Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F10120g5.438ON1051055548e-75
TDEL0D026305.438ON102994411e-57
CAGL0A02882g5.438ON1041024046e-52
NCAS0F034105.438ON1061053993e-51
KNAG0C048805.438ON1041023923e-50
Kwal_55.214145.438ON1191023664e-46
SAKL0G02618g5.438ON1041013525e-44
NDAI0B057005.438ON1041023463e-43
KLTH0F15972g5.438ON1031013463e-43
Kpol_1016.35.438ON971023412e-42
KLLA0E02267g5.438ON1031013231e-39
Ecym_45095.438ON1031013055e-37
Kpol_1016.3asingletonON971022961e-35
ACL169W5.438ON1031012926e-35
TPHA0C00950singletonON991052501e-28
KAFR0D02490singletonON107951972e-20
TBLA0C05870singletonON1001061651e-15
KAFR0D02400singletonON114901485e-13
KAFR0D02500singletonON112901284e-10
Kwal_14.18516.104ON53543700.24
AEL126W1.172ON40056623.4
NDAI0A053803.321ON163084623.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F10120g
         (105 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserv...   218   8e-75
TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON...   174   1e-57
CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly ...   160   6e-52
NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438     158   3e-51
KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON...   155   3e-50
Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {O...   145   4e-46
SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserv...   140   5e-44
NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5....   137   3e-43
KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa] ...   137   3e-43
Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON} co...   135   2e-42
KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserv...   129   1e-39
Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar ...   122   5e-37
Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON} c...   118   1e-35
ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No h...   117   6e-35
TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON}                100   1e-28
KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}      80   2e-20
TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {...    68   1e-15
KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON}                62   5e-13
KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}      54   4e-10
Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {O...    32   0.24 
AEL126W Chr5 (386410..387612) [1203 bp, 400 aa] {ON} Syntenic ho...    28   3.4  
NDAI0A05380 Chr1 complement(1212670..1217562) [4893 bp, 1630 aa]...    28   3.9  

>ZYRO0F10120g Chr6 (820318..820635) [318 bp, 105 aa] {ON} conserved
           hypothetical protein
          Length = 105

 Score =  218 bits (554), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 105/105 (100%), Positives = 105/105 (100%)

Query: 1   MVEWVVIAFDKADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHLQV 60
           MVEWVVIAFDKADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHLQV
Sbjct: 1   MVEWVVIAFDKADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHLQV 60

Query: 61  VADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQPVNKLK 105
           VADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQPVNKLK
Sbjct: 61  VADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQPVNKLK 105

>TDEL0D02630 Chr4 complement(502356..502664) [309 bp, 102 aa] {ON}
          Anc_5.438
          Length = 102

 Score =  174 bits (441), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 79/99 (79%), Positives = 88/99 (88%)

Query: 1  MVEWVVIAFDKADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHLQV 60
          MVEWVVI +DK DRSA+R  HLAGIPP VE GKLVCAGAIYNEP  PG  RTFAGSHLQ+
Sbjct: 1  MVEWVVIVYDKGDRSAFRPAHLAGIPPLVEQGKLVCAGAIYNEPTTPGGERTFAGSHLQI 60

Query: 61 VADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQ 99
          VADTKEEA+E+VK DIFAKEGVWDLDN+I+YQFGCA+R+
Sbjct: 61 VADTKEEALEVVKGDIFAKEGVWDLDNIIIYQFGCAVRK 99

>CAGL0A02882g Chr1 (302262..302576) [315 bp, 104 aa] {ON} highly
           similar to KLLA0E02266g Kluyveromyces lactis
          Length = 104

 Score =  160 bits (404), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 73/102 (71%), Positives = 87/102 (85%), Gaps = 2/102 (1%)

Query: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58
           MVEW VI +DK  +DRS  R +HLAGIPP VE+GKLVCAGAIYNEP   G  RTFAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSTCRPQHLAGIPPLVEAGKLVCAGAIYNEPAQAGGERTFAGSHL 60

