Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F10164g5.440ON42342315750.0
TDEL0D026105.440ON4403568931e-116
SAKL0G02662g5.440ON4793448391e-107
CAGL0K10230g5.440ON4462148281e-106
Suva_8.1755.440ON4533468251e-106
NCAS0H020805.440ON4352178051e-103
YOR123C (LEO1)5.440ON4642167971e-101
Smik_15.3005.440ON4632167911e-101
NDAI0C015905.440ON4702077911e-100
KNAG0B042105.440ON4632177727e-98
KAFR0D050505.440ON4192147643e-97
KLLA0E02311g5.440ON4172137564e-96
Skud_15.2855.440ON4872097547e-95
Ecym_45115.440ON4612107327e-92
ACL167C5.440ON4392177246e-91
TPHA0E017305.440ON4692167162e-89
Kwal_55.214085.440ON4362137115e-89
Kpol_1062.265.440ON4572097092e-88
KLTH0F15928g5.440ON4232136992e-87
TBLA0A064905.440ON4282216941e-86
Kwal_26.73161.264ON79833741.5
SAKL0D05324g1.264ON79733731.9
Kwal_55.21296singletonOFF29264703.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F10164g
         (423 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {...   611   0.0  
TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.4...   348   e-116
SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {...   327   e-107
CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa] ...   323   e-106
Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON...   322   e-106
NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {O...   314   e-103
YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON} ...   311   e-101
Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {...   309   e-101
NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {O...   309   e-100
KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.4...   301   7e-98
KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {O...   298   3e-97
KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {...   295   4e-96
Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {...   295   7e-95
Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {O...   286   7e-92
ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON} Syn...   283   6e-91
TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.4...   280   2e-89
Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123...   278   5e-89
Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON} (58970....   277   2e-88
KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} simi...   273   2e-87
TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON} Anc_5...   271   1e-86
Kwal_26.7316 s26 (309798..312194) [2397 bp, 798 aa] {ON} YJL102W...    33   1.5  
SAKL0D05324g Chr4 (420393..422786) [2394 bp, 797 aa] {ON} simila...    33   1.9  
Kwal_55.21296 s55 (774344..775222) [879 bp, 292 aa] {OFF} [conti...    32   3.6  

>ZYRO0F10164g Chr6 complement(821488..822759) [1272 bp, 423 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 423

 Score =  611 bits (1575), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/423 (74%), Positives = 314/423 (74%)

Query: 1   MSDPQEQAPEATAPVQDSSAEKELSNETKQEPSGDEKSGSQXXXXXXXXXXXXXXXXXXX 60
           MSDPQEQAPEATAPVQDSSAEKELSNETKQEPSGDEKSGSQ                   
Sbjct: 1   MSDPQEQAPEATAPVQDSSAEKELSNETKQEPSGDEKSGSQDEMEDLFGEDEGEDEEDEK 60

Query: 61  XXXXXXXNDEGEVTLRHRQXXXXXXXXXXXXYTRKFYGEDVDRVSDXXXXXXXXXXXXXL 120
                  NDEGEVTLRHRQ            YTRKFYGEDVDRVSD             L
Sbjct: 61  RKGSEDENDEGEVTLRHRQEMDDEEAEEHAMYTRKFYGEDVDRVSDEEEAQEFREEDVEL 120

Query: 121 VRHIVPYRATQGTDKPVLYYAKIPEFLTIDPVPFDPPSFEASVKERLGNKASKEDQLGDR 180
           VRHIVPYRATQGTDKPVLYYAKIPEFLTIDPVPFDPPSFEASVKERLGNKASKEDQLGDR
Sbjct: 121 VRHIVPYRATQGTDKPVLYYAKIPEFLTIDPVPFDPPSFEASVKERLGNKASKEDQLGDR 180

Query: 181 LIDENTVRWRYSRDANQQVFKESNAQIVQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSH 240
           LIDENTVRWRYSRDANQQVFKESNAQIVQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSH
Sbjct: 181 LIDENTVRWRYSRDANQQVFKESNAQIVQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSH 240

Query: 241 DQQELMQCYEGGEVTKTLMFIPTSTSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKDPELE 300
           DQQELMQCYEGGEVTKTLMFIPTSTSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKDPELE
Sbjct: 241 DQQELMQCYEGGEVTKTLMFIPTSTSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKDPELE 300

Query: 301 RGELXXXXXXXXXXXXXXXXXXMESREASGDPDRRAAISAEAEPMGNIRRNXXXXXXXXX 360
           RGEL                  MESREASGDPDRRAAISAEAEPMGNIRRN         
Sbjct: 301 RGELEKKQQQVVRERRRRQVKEMESREASGDPDRRAAISAEAEPMGNIRRNEYEQDDFLV 360

Query: 361 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAERLRRLKREGANNYEERKRRRVAVIDDE 420
                                          AERLRRLKREGANNYEERKRRRVAVIDDE
Sbjct: 361 DDDDEEEYASGSGEEGEEEEEEDEGNVSDEGAERLRRLKREGANNYEERKRRRVAVIDDE 420

Query: 421 EDE 423
           EDE
Sbjct: 421 EDE 423

>TDEL0D02610 Chr4 (500294..501616) [1323 bp, 440 aa] {ON} Anc_5.440
           YOR123C
          Length = 440

 Score =  348 bits (893), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 192/356 (53%), Positives = 222/356 (62%), Gaps = 28/356 (7%)

Query: 92  YTRKFYGEDVDRVSDXXXXXXX-XXXXXXLVRHIVPYRAT-QGTD-KPVLYYAKIPEFLT 148
           YTRKFYGED D +SD              LVRHIVPY+   +G D K  +YYAK+PEFLT
Sbjct: 89  YTRKFYGEDADNMSDQEESANHFTEENVELVRHIVPYKTVGEGADEKSTIYYAKVPEFLT 148

