVSHIYYAFFLVDPKTGKLNPSDEWSDLQMDLYKPLSVKLHNLNLAD 146

Query: 141 DDVHASMG---VLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQWPKMVRDP 197
           ++    +     LP GC+GELFYL+H+GI+    G   K+++++GGWSNRD++P +VRD 
Sbjct: 147 NEKPVQLRDKRKLPLGCIGELFYLKHSGIIP--GGSSTKMILSIGGWSNRDRFPGLVRDT 204

Query: 198 RRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDELEEVIFAG 257
           R+ ENFI+S VETMF+YGFDGIDLDWEFP++DG EP  YLE+  K+R K D+LE  IF  
Sbjct: 205 RKFENFIDSAVETMFRYGFDGIDLDWEFPKDDGLEPNKYLEMISKLRRKMDDLELEIFGE 264

Query: 258 EPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYDGP 317
             +HPKFQLS+ATPAF  KL++LPI ++D+Y+D WNMMTYDY+G WS  TGYHCNL++G 
Sbjct: 265 TKDHPKFQLSVATPAFIYKLSILPIIQMDQYVDYWNMMTYDYYGSWSEATGYHCNLFNGD 324

Query: 318 -VKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKASSNDK 376
             +  + YKH+ ++ + GL+AN AI  MI    V S K+ LGMAAYGR F HVK+     
Sbjct: 325 GSEFRAGYKHEHTAHNNGLNANEAIDFMIKSCNVPSSKVVLGMAAYGREFKHVKSRQGVD 384

Query: 377 RFIDKSFHGVGGASEG-EPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYDNVE 435
             I++ F GVG    G EPGMWLYNQLP+KG+ E YDP Y + FC+D K++TF+GYDNV+
Sbjct: 385 TLINQKFKGVGKGGLGDEPGMWLYNQLPLKGTVEMYDPNYGAAFCYDKKSETFIGYDNVD 444

Query: 436 SVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAK--NENSVYHKPEA 493
           SVK+KA YV+   L GGFWWESCGD+HI+ +RSLL  F+  +  I K  +++ ++ + E 
Sbjct: 445 SVKLKAQYVQTRELGGGFWWESCGDDHINKRRSLLYNFSNEVTEIRKFSDQDLIFRRKEC 504

Query: 494 LRYYLEKFGQDEFLSPFI 511
           + YYL ++G D FLS  +
Sbjct: 505 IAYYLNRYGTDGFLSGIL 522

>TBLA0A02790 Chr1 complement(672252..673895) [1644 bp, 547 aa] {ON}
           Anc_5.441 YDR371W
          Length = 547

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 261/529 (49%), Positives = 365/529 (68%), Gaps = 45/529 (8%)

Query: 25  EMCFYRKIFKSSAEHDVLDHVH-----EVGDGSLQQFKDHH----TVIGDEGYTSGLYYS 75
           EMCFY K+F    E  VL+ +      E  +    + KD+     TV   +GYTSG+YYS
Sbjct: 25  EMCFYDKLFNKKKEQQVLNQLQPPTKIEPLNNVDNEIKDNKNTNLTVANPQGYTSGVYYS 84

Query: 76  DWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQ 135
           +WSPY PRKHFPHDIDFS++SH+YY+FFL++G  G+++  D+WSD +MDLYKPL++KL +
Sbjct: 85  NWSPYSPRKHFPHDIDFSRISHVYYSFFLVNGDNGKVELGDKWSDIEMDLYKPLSIKLGK 144

Query: 136 LQLKND-----DVHASMGV-LPKGCVGELFYLRHTGIL---DRDKGRHFKVMMAVGGWSN 186
           L+ K D        +++   LPKGC+GE FYLR++ +L   + +  ++FK++M +GGWSN
Sbjct: 145 LKNKVDVYEEPQTQSTIKTNLPKGCIGEFFYLRNSKLLPTINTENSKNFKMIMTIGGWSN 204

Query: 187 RDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLK 246
           RD +PKM + P+++ NF+ S +E MF+YGFDGIDLDWEFP+N+  EP +YL++ +++R  
Sbjct: 205 RDSFPKMAKSPQKIHNFVTSAIEMMFEYGFDGIDLDWEFPKNNTQEPAVYLKIMQQLRQG 264

Query: 247 FDELEEVIFAGEP----NHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGE 302
            +ELEE I+            FQLS+A+PAF++KL+VLPIKE+++ +D WNMMTYDY+GE
Sbjct: 265 MNELEEEIYKNSAVPVEERKHFQLSVASPAFEEKLSVLPIKEMNKVLDYWNMMTYDYNGE 324

Query: 303 WSPVTGYHCNLYDGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAY 362
           WS  TGYH NLYDG     S+ KHD    +E L+A+SAI  MI   GV+  K+ LG+A Y
Sbjct: 325 WSEKTGYHSNLYDG-----SKVKHD----EEVLNADSAIKYMIETQGVEPNKLVLGLAGY 375

Query: 363 GRGFTHVKAS--------------SNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSK 408
           GRG+T+V  +              + D+ FID  + GVGG SEGEPGMW+YNQLPIKGS 
Sbjct: 376 GRGYTNVNVNHIQGFGKNNKERELTGDEVFIDLEYKGVGGESEGEPGMWMYNQLPIKGSI 435

Query: 409 EEYDPEYVSGFCFDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRS 468
           E++DP++VS +C+D KT T V YDNVES+ VK  YVK+ GL GGF WESCGD H +P+RS
Sbjct: 436 EQFDPKFVSAYCYDLKTNTLVTYDNVESMNVKGQYVKDKGLAGGFMWESCGDVHDNPKRS 495

Query: 469 LLNAFTGRIKTIAKNENSVYHKPEALRYYLEKFGQDEFLSPFIIRIISK 517
           L+ AFT  +  I K E+S++   +   +YLE+FG + +LS  I ++++K
Sbjct: 496 LITAFTNELGKIKKQESSIFQDEKTFEFYLEEFGNEGYLSEAIAKLLNK 544

>SAKL0G02684g Chr7 (220460..222079) [1620 bp, 539 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 539

 Score =  517 bits (1331), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 242/452 (53%), Positives = 327/452 (72%), Gaps = 13/452 (2%)

Query: 66  EGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDL 125
           + Y SG+YY++WSPY PR HFPHD++F ++++++Y+FF++D  +G +KSSDEWSDFQMDL
Sbjct: 87  QSYISGVYYTNWSPYAPRNHFPHDMNFHRITNVFYSFFVVDPKSGTVKSSDEWSDFQMDL 146

