Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F10142g5.439ON1261266662e-91
Smik_15.2995.439ON1261265682e-76
YOR122C (PFY1)5.439ON1261265682e-76
Suva_8.1745.439ON1261265632e-75
TDEL0D026205.439ON1261265596e-75
Skud_15.2845.439ON1261265587e-75
TPHA0E017405.439ON1261265587e-75
KNAG0B042205.439ON1261265526e-74
SAKL0G02640g5.439ON1261265483e-73
KLTH0F15950g5.439ON1261265466e-73
KAFR0D050405.439ON1261265432e-72
CAGL0I01078g5.439ON1261265423e-72
NDAI0C015805.439ON1261265381e-71
Kpol_1062.275.439ON1261265352e-71
NCAS0H020705.439ON1261265328e-71
KLLA0E02289g5.439ON1261265274e-70
ACL168C5.439ON1261265162e-68
TBLA0A065005.439ON1191265111e-67
Ecym_45105.439ON1261265075e-67
Kwal_55.214135.439ON58582525e-29
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F10142g
         (126 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381...   261   2e-91
Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381...   223   2e-76
YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,...   223   2e-76
Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 b...   221   2e-75
TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa...   219   6e-75
Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381...   219   7e-75
TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa...   219   7e-75
KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa...   217   6e-74
SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381...   215   3e-73
KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 1...   214   6e-73
KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 ...   213   2e-72
CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {...   213   3e-72
NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 ...   211   1e-71
Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa] ...   210   2e-71
NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 ...   209   8e-71
KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381...   207   4e-70
ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 ...   203   2e-68
TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 11...   201   1e-67
Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [38...   199   5e-67
Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C ...   101   5e-29

>ZYRO0F10142g Chr6 complement(820724..821091,821172..821184) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  261 bits (666), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 126/126 (100%), Positives = 126/126 (100%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG
Sbjct: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY
Sbjct: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LIGAQY
Sbjct: 121 LIGAQY 126

>Smik_15.299 Chr15 complement(513420..513787,513992..514004) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  223 bits (568), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 114/126 (90%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYT+NL+GTGK+DKA IYSRAGD++WA+SGGL+  P EIG+I  GFD P+GLQS G
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L +QGQKFMLLRADDRSIY RHDAEG+ CVRTKQT+I+AHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LIG QY
Sbjct: 121 LIGVQY 126

>YOR122C Chr15 complement(552298..552665,552875..552887) [381 bp,
           126 aa] {ON}  PFY1Profilin, binds actin,
           phosphatidylinositol 4,5-bisphosphate, and polyproline
           regions; involved in cytoskeleton organization; required
           for normal timing of actin polymerization in response to
           thermal stress
          Length = 126

 Score =  223 bits (568), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 114/126 (90%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYT+NL+GTGK+DKA IYSRAGD++WA+SGGL+  P EIG+I  GFD P+GLQS G
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAVWATSGGLSLQPNEIGEIVQGFDNPAGLQSNG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L +QGQKFMLLRADDRSIY RHDAEG+ CVRTKQT+I+AHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LIG QY
Sbjct: 121 LIGVQY 126

>Suva_8.174 Chr8 complement(310093..310460,310663..310675) [381 bp,
           126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  221 bits (563), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 99/126 (78%), Positives = 113/126 (89%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYT+NL+GTGK+DKA I+SRAGD++WA+SGGL+  P EIG+I  GFD P GLQS G
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIFSRAGDAIWATSGGLSLQPNEIGEIVQGFDNPGGLQSNG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L +QGQKFMLLRADDRSIY RHDAEG+ CVRTKQT+I+AHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LIG QY
Sbjct: 121 LIGVQY 126

>TDEL0D02620 Chr4 (501856..501868,501937..502304) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  219 bits (559), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 102/126 (80%), Positives = 111/126 (88%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYT+NLLGTGK+DKA IYSRAGDS+WASSGGLT    EI +IA GFD P GLQS G
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSIWASSGGLTLQANEIQEIAQGFDSPVGLQSNG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L +QGQKFMLLRADDRSIY RHDAEG+ CVRTKQTI++AHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LI  QY
Sbjct: 121 LISVQY 126