Query: 149 IDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQIV 208
           IDPVPFDPPSFE+ VKERL N +S+EDQLGDRLIDENT+RWRYSRD NQQV+KESNAQIV
Sbjct: 149 IDPVPFDPPSFESKVKERL-NSSSREDQLGDRLIDENTIRWRYSRDENQQVYKESNAQIV 207

Query: 209 QWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSR 268
           QWSDG  SLKLG EYTDIL NDTDNTFFAVSHD+QELMQC +GGEVTK+LMFIPTST+S+
Sbjct: 208 QWSDGGLSLKLGTEYTDILVNDTDNTFFAVSHDEQELMQCSQGGEVTKSLMFIPTSTNSK 267

Query: 269 MHQKLTKAVMRRDHKQAAGPGTYIVQKDPELERGELXXXXXXXXXXXXXXXXXXMESREA 328
           MHQKLTKAV+RRD +Q  GPG Y V KDPELE+ EL                  +ESR +
Sbjct: 268 MHQKLTKAVIRRDQRQTKGPGVYFVNKDPELEKNELEKKQQQVVRERRKRQLKEIESRNS 327

Query: 329 SGDPD--------RRAAISAEAEP---MGNIRRNXXXXXX--XXXXXXXXXXXXXXXXXX 375
              PD        R+  ++A  E     G+ +RN                          
Sbjct: 328 ---PDISTGLNGYRKTPVTASDEQDSYYGSSKRNEYEQDDFLVDDDEEEEAGYSEEDDVL 384

Query: 376 XXXXXXXXXXXXXXXXAERLRRLKREGANNYEE--------RKRRRVAVIDDEEDE 423
                           AERLR+LKR+G   Y E         KRR+VA+IDDE+DE
Sbjct: 385 DDNNDDQEAEDEEDAKAERLRQLKRQGTERYTEPEPESDPSTKRRKVAIIDDEDDE 440

>SAKL0G02662g Chr7 complement(218969..220408) [1440 bp, 479 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 479

 Score =  327 bits (839), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 168/344 (48%), Positives = 211/344 (61%), Gaps = 12/344 (3%)

Query: 92  YTRKFYGEDVDRVSDXXXXXXX-XXXXXXLVRHIVPYRATQGTDKPVLYYAKIPEFLTID 150
           Y RKFYG+DVD  SD              + +HIVPY+ T  +    +YYAK+P+FLTID
Sbjct: 135 YNRKFYGDDVDNDSDAEDSQREFKEADVEIAKHIVPYKTTSNSQDKEVYYAKVPQFLTID 194

Query: 151 PVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQIVQW 210
           PVPFDPPSF+ +V+ RL   +SKEDQL DRLIDENT+RWRYSRD+ QQVFKESNAQI+QW
Sbjct: 195 PVPFDPPSFKRNVEGRLAQFSSKEDQLDDRLIDENTIRWRYSRDSKQQVFKESNAQIIQW 254

Query: 211 SDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSRMH 270
           SDGTFSL+LGDE++D+L NDTDNTF  VSH+QQELMQC EGGE+TKT+MFIPTSTSS++H
Sbjct: 255 SDGTFSLRLGDEFSDVLINDTDNTFLTVSHEQQELMQCVEGGEITKTMMFIPTSTSSKIH 314

Query: 271 QKLTKAVMRRDHKQAAGPGTYIVQKDPELERGELXXXXXXXXXXXXXXXXXXMESREASG 330
           Q+L+KAV+RR+ ++  GP TYIV+KDPELE+ EL                     +E   
Sbjct: 315 QRLSKAVVRREQREHLGPNTYIVRKDPELEQRELEKKQDQIVRERRKRQLKEQLEKENRD 374

Query: 331 DPDRRAAISAEAEPMGNIRRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 390
             +      +     G  RRN                                       
Sbjct: 375 SVEPLGVRKSATSSFGVGRRNEYEEDDFLVDDEEEEEEGGISGEEEEEAEEEDDDDEDDL 434

Query: 391 XAERLRRLKREGANNYEER-----------KRRRVAVIDDEEDE 423
            AERLR+LKREGA  YE++           KRR++AV+DDEE++
Sbjct: 435 NAERLRQLKREGAAQYEQKDEESGSEESSHKRRKIAVLDDEEED 478

>CAGL0K10230g Chr11 complement(996303..997643) [1341 bp, 446 aa]
           {ON} similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123c LEO1 extremely hydrophilic protein
          Length = 446

 Score =  323 bits (828), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 173/214 (80%), Gaps = 1/214 (0%)

Query: 92  YTRKFYGEDVDRVSDXXXXXXXXXXXXXLVRHIVPYRA-TQGTDKPVLYYAKIPEFLTID 150
           YTRKFYGED    SD             L+RHI+PY+  T   +   ++YAK+P FLTID
Sbjct: 112 YTRKFYGEDAVNYSDDDEPHTFKESNVDLIRHIIPYKTRTTNNEHDEIFYAKVPAFLTID 171

Query: 151 PVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQIVQW 210
           PVPFDP +FEA+V ERL   ASKEDQLGDRLIDENT+RWRYSRDA Q VFKESNAQIVQW
Sbjct: 172 PVPFDPQTFEATVDERLSKSASKEDQLGDRLIDENTIRWRYSRDAEQHVFKESNAQIVQW 231

Query: 211 SDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSRMH 270
           SDG+FSLKLGDEYTDI+ NDTDNTF  VSHDQQELMQCY+GGE+TKT+MFIPTST+S++H
Sbjct: 232 SDGSFSLKLGDEYTDIIVNDTDNTFLTVSHDQQELMQCYDGGEITKTMMFIPTSTNSKIH 291