Query: 126 YKPLAVKLNQLQLKNDDVHASMG----VLPKGCVGELFYLRHTGILDRDKG----RHFKV 177
           YK    +     L +            +LP GC+GELFYL+++ IL    G    R+FKV
Sbjct: 147 YKKFYPQFKAALLSSSSSSTFQSHKKEMLPMGCIGELFYLKYSSILPSLHGDGVHRNFKV 206

Query: 178 MMAVGGWSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYL 237
            M+VGGWSNRD +P +VRD  + + FI +CVETMF+YGFDG+D+DWEFPQNDG EP+MYL
Sbjct: 207 SMSVGGWSNRDAFPIIVRDKNKFDTFIRTCVETMFQYGFDGLDIDWEFPQNDGLEPKMYL 266

Query: 238 ELARKMRLKFDELEEVIFAGEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTY 297
            + R++R   D+LE  IF  E +   F L++A PAFK+KL VLP++++D Y+D WN+M Y
Sbjct: 267 TMIRRLREALDDLERDIFQDEHHSEHFFLTVAVPAFKEKLQVLPLRDMDAYVDFWNLMAY 326

Query: 298 DYHGEWSPVTGYHCNLY-DGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKIT 356
           DYHGEWS +TGYH NLY +    VH ++  D   ++  L+A+SA+  ++  FG++SRK+ 
Sbjct: 327 DYHGEWSELTGYHSNLYSEDSNHVHRRHFRD---EENQLNADSAVKYLLKNFGINSRKVV 383

Query: 357 LGMAAYGRGFTHVKASSNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYV 416
           LGMAAYGRGFT VK ++N   +I K ++GVGGASEGEPGMWLYNQLP+ G+ E +DP  V
Sbjct: 384 LGMAAYGRGFTRVKTTANSGSYIGKPYNGVGGASEGEPGMWLYNQLPLPGTLENFDPRSV 443

Query: 417 SGFCFDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGR 476
           S + FD K+KTFVGYDNV+S++ KA YVK   L GGFWWESCGDNH D Q+SLLNAFT  
Sbjct: 444 SAYSFDPKSKTFVGYDNVDSMRCKAQYVKNHNLAGGFWWESCGDNHKDEQKSLLNAFTND 503

Query: 477 IKTIAKNENSVYHKPEALRYYLEKFGQDEFLS 508
           + ++AK + S+Y     +RYYL+ + Q  FLS
Sbjct: 504 LGSLAKQQPSIYTSAHVIRYYLKNYPQG-FLS 534

>TPHA0E01720 Chr5 complement(348101..349714) [1614 bp, 537 aa] {ON}
           Anc_5.441 YDR371W
          Length = 537

 Score =  504 bits (1298), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 238/457 (52%), Positives = 328/457 (71%), Gaps = 8/457 (1%)

Query: 68  YTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYK 127
           Y+ G+YYS+WSPY PR  FPHDID S+VSH+YY+F L+DG  G +KSSD WSDFQ+D+YK
Sbjct: 78  YSMGVYYSNWSPYSPRLFFPHDIDTSRVSHVYYSFLLVDGDEGTIKSSDTWSDFQIDMYK 137

Query: 128 PLAVKLNQLQLKNDDVHASMG--VLPKGCVGELFYLRHTGI-LDRDKGRHFKVMMAVGGW 184
           PL + L Q+    D V  SM   +LP GC+GE FYLR+T I +   K   FKV M+VGGW
Sbjct: 138 PLYLSLGQVDNDFDSVPISMKKELLPMGCIGEFFYLRNTRIPIHGPKSTDFKVFMSVGGW 197

Query: 185 SNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMR 244
           SNR+ +PKMVRDP++V+ FINSC++TMF YGFDGIDLDWEFP++DGFEP MYL++ ++++
Sbjct: 198 SNREAFPKMVRDPQKVDKFINSCIDTMFMYGFDGIDLDWEFPEDDGFEPMMYLDIIKRLK 257

Query: 245 LKFDELEEVIFAGEPNH----PKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYH 300
           +K  ELE  I+    +H    P F+LS+A PAF +KL +LP++++D+++D WNMMTYDY 
Sbjct: 258 MKMLELEATIYKDAISHNTSYPHFELSIAAPAFDEKLRILPVQQMDKFVDKWNMMTYDYS 317

Query: 301 GEWSPVTGYHCNLYDGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMA 360
           GEWS VTGYH NL+  P    S  K   S+ +E L  ++A+  M +   + SRKI LGMA
Sbjct: 318 GEWSDVTGYHSNLFSPPDVSGSVMKRSQSNSNETLCGDNAVKYMKDNLKISSRKIILGMA 377

Query: 361 AYGRGFTHVKASSNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFC 420
           AYGRGF+ V  S  + +   K F+GV G+S  EPG+WLYN+LPIKGSKEE+D E VS +C
Sbjct: 378 AYGRGFSGVSKSKTNGKLTGKKFNGVSGSSPDEPGVWLYNKLPIKGSKEEFDKESVSAYC 437

Query: 421 FDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTI 480
           +D K+K FV YDN +S+ +K+ YV++  L GGF WE+CG+   +P+ SL+N+FT  +  I
Sbjct: 438 YDPKSKIFVAYDNSQSMVIKSKYVRDNNLGGGFLWEACGEKLNNPKLSLINSFTFDMNNI 497

Query: 481 AKNENSVYHKPEALRYYLEKFGQDEFLSPFIIRIISK 517
            K + S++   + L YYL K+G+  FLS +I+ ++++
Sbjct: 498 DK-QKSMFSNRKVLEYYLMKYGKQGFLSGYILSVLNR 533

>CAGL0A02904g Chr1 (302938..304443) [1506 bp, 501 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371w
          Length = 501

 Score =  499 bits (1285), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 247/459 (53%), Positives = 323/459 (70%), Gaps = 9/459 (1%)

Query: 62  VIGDEGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDF 121
           V+ +  Y +GLYYS+WSPY PR HFPHDIDF KVSHIYYAF LID  TG L SSDEWSD 
Sbjct: 50  VLSNTSYIAGLYYSNWSPYEPRLHFPHDIDFEKVSHIYYAFLLIDPETGNLTSSDEWSDT 109

Query: 122 QMDLYKPLAVKLNQLQLKNDDVHASMGV-LPKGCVGELFYLRHTGILDRDKGRHFKVMMA 180
           Q++L K     + + +   D++ A   +  P GC+GEL YLR+  I  + K R+ K++M+
Sbjct: 110 QLNLAKQCREYMFK-RFTGDELKAVTNIRAPPGCIGELNYLRY--IYSKIKKRNVKLIMS 166