Query: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQP 100
           Q+VADTKEEA+E+V +D+FAK G+WDL+N+I+YQFGCA+RQP
Sbjct: 61  QIVADTKEEALELVHNDVFAKNGIWDLENIIIYQFGCAVRQP 102

>NCAS0F03410 Chr6 (687900..688220) [321 bp, 106 aa] {ON} Anc_5.438
          Length = 106

 Score =  158 bits (399), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 73/105 (69%), Positives = 89/105 (84%), Gaps = 2/105 (1%)

Query: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58
           MVEW VI +DK  +DRSA+R +HLA IP  VE GKLVCAGAIYNEPK+ GE  TFAGSHL
Sbjct: 1   MVEWCVIVYDKPGSDRSAFRPQHLAAIPALVEQGKLVCAGAIYNEPKSEGEAPTFAGSHL 60

Query: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQPVNK 103
           Q++ADTKEEA+ IV +DIFAKEG+WD DN+I+Y+FGCA+R+P +K
Sbjct: 61  QIIADTKEEALAIVMNDIFAKEGIWDTDNIIIYRFGCAVREPKSK 105

>KNAG0C04880 Chr3 complement(944928..945242) [315 bp, 104 aa] {ON}
           Anc_5.438
          Length = 104

 Score =  155 bits (392), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 69/102 (67%), Positives = 84/102 (82%), Gaps = 2/102 (1%)

Query: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58
           MVEW  + +DK  +DRS +R EHLA IP  V+ GKLVCAGAIYNEP  PG  RTFAGSHL
Sbjct: 1   MVEWCAVVYDKPGSDRSQFRPEHLANIPKLVQQGKLVCAGAIYNEPTTPGGDRTFAGSHL 60

Query: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQP 100
           Q+VADTKEEA+E++  D+FAKEG+WDL N+I+YQFGCA+R+P
Sbjct: 61  QIVADTKEEALEVIHGDVFAKEGIWDLSNIILYQFGCAVREP 102

>Kwal_55.21414 s55 complement(825799..826158) [360 bp, 119 aa] {ON}
           [contig 130] FULL
          Length = 119

 Score =  145 bits (366), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 68/102 (66%), Positives = 81/102 (79%), Gaps = 2/102 (1%)

Query: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58
           MVEW VI +DK  +DRS +R  HL GIP  VE GKLVCAGAIY +    G+   FAGSHL
Sbjct: 16  MVEWCVIVYDKKGSDRSLFRPAHLQGIPKLVEEGKLVCAGAIYQDVSPEGKLSNFAGSHL 75

Query: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQP 100
           Q+VADTKEEA+EIVK D+FAKEG+WDL+N+I+Y FGCA+RQP
Sbjct: 76  QIVADTKEEALEIVKGDVFAKEGIWDLENIIIYPFGCAVRQP 117

>SAKL0G02618g Chr7 (217435..217749) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score =  140 bits (352), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 82/101 (81%), Gaps = 2/101 (1%)

Query: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58
           MVEW V+ +DK  ADRS +R  HLAGIPP VE GKLVCAGAI+NE    G+P  FAGS L
Sbjct: 1   MVEWCVVVYDKPNADRSQFRPAHLAGIPPLVEQGKLVCAGAIFNEIPQEGKPLNFAGSQL 60

Query: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQ 99
            +VAD+KEEA+ +VK+D+FAKEG+WDL+N++++ FGCA+R+
Sbjct: 61  TIVADSKEEALGVVKNDVFAKEGIWDLENILIFPFGCAVRK 101

>NDAI0B05700 Chr2 (1388730..1389044) [315 bp, 104 aa] {ON} Anc_5.438
          Length = 104

 Score =  137 bits (346), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 67/102 (65%), Positives = 78/102 (76%), Gaps = 2/102 (1%)