Query: 271 QKLTKAVMRRDHKQAAGPGTYIVQKDPELERGEL 304
           QKL+KAV RR+ +Q  GPG+YI+++DPE+E+ EL
Sbjct: 292 QKLSKAVSRRNARQNLGPGSYIIKQDPEIEKKEL 325

>Suva_8.175 Chr8 complement(310977..312338) [1362 bp, 453 aa] {ON}
           YOR123C (REAL)
          Length = 453

 Score =  322 bits (825), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 177/346 (51%), Positives = 207/346 (59%), Gaps = 18/346 (5%)

Query: 92  YTRKFYGEDVDRVSDXXXXXXX-XXXXXXLVRHIVPYRAT--QGTDKPVLYYAKIPEFLT 148
           YTRKFYGED +  SD              LVRHI+P +A   +      ++YA+IP FLT
Sbjct: 111 YTRKFYGEDANDFSDQDEATHTFKEENVELVRHIIPSKANVNETASHNEIFYARIPNFLT 170

Query: 149 IDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQIV 208
           IDP+PFDPPSFEA V ER  N  SKEDQL DRLIDENTVRWRYSRD +Q VFKESN QIV
Sbjct: 171 IDPIPFDPPSFEAKVNERANNSISKEDQLDDRLIDENTVRWRYSRDNDQHVFKESNTQIV 230

Query: 209 QWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSR 268
           QWSDG++SLK+G+EYTDIL NDT NTF  VSHDQQELMQCYEGGE+ KTLMFIPTSTSS+
Sbjct: 231 QWSDGSYSLKVGEEYTDILVNDTSNTFLTVSHDQQELMQCYEGGEIKKTLMFIPTSTSSK 290

Query: 269 MHQKLTKAVMRRDHKQAAGPGTYIVQKDPELERGELXXXXXXXXXXXXXXXXXXMESREA 328
           +HQKL+KAV+R++ +Q  GPGTYI+  DPE+E+ EL                   E +E 
Sbjct: 291 IHQKLSKAVVRKNQRQNQGPGTYIINMDPEVEKRELEKKQSQILRDRRKRQLKEKEKQE- 349

Query: 329 SGDPDRRAAISAEAEPM--GNIRRNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 386
           S D     A   ++ P   G  RRN                                   
Sbjct: 350 SPDVGFETAFRKQSSPTAYGATRRN---EYEEDDFLVDDDEEEEAEFDDDDDNEEEEEEE 406

Query: 387 XXXXXAERLRRLKREGANNYEER---------KRRRVAVIDDEEDE 423
                A RLR LKREGA  Y+E          KRRRVAVI+D+EDE
Sbjct: 407 ADEDNAARLRNLKREGAAMYKEEGGDDDSNESKRRRVAVIEDDEDE 452

>NCAS0H02080 Chr8 complement(404035..405342) [1308 bp, 435 aa] {ON}
           Anc_5.440 YOR123C
          Length = 435

 Score =  314 bits (805), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 145/217 (66%), Positives = 179/217 (82%), Gaps = 4/217 (1%)

Query: 92  YTRKFYGED-VDRVSDXXXXXXX--XXXXXXLVRHIVPYR-ATQGTDKPVLYYAKIPEFL 147
           YTRKFYG+D  +R S                L+RH+VPY+ +++ TD+  +YYAK+P FL
Sbjct: 86  YTRKFYGDDDYNRYSSDQDNALHHFKEENVELIRHMVPYKTSSEKTDETTVYYAKVPPFL 145

Query: 148 TIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQI 207
           TI+PVPFDP +FE+ V++RL N +SKEDQLGDRLIDENTVRWRYSRDANQ+VFKESNAQI
Sbjct: 146 TINPVPFDPIAFESDVRDRLSNYSSKEDQLGDRLIDENTVRWRYSRDANQRVFKESNAQI 205

Query: 208 VQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSS 267
           VQWSDG+FSLKLGDEYTDIL N+T+NTF AVSHDQQELMQCY GGE+TKTLMFIPTST+S
Sbjct: 206 VQWSDGSFSLKLGDEYTDILVNETNNTFLAVSHDQQELMQCYNGGEITKTLMFIPTSTNS 265

Query: 268 RMHQKLTKAVMRRDHKQAAGPGTYIVQKDPELERGEL 304
           ++HQ+L+KAV RR+ ++  GPGT I+ +DPE+E+ EL
Sbjct: 266 KIHQQLSKAVTRRNQREHLGPGTMIINRDPEVEKREL 302

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 23/42 (54%), Gaps = 10/42 (23%)

Query: 392 AERLRRLKREG----------ANNYEERKRRRVAVIDDEEDE 423
           AERLR  KR G           N     K+RRVAVI+D+ED+
Sbjct: 393 AERLRNAKRSGYDEDNQESGTENESSSSKKRRVAVINDDEDD 434

>YOR123C Chr15 complement(553176..554570) [1395 bp, 464 aa] {ON}
           LEO1Component of the Paf1 complex; which associates with
           RNA polymerase II and is involved in histone
           methylation; plays a role in regulating Ty1
           transposition; involved in transcription elongation as
           demonstrated by the G-less-based run-on (GLRO) assay
          Length = 464

 Score =  311 bits (797), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 143/216 (66%), Positives = 168/216 (77%), Gaps = 3/216 (1%)

Query: 92  YTRKFYGEDVDRVSDXXXXXXX-XXXXXXLVRHIVPYRAT--QGTDKPVLYYAKIPEFLT 148
           YTRKFYGED +  SD              LVRHI+P +A   +      ++YA+IP FLT
Sbjct: 119 YTRKFYGEDANNFSDQDETTHTFKEENVELVRHIIPSKANVNETASHNEIFYARIPNFLT 178