Query: 181 VGGWSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELA 240
           VGGWSNR+ +P MVRD  + +NFINSC+ETM  YGFDGIDLDWEFP++D +EP  YL +A
Sbjct: 167 VGGWSNRESFPIMVRDELKFKNFINSCIETMVYYGFDGIDLDWEFPEDDSYEPDAYLRMA 226

Query: 241 RKMRLKFDELEEVIFAGEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYH 300
           R+++L+  +LE  I  G+ ++  FQLSMATPAFKDKL++LPI +LD+YID+WN+MTYDY+
Sbjct: 227 RELKLQLQKLEANIL-GDHSNKTFQLSMATPAFKDKLSILPIHKLDKYIDLWNLMTYDYY 285

Query: 301 GEWSPVTGYHCNLYDGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMA 360
           GEWS  TG H NLY+   K+   ++HD   +D GL  ++AI+ M+NR  +D RK+ LGMA
Sbjct: 286 GEWSERTGLHANLYNEKGKLLHLHRHD---EDAGLSGDAAINYMVNRCKIDPRKVILGMA 342

Query: 361 AYGRGFTHVKA-SSNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGF 419
           AYGRGFT+V   S+N        F GVGGASEGEPGMWLYNQLPI GS E+YD  +V  +
Sbjct: 343 AYGRGFTNVDMKSTNPHNPYGLKFSGVGGASEGEPGMWLYNQLPIPGSNEKYDYRHVGAY 402

Query: 420 CFDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKT 479
           C+D +T T VGYDN  SV  KA+Y+    L G FWWESCGD H +P+RSLLN +   I+ 
Sbjct: 403 CYDDRTHTLVGYDNPTSVIEKANYIMSNSLGGAFWWESCGDTHKNPKRSLLNTYIRVIRN 462

Query: 480 IAKNENSVYHKPEALRYYLEKFGQDEFLSPFIIRIISKS 518
           +  N+ ++Y   +   YYLE +  + FL+ FI  II +S
Sbjct: 463 VKNNKETIYSTTKLHDYYLENYDTNGFLTGFIKDIIQES 501

>Suva_2.543 Chr2 (970024..971559) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  473 bits (1218), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 235/498 (47%), Positives = 317/498 (63%), Gaps = 34/498 (6%)

Query: 25  EMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFKDHHTVIGDEGYTSGLYYSDWSPYPPRK 84
           EMC Y K+FK+    D+ D+            ++      D+GY SG+YYS+WSPY PR 
Sbjct: 30  EMCLYNKLFKNQRSEDIRDNFQNGRHQVPNMVQNQKPSGDDDGYVSGVYYSNWSPYKPRF 89

Query: 85  HFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQLQLKNDDVH 144
           HFPHDI+  +VSH+YYAFF ID  TG + S+D WSD +MDLYKPLA+K +QL   N D +
Sbjct: 90  HFPHDINLEQVSHVYYAFFRIDPKTGCIGSTDSWSDLEMDLYKPLAIKASQLVDDNLDDN 149

Query: 145 ASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQWPKMVRDPRRVENFI 204
               +LP GC+GELFYL++        GR FK +M++GGWS+ + +  +V++ + ++NF+
Sbjct: 150 NMQSILPLGCIGELFYLKNAC-----SGRKFKSIMSIGGWSDSENFKTIVKNEKLLQNFV 204

Query: 205 NSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDELEEVIFAGEPNHPKF 264
           +S VETMFK GFDGID+DWEFP+N+  EP+ YL+L R +RLK + LE  IF G      F
Sbjct: 205 DSSVETMFKLGFDGIDIDWEFPENNKVEPQGYLKLVRMLRLKLNSLESQIFGGS-TKDHF 263

Query: 265 QLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYDGPVKVHSQY 324
           +LS+A PAFKDKL  LPI E+D+YID WNMMTYDY+G WS  TGYH NL+          
Sbjct: 264 ELSIAAPAFKDKLYFLPIAEIDQYIDHWNMMTYDYYGSWSETTGYHSNLFS--------- 314

Query: 325 KHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKAS-----SNDKRFI 379
                  +  L  N AI  MI  FGV+ RK+ LGMAAYGR F H+K       + +   I
Sbjct: 315 -------ETELSGNFAIHYMIGEFGVNPRKLVLGMAAYGRSF-HIKDDKFRPFTKNTVLI 366

Query: 380 DKSFHGVGG------ASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYDN 433
           ++ F GVG        ++G+ G+W Y  LP KG+ E+YDP+YVS +CFD K   F+GYDN
Sbjct: 367 NQQFKGVGKPGKEIDKADGKEGIWPYKNLPKKGTTEQYDPKYVSAYCFDEKNSIFIGYDN 426

Query: 434 VESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAKNENSVYHKPEA 493
            ES+K KADYV    L GGFWWESCG+++ D  RSL+NAF   +     ++ S++     
Sbjct: 427 TESIKTKADYVMHTELGGGFWWESCGEDYADKSRSLINAFNEALHFNVSSKPSMFQDKRV 486

Query: 494 LRYYLEKFGQDEFLSPFI 511
           ++YYL K+G   FL+P++
Sbjct: 487 MKYYLSKYGDGGFLAPYL 504

>Skud_4.640 Chr4 (1142282..1143817) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  471 bits (1213), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 236/498 (47%), Positives = 322/498 (64%), Gaps = 35/498 (7%)

Query: 25  EMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFKDHHTVIGDEGYTSGLYYSDWSPYPPRK 84
           EMC Y KIFKS    D+ D+    GD      ++     G +GY SG+YYS+WSPY PR 
Sbjct: 30  EMCLYNKIFKSQRSDDIRDNFRNGGDQVPSMVQNQKPHDGGKGYVSGVYYSNWSPYTPRF 89

Query: 85  HFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQLQLKNDDVH 144
           HFPHDI+  +VSH+YYAFF I+  TG ++S+D WSD +M+LYKPLA+K +QL ++N+   
Sbjct: 90  HFPHDINLMQVSHVYYAFFRINSKTGGIESTDSWSDLEMNLYKPLAIKSSQL-VENNLND 148

Query: 145 ASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQWPKMVRDPRRVENFI 204
           +   +LP GCVGELFYL++         + FKV+M++GGWS+ + +  +V D + ++NF+
Sbjct: 149 SVQNILPLGCVGELFYLKNAC-----SEKKFKVIMSIGGWSDSENFKTIVGDDKLLQNFV 203