Query: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58
           MVEW VI  DK  +DRSA+ S+H AGIP  VE GK+VC GAIYNEP   G   T AGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSAFNSQHFAGIPALVEQGKVVCGGAIYNEPTEEGGNPTVAGSHL 60

Query: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQP 100
           QVVADTKEE +E+VK DIFAKEG+WD+DN I+Y+F  A+R P
Sbjct: 61  QVVADTKEEVMELVKKDIFAKEGIWDVDNAIIYRFDAALRLP 102

>KLTH0F15972g Chr6 complement(1297711..1298022) [312 bp, 103 aa]
           {ON} conserved hypothetical protein
          Length = 103

 Score =  137 bits (346), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 80/101 (79%), Gaps = 2/101 (1%)

Query: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58
           MVEW VI FDK  +DRSA R  HL G+  Q E G LVCAGAIY+E    G+P  FAGSHL
Sbjct: 1   MVEWCVIVFDKKGSDRSACRPAHLEGVAQQYEKGTLVCAGAIYHEVGPDGKPTNFAGSHL 60

Query: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQ 99
           Q+ A+TKE+A+++VK+DIFAKEG+WDL+N+I+Y FGCA+RQ
Sbjct: 61  QISANTKEDALQVVKNDIFAKEGIWDLENIIIYPFGCAVRQ 101

>Kpol_1016.3 s1016 complement(6319..6612) [294 bp, 97 aa] {ON}
           complement(6319..6612) [294 nt, 98 aa]
          Length = 97

 Score =  135 bits (341), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 80/102 (78%), Gaps = 8/102 (7%)

Query: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58
           MVEW VI  DK  +DRS  R +HLAGIPP VE GKL CAGAIYN+        +FAGSHL
Sbjct: 1   MVEWCVIINDKKGSDRSELRPQHLAGIPPLVEQGKLKCAGAIYNDDG------SFAGSHL 54

Query: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQP 100
           Q+VADTKE+A+E+VK D+FA  G+WDLD++I+Y+FGCA+RQP
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIIIYKFGCAVRQP 96

>KLLA0E02267g Chr5 (212406..212717) [312 bp, 103 aa] {ON} conserved
           hypothetical protein
          Length = 103

 Score =  129 bits (323), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 81/101 (80%), Gaps = 3/101 (2%)

Query: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58
           MVEWVVI +DK  +DRSA R +HLAGIPP VE+GK+V AGAIY +    G+P  FAGSHL
Sbjct: 1   MVEWVVIVYDKPGSDRSACRPQHLAGIPPLVEAGKIVHAGAIYKD-VVDGKPANFAGSHL 59

Query: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQ 99
            +VAD+K+E +E++K+D+FAK  +WD+DN ++Y FGCA+R+
Sbjct: 60  TIVADSKDEVVELLKNDVFAKNDIWDVDNALIYPFGCAVRK 100

>Ecym_4509 Chr4 (1018498..1018809) [312 bp, 103 aa] {ON} similar to
           Ashbya gossypii ACL169W
          Length = 103

 Score =  122 bits (305), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 77/101 (76%), Gaps = 3/101 (2%)

Query: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58
           MVEW V  +DK  +DRS YRS HL  IP  V+ GK+V AGAIY +    G+P  FAGSHL
Sbjct: 1   MVEWCVTVYDKPGSDRSPYRSMHLERIPELVQEGKIVVAGAIYKD-LVDGKPGGFAGSHL 59

Query: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQ 99
            +VADT+EE +E++K DI+AKEGVWD+DN++++ FGCA+R+
Sbjct: 60  ILVADTREEVVELLKGDIYAKEGVWDMDNILIFPFGCAVRK 100

>Kpol_1016.3a s1016 complement(7088..7381) [294 bp, 97 aa] {ON}
           complement(7088..7381) [294 nt, 98 aa]
          Length = 97

 Score =  118 bits (296), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 55/102 (53%), Positives = 73/102 (71%), Gaps = 8/102 (7%)