Query: 149 IDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQIV 208
           IDP+PFDPPSFEA V ER  N AS+EDQL DRLIDENTVRWRYSRD +Q VFKESN QIV
Sbjct: 179 IDPIPFDPPSFEAKVNERASNSASREDQLDDRLIDENTVRWRYSRDKDQHVFKESNTQIV 238

Query: 209 QWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSR 268
           QWSDGT+SLK+G+E TDIL NDT NTF  VSHDQQEL+QCYEGGE+ KTLMFIPTST+S+
Sbjct: 239 QWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSK 298

Query: 269 MHQKLTKAVMRRDHKQAAGPGTYIVQKDPELERGEL 304
           +HQKL+KAV+RR+ +Q+ GPGTYIV  DPE+E+ EL
Sbjct: 299 IHQKLSKAVIRRNQRQSKGPGTYIVSMDPEVEKKEL 334

 Score = 38.1 bits (87), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 23/40 (57%), Positives = 25/40 (62%), Gaps = 10/40 (25%)

Query: 394 RLRRLKREGANNY----------EERKRRRVAVIDDEEDE 423
           RLR LKREGA  Y           E KRRRVAVI+D+EDE
Sbjct: 424 RLRNLKREGAAMYREEEEEEKDRSETKRRRVAVIEDDEDE 463

>Smik_15.300 Chr15 complement(514294..515685) [1392 bp, 463 aa] {ON}
           YOR123C (REAL)
          Length = 463

 Score =  309 bits (791), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 144/216 (66%), Positives = 167/216 (77%), Gaps = 3/216 (1%)

Query: 92  YTRKFYGEDVDRVSDXXXXXXX-XXXXXXLVRHIVPYRA--TQGTDKPVLYYAKIPEFLT 148
           YTRKFYGED++  SD              LVRHI+P +    +      ++YA+IP FLT
Sbjct: 113 YTRKFYGEDLNDFSDQDEATHTFKEENVELVRHIIPSKGIVNETASHNEIFYARIPNFLT 172

Query: 149 IDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQIV 208
           IDPVPFDPPSFEA V ER  N ASKEDQL DRLIDENTVRWRYSRD +Q VFKESN QIV
Sbjct: 173 IDPVPFDPPSFEAKVNERTSNSASKEDQLDDRLIDENTVRWRYSRDKDQHVFKESNTQIV 232

Query: 209 QWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSR 268
           QWSDGT+SLK+G+E TDIL NDT NTF  VSHDQQEL+QCYEGGE+ KTLMFIPTST+S+
Sbjct: 233 QWSDGTYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSK 292

Query: 269 MHQKLTKAVMRRDHKQAAGPGTYIVQKDPELERGEL 304
           +HQKL+KAV+RR+ +Q  GPGTYIV  DPE+E+ EL
Sbjct: 293 IHQKLSKAVIRRNQRQNKGPGTYIVSMDPEVEKREL 328

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 25/38 (65%), Gaps = 8/38 (21%)

Query: 394 RLRRLKREGANNY--------EERKRRRVAVIDDEEDE 423
           RLR LK+EGA  Y         E KRRRVAVI+D+E+E
Sbjct: 425 RLRSLKKEGAAMYRQEENEDNNETKRRRVAVIEDDEEE 462

>NDAI0C01590 Chr3 complement(340050..341462) [1413 bp, 470 aa] {ON}
           Anc_5.440 YOR123C
          Length = 470

 Score =  309 bits (791), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 166/207 (80%), Gaps = 2/207 (0%)

Query: 92  YTRKFYGEDVDRVSDXXXXXXX-XXXXXXLVRHIVPYRATQGTDKPVLYYAKIPEFLTID 150
           YTRKFYG D D+ SD              ++RH+VPY+ +       +YYAK+P FLTID
Sbjct: 122 YTRKFYG-DTDKYSDNEEDAHDFKEANVEIIRHMVPYKTSSDQADTTIYYAKVPPFLTID 180

Query: 151 PVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQIVQW 210
           P+PFDP SFE  VK+RL + +S+EDQLGDRLIDENT+RWRYSRD NQ+VFKESNAQIVQW
Sbjct: 181 PIPFDPVSFETKVKDRLADYSSREDQLGDRLIDENTIRWRYSRDQNQRVFKESNAQIVQW 240

Query: 211 SDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSRMH 270
           SDG+FSLKLGDEYTDIL NDTDNTF  VSHDQQELMQCY GGE+TKT+MFIPTST+S++H
Sbjct: 241 SDGSFSLKLGDEYTDILVNDTDNTFLTVSHDQQELMQCYNGGEITKTMMFIPTSTNSKIH 300

Query: 271 QKLTKAVMRRDHKQAAGPGTYIVQKDP 297
           Q+L+KAV RR+ +Q  GPGT I++KDP
Sbjct: 301 QQLSKAVTRRNQRQNLGPGTMIIEKDP 327

 Score = 32.0 bits (71), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 27/43 (62%), Gaps = 11/43 (25%)

Query: 392 AERLRRLKREGANNYEER----------KRRRVAVI-DDEEDE 423
           A+RL+ +K+ GA  Y +R          KRR+VAV+ DDEEDE
Sbjct: 428 AKRLKEIKKGGAQEYADREESDMEEGSSKRRKVAVLSDDEEDE 470

>KNAG0B04210 Chr2 (801346..802737) [1392 bp, 463 aa] {ON} Anc_5.440
           YOR123C
          Length = 463

 Score =  301 bits (772), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 145/217 (66%), Positives = 162/217 (74%), Gaps = 6/217 (2%)