Query: 205 NSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDELEEVIFAGEPNHPKF 264
           +S VETMFK GFDGID+DWEFP+N+  EP+ YL+L + +RLK + LE  IF GE     F
Sbjct: 204 DSSVETMFKLGFDGIDIDWEFPENNKIEPQGYLKLVKMLRLKLNNLESQIF-GESIEDHF 262

Query: 265 QLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYDGPVKVHSQY 324
           Q+S+A PAFKDKL  LPI E+D+YID WNMMTYDY+G WS  TGYH NL+          
Sbjct: 263 QISIAAPAFKDKLFFLPISEIDQYIDYWNMMTYDYYGSWSETTGYHSNLFS--------- 313

Query: 325 KHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKAS-----SNDKRFI 379
                  +  L  N A+  MI+ F VDS K+ LGMAAYGR F H+K S     + +   I
Sbjct: 314 -------ETELSGNFAMHYMIDEFSVDSSKLVLGMAAYGRSF-HIKDSKFQPFTQNTVLI 365

Query: 380 DKSFHGVGG------ASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYDN 433
           ++ F GVG        ++G+ G+W Y  LP KG+ E+YDP+YVS +CFD K   F+ YDN
Sbjct: 366 NQHFKGVGKPGKEIDKADGKEGIWPYKSLPKKGTIEQYDPKYVSAYCFDEKNSIFISYDN 425

Query: 434 VESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAKNENSVYHKPEA 493
            +S K KA+YV    L GGFWWESCG+ H +  RSL+NAF   I+    ++ S++     
Sbjct: 426 TKSAKTKAEYVMHNKLGGGFWWESCGEAHTNKSRSLINAFNEGIRFNVSSKPSMFQDMRV 485

Query: 494 LRYYLEKFGQDEFLSPFI 511
           +++YL K+G D FLSP++
Sbjct: 486 IKFYLNKYGDDGFLSPYL 503

>YDR371W Chr4 (1219413..1220948) [1536 bp, 511 aa] {ON}
           CTS2Putative chitinase, functionally complements A.
           gossypii cts2 mutant sporulation defect
          Length = 511

 Score =  469 bits (1206), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 235/504 (46%), Positives = 327/504 (64%), Gaps = 35/504 (6%)

Query: 25  EMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFKDHHTVIGDEGYTSGLYYSDWSPYPPRK 84
           EMC Y KIFK+    D+ D+ +  G       ++H T I DE + SG+YYS+WSPY PR 
Sbjct: 30  EMCLYNKIFKNQRSDDIRDNFNNGGHRVPSNVQNHGTHIRDEAFISGVYYSNWSPYKPRF 89

Query: 85  HFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQLQLKNDDVH 144
           HFPHDI+  +VSHIYYAFF I+  TG ++++D WSD +M+LYK LA+K ++L +K    +
Sbjct: 90  HFPHDINLKQVSHIYYAFFKINSRTGGIENTDSWSDLEMNLYKSLAIKNSEL-IKESSNN 148

Query: 145 ASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQWPKMVRDPRRVENFI 204
           +   +LP GC+GELFYL++T        + FKV+M++GGWS+ + +  +++D + ++NF+
Sbjct: 149 SVQNILPLGCIGELFYLKNTC-----SDKKFKVIMSIGGWSDSENFKIIIKDDKLLQNFV 203

Query: 205 NSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDELEEVIFAGEPNHPKF 264
           +S VETMF+ GFDGIDLDWEFP N+  EPR YL+L R +RLK + LE  IF G+     F
Sbjct: 204 DSSVETMFRLGFDGIDLDWEFPGNNESEPRGYLKLVRMLRLKLNSLESQIF-GKRTEDHF 262

Query: 265 QLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYDGPVKVHSQY 324
           QLS+A PAFKDKL  LPI E+D+Y+D WNMMTYDY+G WS  TGYH NL+          
Sbjct: 263 QLSIAAPAFKDKLFYLPITEIDQYVDYWNMMTYDYYGSWSETTGYHSNLFS--------- 313

Query: 325 KHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKAS-----SNDKRFI 379
                  +  L+ N A+  MI+RFGV+SRK+ LGMAAYGR F H+K +     + +   I
Sbjct: 314 -------ETELNGNFAMHYMIDRFGVNSRKLVLGMAAYGRSF-HIKDNKFEPFNQNTVLI 365

Query: 380 DKSFHGVGG------ASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYDN 433
           +K F GVG        ++G+ G+W Y  LP  G+ E+YDP+YVS +CFD K   F+ YDN
Sbjct: 366 NKIFKGVGKPTKEIDKADGKEGIWPYKNLPKIGTIEQYDPKYVSAYCFDEKNSIFISYDN 425

Query: 434 VESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAKNENSVYHKPEA 493
            +SVK KA+YV    L GGFWWESCG+ + +  RSL+NAF   +     ++ S++     
Sbjct: 426 TKSVKTKAEYVTHNNLGGGFWWESCGEAYANESRSLINAFNEGLHFNVSSKPSIFQDVRV 485

Query: 494 LRYYLEKFGQDEFLSPFIIRIISK 517
            +YYL K+G   FLSP++  + S+
Sbjct: 486 KKYYLNKYGDGGFLSPYLKHLDSR 509

>Smik_4.637 Chr4 (1139498..1141033) [1536 bp, 511 aa] {ON} YDR371W
           (REAL)
          Length = 511

 Score =  462 bits (1190), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 230/498 (46%), Positives = 325/498 (65%), Gaps = 35/498 (7%)

Query: 25  EMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFKDHHTVIGDEGYTSGLYYSDWSPYPPRK 84
           EMC Y+KIFK+   + + D  +  G       +     +  EG+ SG+YYS+WSPY PR 
Sbjct: 30  EMCLYKKIFKNQRSNKIRDSFNNGGHKVPNMDQTQGPNVDGEGFVSGVYYSNWSPYKPRF 89

Query: 85  HFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQLQLKNDDVH 144
           HFPHDI+ ++VSH+YYAFF I+  TG ++S+D WSD +M+LYKPLA+K ++L +  +  +
Sbjct: 90  HFPHDINLTQVSHVYYAFFRINPRTGGIESTDNWSDLEMNLYKPLAIKSSEL-IDGNSSN 148

Query: 145 ASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQWPKMVRDPRRVENFI 204
               +LP GC+GELFYL+H+       G+ FKV+M++GGWS+ + +  ++++   ++ F+
Sbjct: 149 DIQKILPLGCIGELFYLKHSC-----SGKKFKVIMSIGGWSDSENFKVIIKNENLLQAFV 203