>Skud_15.284 Chr15 complement(508731..509098,509302..509314) [381
           bp, 126 aa] {ON} YOR122C (REAL)
          Length = 126

 Score =  219 bits (558), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 97/126 (76%), Positives = 113/126 (89%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYT+NL+GTGK+DKA IYSRAGD++WA+SGGL+  P EI ++  GFD P+GLQS G
Sbjct: 1   MSWQAYTDNLIGTGKVDKAVIYSRAGDAIWATSGGLSLQPNEISEVVQGFDNPAGLQSNG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L +QGQKFMLLRADDRSIY RHDAEG+ CVRTKQT+I++HYPP+VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVICVRTKQTVIISHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LIG QY
Sbjct: 121 LIGVQY 126

>TPHA0E01740 Chr5 (352358..352370,352454..352821) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  219 bits (558), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 114/126 (90%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYT+NLL TGK+DKAA+YSRAGD+ WA+SGGL+   QE  +IA GFD+PSGLQ+TG
Sbjct: 1   MSWQAYTDNLLATGKVDKAALYSRAGDAAWAASGGLSLTAQEATEIAKGFDDPSGLQTTG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L +QGQKFMLLRADDRSIY RHDAEG+ CVRTKQTII+AHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LIG QY
Sbjct: 121 LIGVQY 126

>KNAG0B04220 Chr2 (803026..803038,803229..803596) [381 bp, 126 aa]
           {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  217 bits (552), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 109/126 (86%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYT+NLLGTGK+DKA IYSRAGDS+WA+SGGLT  P EI  I  GFD  +GLQS G
Sbjct: 1   MSWQAYTDNLLGTGKVDKAVIYSRAGDSVWATSGGLTLQPNEISAIVTGFDNQAGLQSNG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L VQGQKFM LRADDRSIY RHDAEG+ CVRTKQTI++AHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMFLRADDRSIYGRHDAEGVICVRTKQTILVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LI  QY
Sbjct: 121 LISVQY 126

>SAKL0G02640g Chr7 complement(217953..218320,218467..218479) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  215 bits (548), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 98/126 (77%), Positives = 110/126 (87%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYT+NLLGTGK+DKA IYSRAGD++WA+SGGL   P EI +IA GFD P+GLQS G
Sbjct: 1   MSWQAYTDNLLGTGKVDKAIIYSRAGDAIWATSGGLNLQPAEISEIAQGFDNPTGLQSNG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L +Q QKFML+RADDRSIY RHDAEG+ CVRTKQTI++AHYPP VQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLIRADDRSIYGRHDAEGVVCVRTKQTILIAHYPPGVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LI  QY
Sbjct: 121 LISVQY 126

>KLTH0F15950g Chr6 (1297129..1297141,1297227..1297594) [381 bp, 126
           aa] {ON} highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122C PFY1 Profilin actin- and
           phosphatidylinositol 4 5-bisphosphate-binding protein
           plays a role in cytoskeleton organization required for
           normal timing of actin polymerization in response to
           thermal stress localizes to plasma membrane and cytosol
          Length = 126

 Score =  214 bits (546), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 101/126 (80%), Positives = 111/126 (88%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYT+NLLGTGKIDKAAIYSRAGDSLWA+SGGL+    EIG+IA GF+ PSGLQSTG
Sbjct: 1   MSWQAYTDNLLGTGKIDKAAIYSRAGDSLWAASGGLSLPTNEIGEIAQGFENPSGLQSTG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L +QGQKFML+RADDRSIY RHDAEG+ CVRTKQTI++ HYP  VQAGEATKIVEQLADY
Sbjct: 61  LHLQGQKFMLIRADDRSIYGRHDAEGVICVRTKQTILVTHYPAGVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LI   Y
Sbjct: 121 LISVSY 126

>KAFR0D05040 Chr4 complement(992821..993188,993288..993300) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  213 bits (543), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 97/126 (76%), Positives = 109/126 (86%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYT+NLL T K+D+A IYSRAGD+ WA+SGG+   P EI +IA GFD  +GLQS G
Sbjct: 1   MSWQAYTDNLLATNKVDRAVIYSRAGDAAWATSGGMALQPNEIAEIAQGFDNAAGLQSNG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L +QGQKFMLLRADDRSIY RHDAEG+ CVRTKQTII+AHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTIIIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LIG QY
Sbjct: 121 LIGVQY 126