Query: 92  YTRKFYGEDVDRVSDXXXXXXXXXXXXXLVRHIVPYRATQ----GTDKPVLYYAKIPEFL 147
           Y RKFYGEDVD                 LV+HIVPY+       GT+   +Y AK+P FL
Sbjct: 103 YNRKFYGEDVDMSDTEQAEHEFKEANVELVKHIVPYKLVPDDAIGTND--IYVAKVPPFL 160

Query: 148 TIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQI 207
            IDP PFDP SFE  V +RL    SKED+LGDRLIDENTVRWRYSRD NQ VFKESN QI
Sbjct: 161 MIDPAPFDPTSFEGKVADRLDGSLSKEDRLGDRLIDENTVRWRYSRDTNQSVFKESNTQI 220

Query: 208 VQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSS 267
           VQWSDG++SLKLG+EYTDIL NDTDNTF  VSHDQQELMQC EGG V KTLMFIPTSTSS
Sbjct: 221 VQWSDGSYSLKLGNEYTDILINDTDNTFLTVSHDQQELMQCVEGGLVNKTLMFIPTSTSS 280

Query: 268 RMHQKLTKAVMRRDHKQAAGPGTYIVQKDPELERGEL 304
           ++HQKL+KAV RR+  Q+AGPGTYIV  DPE+E+ EL
Sbjct: 281 KIHQKLSKAVARRNVMQSAGPGTYIVSVDPEIEKKEL 317

>KAFR0D05050 Chr4 complement(993511..994770) [1260 bp, 419 aa] {ON}
           Anc_5.440 YOR123C
          Length = 419

 Score =  298 bits (764), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 165/214 (77%), Gaps = 1/214 (0%)

Query: 92  YTRKFYGEDVDRVSDXXXXXXXXXXXXXLVRHIVPYRA-TQGTDKPVLYYAKIPEFLTID 150
           Y RKFYGE+   +SD             LVRH+VPY+   +  D   +YY K+P FL+ID
Sbjct: 72  YNRKFYGEEGSDMSDHEEEALFKEADVELVRHVVPYKTFPENEDDKTIYYTKVPAFLSID 131

Query: 151 PVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQIVQW 210
           P+PFDPPSFE  VKER  N +S EDQLGDRLIDENT+RWRYSRDA Q+VFKESNAQIVQW
Sbjct: 132 PLPFDPPSFENKVKERTSNFSSVEDQLGDRLIDENTIRWRYSRDAEQRVFKESNAQIVQW 191

Query: 211 SDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSRMH 270
           SDG++SLKLG EYTDIL N TDNTF  VSHDQQELMQC +GG++ KTL+FIPTST+S++H
Sbjct: 192 SDGSYSLKLGAEYTDILVNGTDNTFLTVSHDQQELMQCVDGGQINKTLIFIPTSTNSKIH 251

Query: 271 QKLTKAVMRRDHKQAAGPGTYIVQKDPELERGEL 304
           Q+L+KA+ RRD +  +GPGT IV  DPE+E+ EL
Sbjct: 252 QRLSKAIARRDQRVHSGPGTMIVNLDPEVEKREL 285

>KLLA0E02311g Chr5 complement(214032..215285) [1254 bp, 417 aa] {ON}
           similar to uniprot|P38439 Saccharomyces cerevisiae
           YOR123C LEO1 Component of the Paf1 complex which
           associates with RNA polymerase II and is involved in
           histone methylation
          Length = 417

 Score =  295 bits (756), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 129/213 (60%), Positives = 168/213 (78%)

Query: 92  YTRKFYGEDVDRVSDXXXXXXXXXXXXXLVRHIVPYRATQGTDKPVLYYAKIPEFLTIDP 151
           Y RKF GED +  S+             +V+H+VPY+   G D   +YYAK+P+FLTIDP
Sbjct: 73  YNRKFLGEDYEGQSEEEYEKKYKEVDVEIVKHVVPYKTANGADDKTIYYAKVPQFLTIDP 132

Query: 152 VPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQIVQWS 211
           VPFDPPSF+  V++R+   +SKEDQLGDRLI+ENT+RWRYSRD +++VFKESNAQIV+WS
Sbjct: 133 VPFDPPSFQKKVEDRVSKYSSKEDQLGDRLIEENTIRWRYSRDKDERVFKESNAQIVEWS 192

Query: 212 DGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSRMHQ 271
           DGTFSLK+GDEYTDIL N+T+NT+  VSH++QEL+QC EGGE+TK++MF+PTST+S++H+
Sbjct: 193 DGTFSLKVGDEYTDILVNNTENTYLTVSHEEQELIQCVEGGEITKSMMFVPTSTNSKVHK 252

Query: 272 KLTKAVMRRDHKQAAGPGTYIVQKDPELERGEL 304
            L+KAV RRD +   GP TYI + DPELE+ EL
Sbjct: 253 ILSKAVARRDERGQHGPNTYITRTDPELEKREL 285

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 27/35 (77%), Gaps = 3/35 (8%)

Query: 392 AERLRRLKREGANNYEE---RKRRRVAVIDDEEDE 423
           A+RLR +K+ GA  Y+E    K+R++AV+DDE+DE
Sbjct: 383 AKRLREVKQTGAQEYQEDAQAKKRKIAVLDDEDDE 417

>Skud_15.285 Chr15 complement(509624..511087) [1464 bp, 487 aa] {ON}
           YOR123C (REAL)
          Length = 487

 Score =  295 bits (754), Expect = 7e-95,   Method: Compositional matrix adjust.
 Identities = 137/209 (65%), Positives = 159/209 (76%), Gaps = 3/209 (1%)