Query: 205 NSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDELEEVIFAGEPNHPKF 264
           +S VETMFK GFDGIDLDWEFP+N+  EP+ YL+L R +R K + LE  IF GE     F
Sbjct: 204 DSSVETMFKLGFDGIDLDWEFPENNKSEPQGYLKLVRMLRSKLNSLESQIF-GEGVEDHF 262

Query: 265 QLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYDGPVKVHSQY 324
           QLS+A PAFKDKL  LPI E+D+YID WNMMTYDY+G WS  TGYH NL+          
Sbjct: 263 QLSIAAPAFKDKLYYLPIPEIDQYIDYWNMMTYDYYGSWSETTGYHSNLF---------- 312

Query: 325 KHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKAS-----SNDKRFI 379
                S+ E L  N AI  MI++FG++SRK+ LGMAAYGR F H+K S     + +   I
Sbjct: 313 -----SETE-LSGNFAIHYMIDKFGINSRKLVLGMAAYGRSF-HIKGSGFQPFTQNTILI 365

Query: 380 DKSFHGVG------GASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYDN 433
           ++SF GVG        ++G+ G+W Y  LP KG+ E YDP+YVS +CFD K   F+ YDN
Sbjct: 366 NQSFKGVGKLTKEVNKADGKEGIWPYKNLPKKGTIERYDPKYVSAYCFDEKNSIFISYDN 425

Query: 434 VESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAKNENSVYHKPEA 493
            +SVK KA+YV    L GGFWWESCG+ + +  RSL++AF   +++    + S++     
Sbjct: 426 TKSVKTKAEYVLHNKLGGGFWWESCGETYANESRSLIHAFNEGLRSNVSTKPSMFENERV 485

Query: 494 LRYYLEKFGQDEFLSPFI 511
           + +YL K+G + FL+P++
Sbjct: 486 VNFYLNKYGNNGFLTPYL 503

>KNAG0C04870 Chr3 complement(943386..944762) [1377 bp, 458 aa] {ON}
           Anc_5.441 YDR371W
          Length = 458

 Score =  444 bits (1142), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 225/446 (50%), Positives = 291/446 (65%), Gaps = 41/446 (9%)

Query: 65  DEGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMD 124
           ++ Y SG+YYSDWSPY PR HFP +ID SK++HIYY+FFL+D  +  LK  D WSD +M 
Sbjct: 48  NQKYVSGVYYSDWSPYEPRMHFPKNIDTSKITHIYYSFFLVDADSSALKLGDSWSDIEMP 107

Query: 125 LYKPLAVKLNQLQLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGW 184
           + K   +K                    GC+G L  LR       D+   FK +MAVGGW
Sbjct: 108 MGKNTVLK--------------------GCIGALNSLR-------DEKPGFKNIMAVGGW 140

Query: 185 SNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMR 244
           SN+D +P  +R    VE    SCVETMF+YGFDGIDLDWE+P++DG EPR+YLEL RK+R
Sbjct: 141 SNKDAFPLALRKKHGVEKLAQSCVETMFQYGFDGIDLDWEYPKDDGKEPRIYLELMRKIR 200

Query: 245 LKFDELEEVIFAGEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWS 304
              +ELE  I+  +    +F LS+ATPAF DKL   PIKE+D+YID WNMMTYDY+GEWS
Sbjct: 201 QHMNELEIAIWGDKKR--RFHLSVATPAFYDKLETFPIKEMDQYIDYWNMMTYDYYGEWS 258

Query: 305 PVTGYHCNLYDGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGR 364
             TG+H NLYDG  K            +  L A+ AI  M N+ G++SRK+ LGMA YGR
Sbjct: 259 SGTGFHSNLYDGTNKF----------SEHSLCADGAIRYMTNKIGINSRKVVLGMALYGR 308

Query: 365 GFTHVKASSNDKR--FIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCFD 422
           GFT+VK     K    I++ F GVGG SEGEPGMWLYNQLPI+G++E +D +Y S +CFD
Sbjct: 309 GFTNVKEGDPKKTSGLINRKFKGVGGESEGEPGMWLYNQLPIRGTQEVFDEQYGSAYCFD 368

Query: 423 HKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAK 482
            KTKT VGYDNV+S + KA YV+   L GGFWWESCG+   + Q+SL++ F   I+ + +
Sbjct: 369 PKTKTLVGYDNVDSTRQKAQYVRFHNLAGGFWWESCGNKWDNVQQSLVHVFNEDIERLDR 428

Query: 483 NENSVYHKPEALRYYLEKFGQDEFLS 508
           NE ++Y  P+   +YL+ F +  FL+
Sbjct: 429 NETNLYQDPKLREHYLQIFAKSGFLA 454

>KLLA0E02333g Chr5 (215594..217036) [1443 bp, 480 aa] {ON} similar
           to uniprot|Q06350 Saccharomyces cerevisiae YDR371W CTS2
           Sporulation-specific chitinase
          Length = 480

 Score =  432 bits (1110), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 214/451 (47%), Positives = 306/451 (67%), Gaps = 39/451 (8%)

Query: 64  GDEGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQM 123
           G +G++   YYS+WSPY  R H P DI  S+++H+YYAFF++D  +G +KSSD WSDF++
Sbjct: 62  GPDGFSVATYYSNWSPYNARNHKPADIPTSQLTHVYYAFFVVDAKSGAVKSSDSWSDFEL 121

Query: 124 DLYKPLAVKLNQLQLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGG 183
            L                    S+GV  KGC+ EL  ++       +    FK ++ +GG
Sbjct: 122 PL--------------------SVGV--KGCIKELQKIK------LESKHEFKTILCLGG 153

Query: 184 WSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKM 243
           WSNR+ + K+ +  ++V+ FI + V+ MF+YGFDGIDLDWEFP+ D  EP +YLE+ R +
Sbjct: 154 WSNREAYKKIAKSEKKVKKFIETAVDCMFRYGFDGIDLDWEFPEEDSNEPIVYLEMMRGI 213

Query: 244 RLKFDELEEVIF---AGEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYH 300
           R   D+LE  IF   A E +HP FQLS+ATPAF +KLN+LPI E+ +Y+D+WNMM YD+H
Sbjct: 214 REGMDQLERQIFGSPAEEKDHPHFQLSVATPAFAEKLNILPISEMSKYVDIWNMMCYDFH 273

Query: 301 GEWSPVTGYHCNLYDGPVKVHSQYKHDSSS-DDEGLDANSAISDMINRFGVDSRKITLGM 359
           GEWS VTGYH NLY   ++ HS  +  S+   +  L +++A+  M +R  + SR+I LGM
Sbjct: 274 GEWSDVTGYHSNLY---LQGHSHRRSLSNRISNSSLSSDTAVKLMTDRHNISSRRIALGM 330

Query: 360 AAYGRGFTHVKASSNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGF 419
           AAYGRGFT+V+  +ND  ++ K +HGVGG SEGEPG+WLYNQLPI GSKE++D   VS +
Sbjct: 331 AAYGRGFTNVE--TNDDNYLGKKYHGVGGGSEGEPGIWLYNQLPIDGSKEQFDSNAVSAY 388

Query: 420 CFDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKT 479
           CFD K++TFVGYDNV+S+ +K  Y+K+  L GGFWWESCGD+  DP++SL+NAF+  I  
Sbjct: 389 CFDPKSRTFVGYDNVQSMDIKGKYIKKKNLNGGFWWESCGDSK-DPRKSLVNAFSKEI-G 446

Query: 480 IAKNENSVYHKPEALRYYLEKFGQDEFLSPF 510
           +++   S++   +  +++L+K+ +D   S F
Sbjct: 447 LSEGFVSLFKSDKVKQFHLQKYPKDYISSLF 477

>KAFR0E03810 Chr5 complement(756701..758173) [1473 bp, 490 aa] {ON}
           Anc_5.441 YDR371W
          Length = 490

 Score =  432 bits (1110), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 220/456 (48%), Positives = 297/456 (65%), Gaps = 38/456 (8%)

Query: 65  DEGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMD 124
           +  ++ GLYYS+WS Y PR HFPH+I+F  +SH+YYAFFL+DG  G+L S D+W+DFQ  
Sbjct: 55  NRSFSCGLYYSNWSAYEPRLHFPHEINFDHISHVYYAFFLVDGKNGKLVSGDKWADFQ-- 112

Query: 125 LYKPLAVKLNQLQLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGW 184
             +P+        LKN+        L KG VGELF L+             K +M +GGW
Sbjct: 113 --RPI--------LKNNK-------LVKGNVGELFDLKMK--------NRVKCIMCIGGW 147

Query: 185 SNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMR 244
           SNR+ W     DP ++E+F    V+ MF+YGFDGIDLDWE+P++DG EP++YLE+ R+++
Sbjct: 148 SNREAWHIFSTDPSKIESFTEQAVKMMFEYGFDGIDLDWEYPEDDGIEPQLYLEIMRRIK 207

Query: 245 LKFDELEEVIFA-GEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEW 303
              ++LE  IF         F+LS+ATPAFKDKL + P+KE+D  ID WNMMTYDY+GEW
Sbjct: 208 HHMNKLESEIFKDTSATTSYFELSVATPAFKDKLEIFPLKEMDTVIDYWNMMTYDYYGEW 267

Query: 304 SPVTGYHCNLYDGP---VKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMA 360
           S  TGYH NLYDG      + S  +H   S+ EGL+ + A+  MIN+ G+   KI LGMA
Sbjct: 268 SERTGYHSNLYDGSKGSTTIESVLRH-GMSEVEGLNGDYAVKYMINQ-GIKKDKIILGMA 325

Query: 361 AYGRGFTHVKASS----NDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYV 416
           AYGRGFT+V   +       R+I ++F GVGGASEGEPGMW Y+QLPI G+ E++DP YV
Sbjct: 326 AYGRGFTNVDVPTPRPNESPRYIGRTFDGVGGASEGEPGMWRYDQLPIPGTVEQFDPRYV 385

Query: 417 SGFCFDHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGR 476
           SG+CF+  T TFVGYD ++SV+VK  Y+K   + GGFWWESCGD H +P+RSL+NA+   
Sbjct: 386 SGYCFEPTTGTFVGYDTIDSVRVKTQYIKMKDIGGGFWWESCGDTHKNPERSLVNAYVKE 445

Query: 477 I-KTIAKNENSVYHKPEALRYYLEKFGQDEFLSPFI 511
           + +   K   S+Y     + +Y + F    FLS ++
Sbjct: 446 LGRDNIKKPESIYKNLHCVSHYKQSFHGKGFLSKYL 481

>Kwal_55.21402 s55 complement(821930..823480) [1551 bp, 516 aa] {ON}
           YDR371W (CTS2) - chitinase [contig 130] FULL
          Length = 516

 Score =  421 bits (1083), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 213/465 (45%), Positives = 296/465 (63%), Gaps = 17/465 (3%)

Query: 57  KDHHTVIGDE-GYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSS 115
           KD+  +I  E G TSG+YYS+WSPY  RKHFPHDIDF +++ ++Y+F +++G TGE + S
Sbjct: 59  KDNSLLISSERGLTSGIYYSNWSPYKARKHFPHDIDFRRLTEVFYSFLVVNGETGECQLS 118

Query: 116 DEWSDFQMDLYKPLAVKLNQLQLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKG--- 172
           DEWSD QMDLYK +     ++ LK     +S   LP GC+GELFYL++T  L +  G   
Sbjct: 119 DEWSDVQMDLYKQMFSAFEKVDLKRQFPQSSRNDLPLGCIGELFYLKYTDFLSKMGGPED 178

Query: 173 -RHFKVMMAVGGWSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGF 231
            ++FK +M+VGGWSNR+ +  +V+ P +++ FINSCV+ MFKYGFDGID+DWEFP+ND  
Sbjct: 179 VKNFKTIMSVGGWSNREAFESLVQSPAKMKVFINSCVDQMFKYGFDGIDIDWEFPKNDST 238

Query: 232 EPRMYLELARKMRLKFDELEEVIFAGEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDV 291
           EP+ YL++ R +R K D+LE  IF  E +   F L+ A  A    L  LP+ E+DRY+D 
Sbjct: 239 EPKAYLDMMRSLRKKLDDLESDIFGTEKHTQHFLLTSAISADPSCLEYLPLGEIDRYVDQ 298

Query: 292 WNMMTYDYHGEWSPVTGYHCNLYDGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVD 351
           WN+M YD+ G WS  T Y  NLY              S + EG  A++A+  ++N+  + 
Sbjct: 299 WNLMAYDFSGAWSRHTAYQSNLYS------RSSLGKRSENSEGGSADTAVRLLLNKHKLP 352

Query: 352 SRKITLGMAAYGRGFTHVKAS-SNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEE 410
           ++KI LGM AYGRGF  V     ++   I +SF  V G SEGE G+ LYNQLP+KG +E 
Sbjct: 353 AKKIVLGMPAYGRGFKGVSVPHHSEHNVIGQSFQQVSGLSEGESGISLYNQLPLKGGQEW 412