Query: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58
           M EW +I  DK  ++RS   S+H AGI P VE G L C GAIYN+        + AGSHL
Sbjct: 1   MSEWCIIINDKKGSNRSELLSQHFAGISPLVEQGILTCGGAIYNDDG------SVAGSHL 54

Query: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQP 100
           Q+VADTKE+A+E+VK D+FA  G+WDLD++++Y+F CA+RQP
Sbjct: 55  QIVADTKEQALEVVKGDVFATGGIWDLDSIVIYKFACAVRQP 96

>ACL169W Chr3 (61958..62269) [312 bp, 103 aa] {ON} NOHBY311; No
           homolog in Saccharomyces cerevisiae
          Length = 103

 Score =  117 bits (292), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 73/101 (72%), Gaps = 3/101 (2%)

Query: 1   MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58
           MVEW  I +DK   DRS +R EHLA IP  VE GKLV AGAIY E    G P  FAGS L
Sbjct: 1   MVEWCAIIYDKPGVDRSVHRQEHLAEIPKLVEQGKLVQAGAIYKEV-VDGRPSQFAGSQL 59

Query: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQ 99
            +VAD++EEA+ I++ D FAK GVWD++N+++Y FGCA+R+
Sbjct: 60  TLVADSREEALAIIRDDPFAKHGVWDVENVVLYPFGCAVRK 100

>TPHA0C00950 Chr3 (203282..203581) [300 bp, 99 aa] {ON} 
          Length = 99

 Score =  100 bits (250), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 72/105 (68%), Gaps = 10/105 (9%)

Query: 1   MVEWVVIAFDKAD----RSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGS 56
           M E+VV+  D A     R  +  EH   IPP V++G +VC GA++NE  +P       GS
Sbjct: 1   MSEYVVVIKDHAGAEKLREQHGPEHFGNIPPLVDAGIVVCGGAMFNEEGSP------VGS 54

Query: 57  HLQVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQPV 101
           H+Q+VAD++E+ +E++K D+FA+E VWDL++ I+Y+F CA+R+P+
Sbjct: 55  HIQIVADSREQVLEMLKKDVFARENVWDLESAIIYKFDCAVRKPM 99

>KAFR0D02490 Chr4 complement(498165..498488) [324 bp, 107 aa] {ON}
          
          Length = 107

 Score = 80.5 bits (197), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 8/95 (8%)

Query: 1  MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58
          M EW+V   DK  ADR+ Y   HLA +P   E   LV AGA+       G+     GS  
Sbjct: 1  MPEWIVNVQDKPEADRAPYNDRHLAALPGLFEKKVLVSAGALI------GDNGKEVGSSF 54

Query: 59 QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQF 93
          QVVA++KE+AI ++K+DIFAKEGV++LD+ + Y+F
Sbjct: 55 QVVAESKEDAINVIKNDIFAKEGVYNLDSFVCYRF 89

>TBLA0C05870 Chr3 complement(1422912..1423214) [303 bp, 100 aa] {ON}
           
          Length = 100

 Score = 68.2 bits (165), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 57/106 (53%), Gaps = 8/106 (7%)

Query: 1   MVEWVVIAFD--KADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58
           M EW V   D   +DR+    EH+  +P  + +G L C GA+ ++           GSH 
Sbjct: 1   MTEWYVTIKDIPNSDRTPVLKEHMDRLPILINAGVLSCGGALLDDNG------NMIGSHF 54

Query: 59  QVVADTKEEAIEIVKSDIFAKEGVWDLDNLIVYQFGCAIRQPVNKL 104
           ++  +TKEEA++++  D F K GVWD++++ + +F C  R+    L
Sbjct: 55  ELKVETKEEAMKLINEDPFVKGGVWDMNSIQIRKFYCVHREEYKTL 100

>KAFR0D02400 Chr4 (483506..483850) [345 bp, 114 aa] {ON} 
          Length = 114

 Score = 61.6 bits (148), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 54/90 (60%), Gaps = 8/90 (8%)