Query: 92  YTRKFYGEDVDRVSDXXXXXXX-XXXXXXLVRHIVPYRAT--QGTDKPVLYYAKIPEFLT 148
           YTRKFYGED +  SD              +VRHI+P +A   +      ++YA+IP FLT
Sbjct: 141 YTRKFYGEDANDYSDQDEAAHTFKEENIEIVRHIIPNKANVNETASHNEIFYARIPNFLT 200

Query: 149 IDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQIV 208
           ID VPFDPPSFEA V ER  N  SKEDQL DRLIDENTVRWRYSRD +Q VFKESN QIV
Sbjct: 201 IDAVPFDPPSFEAKVNERAINSTSKEDQLDDRLIDENTVRWRYSRDKDQHVFKESNTQIV 260

Query: 209 QWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSR 268
           QWSDG++SLK+G+E TDIL NDT NTF  VSHDQQEL+QCYEGGE+ KTLMFIPTST+S+
Sbjct: 261 QWSDGSYSLKVGEECTDILVNDTSNTFLTVSHDQQELIQCYEGGEIKKTLMFIPTSTNSK 320

Query: 269 MHQKLTKAVMRRDHKQAAGPGTYIVQKDP 297
           +HQKL+KAV+RR+ +Q  GPGTYIV  DP
Sbjct: 321 IHQKLSKAVIRRNQRQNKGPGTYIVNMDP 349

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 24/41 (58%), Positives = 27/41 (65%), Gaps = 9/41 (21%)

Query: 392 AERLRRLKREGANNYEER---------KRRRVAVIDDEEDE 423
           A RLR LKREGA  Y+E          KRRRVAVI+D+EDE
Sbjct: 446 AARLRNLKREGAAMYKEEEKDDDSNETKRRRVAVIEDDEDE 486

>Ecym_4511 Chr4 complement(1020312..1021697) [1386 bp, 461 aa] {ON}
           similar to Ashbya gossypii ACL167C
          Length = 461

 Score =  286 bits (732), Expect = 7e-92,   Method: Compositional matrix adjust.
 Identities = 125/210 (59%), Positives = 165/210 (78%), Gaps = 4/210 (1%)

Query: 92  YTRKFYGEDVDRVS---DXXXXXXXXXXXXXLVRHIVPYRATQGTDK-PVLYYAKIPEFL 147
           Y RKFYG+D+ + S   D             +++H+VPY  T  ++K   LYYAK+P+FL
Sbjct: 90  YNRKFYGDDLKKTSYESDVEEEREIKEANVQIMKHVVPYYTTNASEKDSSLYYAKVPQFL 149

Query: 148 TIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQI 207
           TIDP+PFDPP F++ +++RL   +SKEDQLGDRLIDENT+RWRYSR ANQQVFKESNAQI
Sbjct: 150 TIDPIPFDPPGFQSQIEQRLKRFSSKEDQLGDRLIDENTIRWRYSRGANQQVFKESNAQI 209

Query: 208 VQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSS 267
           +QWSDGTFSLKLGDE++DIL ND +NT+  VSH+Q+ELMQC EGGE+ K+++FIPTST+S
Sbjct: 210 IQWSDGTFSLKLGDEFSDILINDIENTYMTVSHEQEELMQCVEGGEIKKSMLFIPTSTNS 269

Query: 268 RMHQKLTKAVMRRDHKQAAGPGTYIVQKDP 297
           + HQ+L+ A+ RR+ ++ +GP TYIV+ DP
Sbjct: 270 KTHQRLSAAIARREAREHSGPSTYIVRMDP 299

>ACL167C Chr3 complement(63134..64453) [1320 bp, 439 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR123C
           (LEO1)
          Length = 439

 Score =  283 bits (724), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 171/217 (78%), Gaps = 4/217 (1%)

Query: 92  YTRKFYGEDVDR---VSDXXXXXXXXXXXXXLVRHIVPYRATQGTD-KPVLYYAKIPEFL 147
           Y RKFYG+D+ +   +SD             LV+H+VP    +  + K +LYY K+P+FL
Sbjct: 85  YNRKFYGDDLQQASDLSDEDEAREIKEADLELVKHVVPLLYNKPLEGKRLLYYTKVPQFL 144

Query: 148 TIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQI 207
           TIDPVPFDPPSF+  +++R+   +SKEDQLGD LIDENT+RWRYSR ++Q+VFKESNAQ+
Sbjct: 145 TIDPVPFDPPSFQGQIEKRMARFSSKEDQLGDSLIDENTIRWRYSRGSDQRVFKESNAQV 204

Query: 208 VQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSS 267
           ++WSDGT SLKLGDEYTDIL+N+ +NT+  VSH+QQE+MQC EGG ++ +++FIPTST+S
Sbjct: 205 IEWSDGTLSLKLGDEYTDILTNEIENTYLTVSHEQQEIMQCVEGGTISNSMLFIPTSTNS 264

Query: 268 RMHQKLTKAVMRRDHKQAAGPGTYIVQKDPELERGEL 304
           ++H++LTKA+ RR+ ++ +GP TYIV+KDPELE+ EL
Sbjct: 265 KIHKRLTKAIARREAREHSGPSTYIVRKDPELEKREL 301

>TPHA0E01730 Chr5 (350455..351864) [1410 bp, 469 aa] {ON} Anc_5.440
           YOR123C
          Length = 469

 Score =  280 bits (716), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 157/216 (72%), Gaps = 10/216 (4%)

Query: 92  YTRKFYG-EDVDRVSDXXXXXXXXXXXXXLVRHIVPYRATQ---------GTDKPVLYYA 141
           YTRKFYG EDV++  +             LVRHIVPY+  +          T K   YYA
Sbjct: 115 YTRKFYGDEDVNKYDEDENMHEFKEADVELVRHIVPYKILEQKNDNSKDDATSKNSTYYA 174