>CAGL0I01078g Chr9 (90566..90578,91000..91367) [381 bp, 126 aa] {ON}
           highly similar to uniprot|P07274 Saccharomyces
           cerevisiae YOR122c PFY1 profilin
          Length = 126

 Score =  213 bits (542), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 110/126 (87%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYT+NLL TGK+DKA IYS+AGD++WA+SGGL+    EI +I  GFD P+GLQS G
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSKAGDAVWATSGGLSLQANEISEIVQGFDNPTGLQSNG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L +QGQKFMLLRADDRSIY RHDAEG+ CVRTKQT+++AHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLIAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LI  QY
Sbjct: 121 LISVQY 126

>NDAI0C01580 Chr3 complement(339182..339549,339677..339689) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  211 bits (538), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 108/126 (85%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYT+NLL TGK+DKA IYSRAGDS+WA+SGG      EI +I  GFD P+GLQS G
Sbjct: 1   MSWQAYTDNLLATGKVDKAVIYSRAGDSVWATSGGFQLQANEISEICQGFDNPAGLQSNG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L +QGQKFMLLRADDRSIY RHDAEG+ CVRTKQT+++AHYPP+VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADDRSIYGRHDAEGVVCVRTKQTVLVAHYPPTVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LI  QY
Sbjct: 121 LISVQY 126

>Kpol_1062.27 s1062 (61009..61021,61207..61574) [381 bp, 126 aa]
           {ON} (61009..61021,61207..61574) [381 nt, 127 aa]
          Length = 126

 Score =  210 bits (535), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 98/126 (77%), Positives = 109/126 (86%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYT+NLL TGKIDKA +YSRAGD++WASSGGL  A  EI  IA GFD+PS LQS G
Sbjct: 1   MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L +QGQKFM+LRADDRSIY RHDAEG+ CVRTKQTI++AHYP +VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LI  QY
Sbjct: 121 LISVQY 126

>NCAS0H02070 Chr8 complement(403286..403653,403777..403789) [381 bp,
           126 aa] {ON} Anc_5.439 YOR122C
          Length = 126

 Score =  209 bits (532), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 109/126 (86%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQA T+NLL TGK+D+A +YSRAGDS+WA+SGGL   P EI +IA GFD P+GLQS G
Sbjct: 1   MSWQACTDNLLATGKVDRAVLYSRAGDSVWATSGGLQLQPNEIAEIARGFDNPAGLQSNG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L VQGQKFMLLRADD+SIY RHDAEG+ CVRT QTI++AHYPPSVQAGEATKIVEQLADY
Sbjct: 61  LHVQGQKFMLLRADDKSIYGRHDAEGIVCVRTLQTILIAHYPPSVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LI  +Y
Sbjct: 121 LISVKY 126

>KLLA0E02289g Chr5 complement(212983..213350,213571..213583) [381
           bp, 126 aa] {ON} highly similar to uniprot|P07274
           Saccharomyces cerevisiae YOR122C PFY1 Profilin actin-
           and phosphatidylinositol 4 5-bisphosphate-binding
           protein plays a role in cytoskeleton organization
           required for normal timing of actin polymerization in
           response to thermal stress localizes to plasma membrane
           and cytosol
          Length = 126

 Score =  207 bits (527), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (84%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYT+NLL TGKIDK+ IYSRAGD++WASSGGL   P EI +IA GFD PSGLQS G
Sbjct: 1   MSWQAYTDNLLATGKIDKSVIYSRAGDAVWASSGGLQLQPAEISEIARGFDNPSGLQSNG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L VQGQKFML++ADDRSIY RH+AEG+  VRTKQTI++ HYPP VQAGEATKIVEQL DY
Sbjct: 61  LHVQGQKFMLIKADDRSIYGRHEAEGIVIVRTKQTILIGHYPPGVQAGEATKIVEQLGDY 120