Query: 411 YDPEYVSGFCF----DHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQ 466
           +D + VS +      + +    V YDNV+S+K+KA YV +  L GGFWWESCG+N++D  
Sbjct: 413 FDQDAVSAYSVKLASNKEMAELVVYDNVQSMKIKAQYVLKNNLGGGFWWESCGENYLDNS 472

Query: 467 RSLLNAFTGRIKTIAKNENSVYHKPEALRYYLEKFGQDEFLSPFI 511
           RSL  AFT  IK + K   ++Y  P+   YY +K+  D FL+  I
Sbjct: 473 RSLTRAFTQEIKYLNKTVPTIYALPQVGEYYHKKY-PDGFLASII 516

>Ecym_4512 Chr4 (1022092..1023675) [1584 bp, 527 aa] {ON} similar to
           Ashbya gossypii ACL166W
          Length = 527

 Score =  416 bits (1070), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 225/495 (45%), Positives = 320/495 (64%), Gaps = 49/495 (9%)

Query: 25  EMCFYRKIF-------KSSAEHDVLDHVHEVGDGSLQQFKDHHTVIGDEGYTSGLYYSDW 77
           EM F  K+        +S  E   L  +    D +LQ  K          Y  G+YY+ W
Sbjct: 23  EMTFIPKLMIEKFKKPRSDIERTALSTITRPVDRNLQHGK----------YAVGVYYTSW 72

Query: 78  SPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQLQ 137
           SPY PR HFPHDIDF +V+++ YAFF++D  TG+++ +D WSD +M  + P         
Sbjct: 73  SPYEPRLHFPHDIDFKRVTNVNYAFFVVDPKTGKVQPTDSWSDLEMPSHAP--------- 123

Query: 138 LKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQWPKMVRDP 197
                     GV   G +GEL YL+    L R+   +F++ MAVGGWSNR+ +PK+VR  
Sbjct: 124 ------GIPQGV--TGMIGELNYLK----LQRNT--NFRLFMAVGGWSNREAFPKIVRSE 169

Query: 198 RRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDELEEVIF-A 256
            +++NF+NS ++ MF+YGFDGIDLDWEFP++DG+EP MYLE+  ++R K D+LE+ I+ A
Sbjct: 170 EKLKNFVNSTIDAMFEYGFDGIDLDWEFPKDDGYEPGMYLEMCSRLRSKMDKLEDEIWGA 229

Query: 257 GEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYDG 316
              ++PKF+LS+ATPAF   L +LPI E+++++ +WNMMTYD+HG WS  TGYH NLYDG
Sbjct: 230 NNTDYPKFELSVATPAFSQTLKILPIIEMNKFVSIWNMMTYDFHGSWSKRTGYHSNLYDG 289

Query: 317 PVK----VHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKAS 372
                     +++     D+EGL+A+ AI  M+  F V ++K+ LGM AYGRGFT+V+  
Sbjct: 290 NKNNDELKKRRFEGMVIDDNEGLNADDAIKIMVENFKVHAKKVRLGMPAYGRGFTNVQTK 349

Query: 373 SNDKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYD 432
            +D   ++K + GVGG SEGEPG+WLYNQLP+  + E++D  +VS +CFD   KTFVGYD
Sbjct: 350 DDDD-LLNKKYSGVGGGSEGEPGIWLYNQLPLANTAEKFDDRWVSAYCFDKNLKTFVGYD 408

Query: 433 NVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAKNENSVYHKPE 492
           N++S++VK+DYVK+  L GGF+WESCGD H DP+R+L+ AF+  +  +     +++  P 
Sbjct: 409 NIQSMEVKSDYVKQKHLSGGFFWESCGDTHNDPKRNLVRAFSQELSEM--RIPTIFKDPR 466

Query: 493 ALRYYLEKFGQDEFL 507
           A+ YYL K  Q  FL
Sbjct: 467 AIAYYL-KHRQKGFL 480

>KLTH0F15906g Chr6 complement(1293832..1295379) [1548 bp, 515 aa]
           {ON} similar to uniprot|Q06350 Saccharomyces cerevisiae
           YDR371W CTS2 Sporulation-specific chitinase
          Length = 515

 Score =  404 bits (1037), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 199/444 (44%), Positives = 286/444 (64%), Gaps = 18/444 (4%)

Query: 65  DEGYTSGLYYSDWSPYPPRKHFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMD 124
           + G+ +G+YYS+WSPY  RKHFPHDIDF K++H+YYAF +++  TGE + SDEWSD QMD
Sbjct: 68  ESGFVTGMYYSNWSPYAARKHFPHDIDFRKLTHVYYAFLVVNSETGECQLSDEWSDVQMD 127

Query: 125 LYKPLAVKLNQLQLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKG----RHFKVMMA 180
           LYK +     +L L+      S   LP GC+GELF+L+++  L R+ G     +FK +M+
Sbjct: 128 LYKQMISSFKKLDLRAQFPTGSKDKLPLGCIGELFFLKYSNFLTRNGGSAGVNNFKTIMS 187

Query: 181 VGGWSNRDQWPKMVRDPRRVENFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELA 240
           VGGWSNR+ +  +V  P ++E F++SCV  MF+YGFDGID+DWEFP+ND  EP++YL++ 
Sbjct: 188 VGGWSNREAFTSLVESPAKLEVFLDSCVSKMFEYGFDGIDIDWEFPKNDAKEPKVYLQML 247

Query: 241 RKMRLKFDELEEVIFAGEPNHPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYH 300
           + +R + D LE  IF  + +   F L+ A  A ++ L  LP++E DRY+D WN+M YD+ 
Sbjct: 248 KALRERLDTLESQIFGSKDHKHHFALTSAISADEECLKYLPLQEADRYVDYWNLMAYDFS 307

Query: 301 GEWSPVTGYHCNLYDGPVKVHSQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMA 360
           G WS  T Y  NLY  P K + +     S++  G  A+ A+  + ++  + S+KI LGM 
Sbjct: 308 GAWSAQTAYQSNLYT-PAKTNKR-----STNGRG-SADKAVRFLTDKSKLASKKIVLGMP 360

Query: 361 AYGRGFTHVKASSND-KRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGF 419
           AYGRGF  V+ S    +  I K F  V G+SEGE G+ LY QLP+KG  E +D   VS +
Sbjct: 361 AYGRGFKGVEVSHKSIENVIGKPFQDVSGSSEGEEGISLYKQLPLKGGMEFFDHNAVSAY 420