Query: 142 KIPEFLTIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFK 201
           +IP FLTIDPVPFDPP FE+ VKERL N  + +D++GDRLIDENT+RWRYSRDANQ VFK
Sbjct: 175 RIPPFLTIDPVPFDPPQFESEVKERLENTTNVKDRIGDRLIDENTIRWRYSRDANQTVFK 234

Query: 202 ESNAQIVQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFI 261
           ESNAQI+QWSDG++SLKLGD+YTD+L ND  NTF  VSHDQQELMQC +GGE++K+ MF+
Sbjct: 235 ESNAQIIQWSDGSYSLKLGDDYTDLLVNDISNTFLTVSHDQQELMQCVDGGEISKSAMFV 294

Query: 262 PTSTSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKDP 297
           P ST+SR+HQ+L+KA+ RRD      P + I+  DP
Sbjct: 295 PISTNSRLHQRLSKAIARRDQNSTESPRSMIINVDP 330

>Kwal_55.21408 s55 (823660..824970) [1311 bp, 436 aa] {ON} YOR123C
           (LEO1) - Product of gene unknown [contig 130] FULL
          Length = 436

 Score =  278 bits (711), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 121/213 (56%), Positives = 163/213 (76%)

Query: 92  YTRKFYGEDVDRVSDXXXXXXXXXXXXXLVRHIVPYRATQGTDKPVLYYAKIPEFLTIDP 151
           Y RKFYG++ +  +D             +V+H+VPY          ++YAK+P+FLTIDP
Sbjct: 84  YNRKFYGDNAEDSNDEGSQREFREADVDVVKHVVPYSTVPSEGDKTIFYAKVPQFLTIDP 143

Query: 152 VPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQIVQWS 211
           +PFDPP+F+  +++R    +S EDQ+ DRLI+ENTVRWRYSRD+ QQVFKESNAQIVQWS
Sbjct: 144 IPFDPPAFQNKIEQRTAQLSSTEDQIDDRLIEENTVRWRYSRDSKQQVFKESNAQIVQWS 203

Query: 212 DGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSRMHQ 271
           DGTFSL+LGDE+TD+L NDT++T+  VSHDQQEL+Q  +GGEVTK ++FIPTST+S+ HQ
Sbjct: 204 DGTFSLRLGDEFTDVLINDTEDTYLTVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQ 263

Query: 272 KLTKAVMRRDHKQAAGPGTYIVQKDPELERGEL 304
           +L+KAV R++ ++  GP TYI++ DPELE+ EL
Sbjct: 264 RLSKAVARKEQREHHGPNTYILRVDPELEQKEL 296

 Score = 36.2 bits (82), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 27/49 (55%), Gaps = 17/49 (34%)

Query: 392 AERLRRLKREGANNYEER-----------------KRRRVAVIDDEEDE 423
           AERLR+LKR GA+ Y                    KRR+VAV+DDE+DE
Sbjct: 388 AERLRQLKRSGASQYRSEGSEDDHVADEEPQDSTLKRRKVAVLDDEDDE 436

>Kpol_1062.26 s1062 (58970..60343) [1374 bp, 457 aa] {ON}
           (58970..60343) [1374 nt, 458 aa]
          Length = 457

 Score =  277 bits (709), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 127/209 (60%), Positives = 157/209 (75%), Gaps = 3/209 (1%)

Query: 92  YTRKFYGED-VDRVSDXXXXXXXXXXXXXLVRHIVPYRAT--QGTDKPVLYYAKIPEFLT 148
           YTRKFYGED  D+                L RH+VP + T  +      +YYAK+P FLT
Sbjct: 96  YTRKFYGEDDYDKSDQEEDKHEFREEDVVLTRHVVPTKITSEENDADTTIYYAKVPPFLT 155

Query: 149 IDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQIV 208
           IDP+PFDPP+FE  V+ERL N  SKE+QL DRLID+NT+RWRYSRD NQ+VFKESNA IV
Sbjct: 156 IDPIPFDPPTFENVVRERLTNGLSKEEQLEDRLIDQNTIRWRYSRDDNQRVFKESNATIV 215

Query: 209 QWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSR 268
           QWSDG++SLKLGDEYTDIL NDTDNTF  VSHDQQELMQC  GGE++K+L+F+P ST+S+
Sbjct: 216 QWSDGSYSLKLGDEYTDILLNDTDNTFLTVSHDQQELMQCVHGGEISKSLLFVPISTTSK 275

Query: 269 MHQKLTKAVMRRDHKQAAGPGTYIVQKDP 297
           +HQ+L+KA++RR+  +  GP + IV  DP
Sbjct: 276 LHQRLSKAIVRRNATETMGPRSMIVNIDP 304

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 21/40 (52%), Positives = 26/40 (65%), Gaps = 8/40 (20%)

Query: 392 AERLRRLKREGANNY--------EERKRRRVAVIDDEEDE 423
           AERLR LKR+G   Y        E  KRR+VAVI+D+ED+
Sbjct: 418 AERLRELKRQGTAAYNDDEKSGSESPKRRKVAVIEDDEDD 457

>KLTH0F15928g Chr6 (1295609..1296880) [1272 bp, 423 aa] {ON} similar
           to uniprot|P38439 Saccharomyces cerevisiae YOR123C LEO1
           Component of the Paf1 complex which associates with RNA
           polymerase II and is involved in histone methylation
          Length = 423

 Score =  273 bits (699), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 123/213 (57%), Positives = 161/213 (75%), Gaps = 1/213 (0%)

Query: 92  YTRKFYGEDVDRVSDXXXXXXXXXXXXXLVRHIVPYRATQGTDKPVLYYAKIPEFLTIDP 151
           Y RKFYG D    S+             +++HIVPY          +YY K+P+FLTIDP
Sbjct: 71  YNRKFYG-DKGEDSNDEGSQEFREADIDIMKHIVPYSTEPSQGDKTIYYTKVPQFLTIDP 129