Query: 121 LIGAQY 126
           LI  QY
Sbjct: 121 LISVQY 126

>ACL168C Chr3 complement(62415..62782,62842..62854) [381 bp, 126 aa]
           {ON} Syntenic homolog of Saccharomyces cerevisiae
           YOR122C (PFY1); 1-intron
          Length = 126

 Score =  203 bits (516), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 93/126 (73%), Positives = 107/126 (84%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYT+NLL TGK+DKA IYSRAGD++WASSGGL   P EI +I+ GFD  +GLQ+ G
Sbjct: 1   MSWQAYTDNLLATGKVDKATIYSRAGDTIWASSGGLALEPSEIKEISQGFDNAAGLQANG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L +QGQKFMLLRAD+RSIY RH+AEG+  VRTKQTI++AHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQGQKFMLLRADERSIYGRHEAEGVVAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LI  QY
Sbjct: 121 LISVQY 126

>TBLA0A06500 Chr1 (1596802..1596814,1596982..1597328) [360 bp, 119
           aa] {ON} Anc_5.439 YOR122C
          Length = 119

 Score =  201 bits (511), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 97/126 (76%), Positives = 104/126 (82%), Gaps = 7/126 (5%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQA       TGK+DKA IYSRAGDS+WASSGGL     EI +IA GFD PSGLQS G
Sbjct: 1   MSWQA-------TGKVDKAVIYSRAGDSVWASSGGLQLGANEIAEIARGFDNPSGLQSNG 53

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L VQ QKFMLLRADDRSIY RHDAEG+ CVRTKQTI++AHYPP+VQAGEATKIVEQLADY
Sbjct: 54  LHVQSQKFMLLRADDRSIYGRHDAEGIVCVRTKQTIVIAHYPPTVQAGEATKIVEQLADY 113

Query: 121 LIGAQY 126
           LIG QY
Sbjct: 114 LIGVQY 119

>Ecym_4510 Chr4 complement(1019247..1019614,1019714..1019726) [381
           bp, 126 aa] {ON} similar to Ashbya gossypii ACL168C
           1-intron
          Length = 126

 Score =  199 bits (507), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 105/126 (83%)

Query: 1   MSWQAYTENLLGTGKIDKAAIYSRAGDSLWASSGGLTFAPQEIGKIAAGFDEPSGLQSTG 60
           MSWQAYT+NL+ TGK+DKA IYSRAGD++WASSGG++    EI +I+ GFD   GLQS G
Sbjct: 1   MSWQAYTDNLIATGKVDKAIIYSRAGDTIWASSGGMSLEANEISEISQGFDNAGGLQSNG 60

Query: 61  LFVQGQKFMLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADY 120
           L +Q QKFMLLRADDRSIY RH+AEG+  VRTKQTI++AHYP  VQAGEATKIVEQLADY
Sbjct: 61  LHIQSQKFMLLRADDRSIYGRHEAEGIIAVRTKQTILIAHYPAGVQAGEATKIVEQLADY 120

Query: 121 LIGAQY 126
           LI  QY
Sbjct: 121 LISVQY 126

>Kwal_55.21413 s55 (825487..825663) [177 bp, 58 aa] {ON} YOR122C
           (PFY1) - profilin (actin-binding protein) [contig 130]
           FULL
          Length = 58

 Score =  101 bits (252), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 50/58 (86%)

Query: 69  MLLRADDRSIYARHDAEGMCCVRTKQTIILAHYPPSVQAGEATKIVEQLADYLIGAQY 126
           ML+RADDRSIY RHDAEG+ CVRTKQTI++ HYP  VQAGEATKIVEQLADYLI   Y
Sbjct: 1   MLIRADDRSIYGRHDAEGVVCVRTKQTILVTHYPAGVQAGEATKIVEQLADYLISVSY 58

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,047,235
Number of extensions: 404304
Number of successful extensions: 737
Number of sequences better than 10.0: 20
Number of HSP's gapped: 737
Number of HSP's successfully gapped: 20
Length of query: 126
Length of database: 53,481,399
Length adjustment: 95
Effective length of query: 31
Effective length of database: 42,588,129
Effective search space: 1320231999
Effective search space used: 1320231999
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)