Query: 420 CF----DHKTKTFVGYDNVESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTG 475
           C     + K    + YDNV+S+  KA YV++  L GGFWWESCG+++    +SL+ AFT 
Sbjct: 421 CVKLSHNKKQAELIVYDNVDSMIQKAHYVEKNHLGGGFWWESCGEDY--KGKSLVGAFTK 478

Query: 476 RIKTIAKNENSVYHKPEALRYYLE 499
            IK + K E ++Y  PE +++YL+
Sbjct: 479 EIKCLNKTEPTIYSLPEVVQHYLK 502

>ACL166W Chr3 (64828..66300) [1473 bp, 490 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDR371W (CTS2)
          Length = 490

 Score =  385 bits (990), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 222/496 (44%), Positives = 309/496 (62%), Gaps = 44/496 (8%)

Query: 25  EMCFYRKIFKSSAEHDVLDHVHEVGDGSLQQFKDHHTVIGDEGYTSGLYYSDWSPYPPRK 84
           EM F  K+ K      +     EV + + +   D     G+  YT G+YYS WSPY PR 
Sbjct: 23  EMTFLPKLIKEKLSRRIRPKPLEVHEET-RPVPDAPYPDGE--YTVGVYYSSWSPYKPRL 79

Query: 85  HFPHDIDFSKVSHIYYAFFLIDGHTGELKSSDEWSDFQMDLYKPLAVKLNQLQLKNDDVH 144
           H+P +IDF +V+H+YYAFF++D  TG++ S D+WSD +M +                   
Sbjct: 80  HYPRNIDFQRVTHVYYAFFVVDEKTGKIGSLDKWSDTKMPM------------------- 120

Query: 145 ASMGVLPKG---CVGELFYLRHTGILDRDKGRHFKVMMAVGGWSNRDQWPKMVRDPRRVE 201
            ++  +P+G    +GEL YL+         G  FK+MMAVGGWSNR+ + K+VRD  +  
Sbjct: 121 -NLTGMPRGLNGAIGELNYLKTR------PGTDFKLMMAVGGWSNREPFHKIVRDEEKFN 173

Query: 202 NFINSCVETMFKYGFDGIDLDWEFPQNDGFEPRMYLELARKMRLKFDELEEVIFA-GEPN 260
           NFI+S ++ MF+YGFDGIDLDWEFP++DG+EP+MYLE+  ++R K DELE+ I+  G   
Sbjct: 174 NFIDSAIDAMFEYGFDGIDLDWEFPKDDGYEPQMYLEMCSRLRHKMDELEDNIWGPGGTT 233

Query: 261 HPKFQLSMATPAFKDKLNVLPIKELDRYIDVWNMMTYDYHGEWSPVTGYHCNLYDG---P 317
            P+F LSMA PAF   L + P++E+++Y+ +WNMMTYDYHG WS  TGYH NLY+    P
Sbjct: 234 EPRFHLSMAAPAFPQTLGIFPVEEMNKYLSMWNMMTYDYHGAWSERTGYHSNLYNATNSP 293

Query: 318 VKVH---SQYKHDSSSDDEGLDANSAISDMINRFGVDSRKITLGMAAYGRGFTHVKASSN 374
            K H    +Y+     + + L+A+ AI  M  +F V  RKI LGMAAYGRGFT+V+   +
Sbjct: 294 YKSHLDKRRYEDMGIDNFDELNAHDAILMMTEQFKVSPRKIALGMAAYGRGFTNVRG--D 351

Query: 375 DKRFIDKSFHGVGGASEGEPGMWLYNQLPIKGSKEEYDPEYVSGFCFDHKTKTFVGYDNV 434
            ++ I + + GVGG SEGEPGMWLYNQLP+    E++D  +VS + +D  TKT V YDNV
Sbjct: 352 GEQLIGQKYSGVGGGSEGEPGMWLYNQLPLAHGPEKFDNVWVSAYSYDPNTKTLVVYDNV 411

Query: 435 ESVKVKADYVKEMGLRGGFWWESCGDNHIDPQRSLLNAFTGRIKTIAKNENSVYHKPEAL 494
           +S+K+K +YVK+  L G F WESCGDN  D  R+L+ AFT  +K   K   + Y   + +
Sbjct: 412 DSMKIKKEYVKDKKLAGAFLWESCGDNFKDKDRNLVEAFTENMKGARK--ATAYKDSKLI 469

Query: 495 RYYLEKFGQDEFLSPF 510
           +YYL +   + FL P 
Sbjct: 470 QYYL-RTRPEGFLVPM 484

>YOL098C Chr15 complement(132725..135838) [3114 bp, 1037 aa] {ON}
           Putative metalloprotease
          Length = 1037

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 25/45 (55%), Gaps = 9/45 (20%)

Query: 174 HFKVMMAVGGWSNRDQWPK-----MVRDPRRV----ENFINSCVE 209
           +FK+    GG+SN  QW K     MV D  RV    EN++NS VE
Sbjct: 643 NFKIQCRAGGYSNSVQWIKHCLFDMVFDENRVRILLENYLNSIVE 687

>TPHA0E02540 Chr5 (539071..541722) [2652 bp, 883 aa] {ON} Anc_3.544
           YGL227W
          Length = 883

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 29/49 (59%), Gaps = 6/49 (12%)

Query: 124 DLYKPLAVKLNQLQLKNDDVHASMGVLPKGCVGELFYLRHTGILDRDKG 172
           ++ KP  VK+N L LK+D + +++    K  + E  YL H G++D  KG
Sbjct: 602 EMIKPEGVKINFLNLKDDSLQSTL----KTVINE--YLVHEGLIDVAKG 644

>NCAS0E00390 Chr5 (65191..68112) [2922 bp, 973 aa] {ON} Anc_3.544
           YGL227W
          Length = 973

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 14/79 (17%)

Query: 100 YAFFLIDGHTGE-------LKSSDEWSDFQMDLYKPLAVKLNQLQLKNDDVHASMGVLPK 152
           Y F   DG+T E       L   D+  D  M++ KP +++LN L + ND +  ++ V+  
Sbjct: 665 YDFDCKDGNTTENNQKASFLLGKDDRID-DMNIKKPNSIRLNDLNVNNDSIPNTLNVMIN 723

Query: 153 GCVGELFYLRHTGILDRDK 171
                  YL H G++D  K
Sbjct: 724 D------YLLHEGMVDLAK 736

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.139    0.446 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 61,077,552
Number of extensions: 2854600
Number of successful extensions: 6582
Number of sequences better than 10.0: 27
Number of HSP's gapped: 6614
Number of HSP's successfully gapped: 27
Length of query: 519
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 405
Effective length of database: 40,409,475
Effective search space: 16365837375
Effective search space used: 16365837375
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)