Query: 152 VPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQQVFKESNAQIVQWS 211
           +PFDPP+F++ ++ER   + S EDQ+ DRLI+ENTVRWRYSRD NQ+VFKESNA IVQWS
Sbjct: 130 IPFDPPAFQSKIEERAAQRTSVEDQIDDRLIEENTVRWRYSRDKNQRVFKESNAHIVQWS 189

Query: 212 DGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPTSTSSRMHQ 271
           DGT+SL+LGDEYTD+L NDT++T+ AVSHDQQEL+Q  +GGEVTK ++FIPTST+S+ HQ
Sbjct: 190 DGTYSLRLGDEYTDVLINDTEDTYLAVSHDQQELIQSVKGGEVTKNMIFIPTSTNSKSHQ 249

Query: 272 KLTKAVMRRDHKQAAGPGTYIVQKDPELERGEL 304
           +L+KAV R++ ++  GP TYI++ DPELE+ EL
Sbjct: 250 RLSKAVARKEQQEHHGPNTYILRVDPELEQKEL 282

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 28/49 (57%), Gaps = 17/49 (34%)

Query: 392 AERLRRLKREGANNYEER-----------------KRRRVAVIDDEEDE 423
           AERLR+LKR+GA  Y  +                 KRR+VAV+DDE+DE
Sbjct: 375 AERLRQLKRKGAAQYNTQEASDNNVESDDAEDSAMKRRKVAVLDDEDDE 423

>TBLA0A06490 Chr1 (1595241..1596527) [1287 bp, 428 aa] {ON}
           Anc_5.440 YOR123C
          Length = 428

 Score =  271 bits (694), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 165/221 (74%), Gaps = 9/221 (4%)

Query: 92  YTRKFYGED-VDRVSDXXXXXXXXXXXXXLVRHIVPYRATQGTDKPV-----LYYAKIPE 145
           Y +KFYGED  +R  D             LVRHIVPY+ T+ ++K +     LYYAK+P 
Sbjct: 59  YEKKFYGEDGFNRSDDDDNEYEYKESDIELVRHIVPYK-TRPSNKELDKHRELYYAKVPP 117

Query: 146 FLTIDPVPFDPPSFEASVKERLGNKASKEDQLGDRLIDENTVRWRYSRDANQ--QVFKES 203
           FL +DPVPFD  +FE++VKER+ N  +++ Q+ DRL DENT+RWRYSRD+N   +VFK+S
Sbjct: 118 FLMVDPVPFDSTNFESAVKERIKNSLNEDTQITDRLRDENTIRWRYSRDSNDNDKVFKQS 177

Query: 204 NAQIVQWSDGTFSLKLGDEYTDILSNDTDNTFFAVSHDQQELMQCYEGGEVTKTLMFIPT 263
           NAQI+QWSDG++SLKLG++YTDIL+N+TDN F  VSHDQQELMQCY GGE+TKTLMFIP+
Sbjct: 178 NAQIIQWSDGSYSLKLGNDYTDILTNETDNIFLTVSHDQQELMQCYNGGEITKTLMFIPS 237

Query: 264 STSSRMHQKLTKAVMRRDHKQAAGPGTYIVQKDPELERGEL 304
           ST S++HQ+LT AV  RD K  +GPG  ++  DPE+E+  L
Sbjct: 238 STKSKIHQRLTAAVQNRDKKTTSGPGMMLINTDPEIEKKLL 278

>Kwal_26.7316 s26 (309798..312194) [2397 bp, 798 aa] {ON} YJL102W
           (MEF2) - mitochondrial elongation factor G-like protein
           [contig 47] FULL
          Length = 798

 Score = 33.1 bits (74), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 147 LTIDPVPFDPPSFEASVKER-LGNKASKEDQLG 178
           L I+P+   PP F AS++ + LGNK S ED L 
Sbjct: 442 LKINPIVTPPPVFSASIEPKTLGNKKSMEDSLA 474

>SAKL0D05324g Chr4 (420393..422786) [2394 bp, 797 aa] {ON} similar
           to uniprot|P39677 Saccharomyces cerevisiae YJL102W MEF2
           mitochondrial elongation factor G-like protein
          Length = 797

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 21/33 (63%), Gaps = 1/33 (3%)

Query: 147 LTIDPVPFDPPSFEASVKER-LGNKASKEDQLG 178
           L I+P+   PP F A+++ R LGN+ S ED L 
Sbjct: 440 LRINPIEIPPPVFSAAIEPRTLGNRKSMEDSLA 472

>Kwal_55.21296 s55 (774344..775222) [879 bp, 292 aa] {OFF} [contig
           130] FULL
          Length = 292

 Score = 31.6 bits (70), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 11/64 (17%)

Query: 193 RDANQQVFKESNAQIVQWSDGTFSLKLGDEYTDILSND----TDNTFFAVSHDQQE-LMQ 247
           R  N QV  +S     QW  GT+SL  GD+ T +L  D    TD+ F+ ++ DQ+  L+ 
Sbjct: 24  RLVNWQVSLDSE----QW--GTWSLFFGDDLTSLLVQDGVDTTDSLFWTLNLDQENRLLD 77

Query: 248 CYEG 251
            + G
Sbjct: 78  LWLG 81

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,232,970
Number of extensions: 1238378
Number of successful extensions: 3355
Number of sequences better than 10.0: 27
Number of HSP's gapped: 3397
Number of HSP's successfully gapped: 43
Length of query: 423
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 311
Effective length of database: 40,638,807
Effective search space: 12638668977
Effective search space used: 12638668977
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)