Query: 1  MVEWVVIAFDK--ADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58
          M EW+V   D    DR+ Y  EH+  +P  V+ G +V AGA+        E +   G  +
Sbjct: 1  MPEWLVKVKDNKDVDRAPYYPEHMRDLPSLVDGGIIVVAGALTTP-----EGKEIGGMFI 55

Query: 59 QVVADTKEEAIEIVKSDIFAKEGVWDLDNL 88
           V A TKEEAIEIVK D+FA++G++++D++
Sbjct: 56 -VTAKTKEEAIEIVKRDVFARKGIFNMDSV 84

>KAFR0D02500 Chr4 complement(498712..499050) [339 bp, 112 aa] {ON}
          
          Length = 112

 Score = 53.9 bits (128), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/90 (38%), Positives = 50/90 (55%), Gaps = 8/90 (8%)

Query: 1  MVEWVVIAFD--KADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHL 58
          M EW+V   D   ADR+ Y  EH+  +    +   LV AGA+      P    T  G  L
Sbjct: 1  MPEWLVKIEDIEGADRTPYYPEHMQNLKNLFDEKILVGAGALTT----PEGKET--GGIL 54

Query: 59 QVVADTKEEAIEIVKSDIFAKEGVWDLDNL 88
           + A TKEEAIE+VK D+FA++G++ +D +
Sbjct: 55 IIAAKTKEEAIEVVKRDVFARKGIFKMDTI 84

>Kwal_14.1851 s14 complement(494548..496155) [1608 bp, 535 aa] {ON}
           YBR212W (NGR1) - negative growth regulatory protein
           [contig 235] FULL
          Length = 535

 Score = 31.6 bits (70), Expect = 0.24,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 1/43 (2%)

Query: 18  RSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRT-FAGSHLQ 59
           R   +  +P  + +  L  A  ++N+P APG   + FA SHLQ
Sbjct: 474 RHSAMQDMPSCLPAANLNRAATVWNQPAAPGSTNSMFASSHLQ 516

>AEL126W Chr5 (386410..387612) [1203 bp, 400 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL175W (ZRT3)
          Length = 400

 Score = 28.5 bits (62), Expect = 3.4,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 10/56 (17%)

Query: 7   IAFDKADRSAYRSEHLAGIPPQVESGKLVCAGAIYNEPKAPGEPRTFAGSHLQVVA 62
           I +D  + + YR ++ AG+P    +G+  CAG   +E  A  E       HL V+A
Sbjct: 177 IGYDLENLATYREQYRAGLPSN--AGETACAGE--DEEHAAAE------RHLHVLA 222

>NDAI0A05380 Chr1 complement(1212670..1217562) [4893 bp, 1630 aa] {ON}
            Anc_3.321
          Length = 1630

 Score = 28.5 bits (62), Expect = 3.9,   Method: Composition-based stats.
 Identities = 22/84 (26%), Positives = 36/84 (42%), Gaps = 10/84 (11%)

Query: 31   SGKLVCAGAIYNEPKAPGEPRTF-------AGSHLQVVADTKEEAIEIVKSDI---FAKE 80
            S KL    +++NE K   EP +          +H   +    E+  EI   DI    +  
Sbjct: 1294 SSKLKKEVSLFNEKKENYEPSSSIVDDVFKPKTHTPSLVAPTEKKKEITNKDISMPLSFV 1353

Query: 81   GVWDLDNLIVYQFGCAIRQPVNKL 104
              +D ++LI Y+  C +  PVN +
Sbjct: 1354 NKFDSNSLIYYEIACILMNPVNDV 1377

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.408 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 10,779,344
Number of extensions: 373194
Number of successful extensions: 696
Number of sequences better than 10.0: 25
Number of HSP's gapped: 677
Number of HSP's successfully gapped: 25
Length of query: 105
Length of database: 53,481,399
Length adjustment: 75
Effective length of query: 30
Effective length of database: 44,881,449
Effective search space: 1346443470
Effective search space used: 1346443470
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)