Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F10098g5.437ON37337320130.0
KAFR0E038205.437ON3963667696e-99
NDAI0B056905.437ON4233877342e-93
TDEL0B021805.437ON4183677324e-93
Smik_4.6365.437ON4463756806e-85
NCAS0F034005.437ON4153986621e-82
YDR370C5.437ON4423846404e-79
Suva_2.5425.437ON4423816188e-76
Skud_4.6395.437ON4423896152e-75
KNAG0C048905.437ON4053776089e-75
Kpol_1016.45.437ON4133676011e-73
SAKL0G02596g5.437ON4003625556e-67
TPHA0J026005.437ON4413785386e-64
KLTH0F15994g5.437ON3903635102e-60
CAGL0A02860g5.437ON4022894878e-57
Kwal_55.214155.437ON3893564676e-54
AER404C5.437ON3863564529e-52
TBLA0A028005.437ON4534104463e-50
KLLA0E02245g5.437ON4032843962e-43
KLLA0E12893g3.570ON3842431024e-04
KLLA0E23013g5.42ON33591830.083
KLTH0E09702g2.390ON60744721.9
YLR128W (DCN1)8.322ON26968702.5
YKL178C (STE3)1.167ON47059677.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F10098g
         (373 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {...   780   0.0  
KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.4...   300   6e-99
NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON} Anc_5...   287   2e-93
TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.4...   286   4e-93
Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {...   266   6e-85
NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {O...   259   1e-82
YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}...   251   4e-79
Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON...   242   8e-76
Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {...   241   2e-75
KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.4...   238   9e-75
Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}...   236   1e-73
SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {...   218   6e-67
TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {...   211   6e-64
KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weak...   201   2e-60
CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {...   192   8e-57
Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370...   184   6e-54
AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}...   178   9e-52
TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.4...   176   3e-50
KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {...   157   2e-43
KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]...    44   4e-04
KLLA0E23013g Chr5 complement(2049719..2050726) [1008 bp, 335 aa]...    37   0.083
KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} simila...    32   1.9  
YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {...    32   2.5  
YKL178C Chr11 complement(113215..114627) [1413 bp, 470 aa] {ON} ...    30   7.9  

>ZYRO0F10098g Chr6 complement(818672..819793) [1122 bp, 373 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 373

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/373 (100%), Positives = 373/373 (100%)

Query: 1   MSHSKCSRNRAQLPSVPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSIG 60
           MSHSKCSRNRAQLPSVPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSIG
Sbjct: 1   MSHSKCSRNRAQLPSVPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSIG 60

Query: 61  LKSPGNKLSHDRSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTS 120
           LKSPGNKLSHDRSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTS
Sbjct: 61  LKSPGNKLSHDRSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTS 120

Query: 121 YSQRSPFVVISPRHYLVELTMQLFQQSKYSILCTHLGDGKIVLSQVENDKKSHQHTSRNT 180
           YSQRSPFVVISPRHYLVELTMQLFQQSKYSILCTHLGDGKIVLSQVENDKKSHQHTSRNT
Sbjct: 121 YSQRSPFVVISPRHYLVELTMQLFQQSKYSILCTHLGDGKIVLSQVENDKKSHQHTSRNT 180

Query: 181 TMTKKILHSGYALEDLLTRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELTETFTE 240
           TMTKKILHSGYALEDLLTRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELTETFTE
Sbjct: 181 TMTKKILHSGYALEDLLTRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELTETFTE 240

Query: 241 LKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKI 300
           LKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKI
Sbjct: 241 LKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKI 300

Query: 301 NDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENVDRSSPQCFKLTIDESHKIQLEK 360
           NDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENVDRSSPQCFKLTIDESHKIQLEK
Sbjct: 301 NDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENVDRSSPQCFKLTIDESHKIQLEK 360

Query: 361 LKHVPAHVELPIR 373
           LKHVPAHVELPIR
Sbjct: 361 LKHVPAHVELPIR 373

>KAFR0E03820 Chr5 (758469..759659) [1191 bp, 396 aa] {ON} Anc_5.437
           YDR370C
          Length = 396

 Score =  300 bits (769), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 146/366 (39%), Positives = 235/366 (64%), Gaps = 15/366 (4%)

Query: 17  PFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSIG----LKSPGNKLSHDR 72
           PF +FQH S   FP+ P N F   +E + Y+ G++++    S      L    +K++   
Sbjct: 31  PFKRFQHRSIAYFPNHPANFFQISREVATYHDGRIYEPNETSQDILPLLNKDISKIAQGV 90

Query: 73  SCSNKRDF----LGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQRSPFV 128
           S  + R +    +GSDLYQG+E+F  +S E LDS+  C+ +I KWE  +H  Y++   + 
Sbjct: 91  SAIDARKYKVKYIGSDLYQGFENFESMSREELDSALPCFAYIKKWEAHHHCKYTENKKYT 150

Query: 129 VISPRHYLVELTMQLFQQSKYSIL-CTHLGDGKIVLSQVENDKKSHQHT--SRNTTMTKK 185
           ++S RH++V L M +F  SK +I+  T+LG+G +  SQ  +D  +      ++N  + KK
Sbjct: 151 IVSARHHIVNLIMSIFDTSKETIVNSTYLGNGLLTFSQDTSDPMTMNEGIFTKNKNL-KK 209

Query: 186 ILHSGYALEDLLTRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELTETFTELKCYA 245
           I +SG+ALEDLLT+    + +P F+I E +LD NI+L+LRCE+D+YN+LT+ +TELKCYA
Sbjct: 210 ICYSGFALEDLLTKS---QKEPLFSITENQLDDNITLLLRCEMDAYNQLTQNYTELKCYA 266

Query: 246 PLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRNL 305
           PL M +  HR+KLLKTWIQ  + P  DL+ G+R+ + G L D+++++   LYR+ N+RNL
Sbjct: 267 PLKMASPQHRKKLLKTWIQTGVLPSSDLMFGIRSPYNGELLDIEWYSRDGLYRRFNNRNL 326

Query: 306 PKSPKRFNYNADLAVQWCQHCIRSICKLVGENVDRSSPQCFKLTIDESHKIQLEKLKHVP 365
           P++ K  N+NA++AV+W  HCI++IC+L+ +N+   +PQ F++ +D    I +  L  +P
Sbjct: 327 PENKKSLNFNANIAVEWSHHCIKTICELISDNLQGDAPQAFQIKVDTFRNISIRNLSKIP 386

Query: 366 AHVELP 371
            + ++P
Sbjct: 387 QNAQIP 392

>NDAI0B05690 Chr2 (1387153..1388424) [1272 bp, 423 aa] {ON}
           Anc_5.437 YDR370C
          Length = 423

 Score =  287 bits (734), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 153/387 (39%), Positives = 234/387 (60%), Gaps = 32/387 (8%)

Query: 13  LPSVPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSI---------GLKS 63
           + ++PF QF+H S   +P  P + F   K+ + Y+  QL+ S   ++          L +
Sbjct: 36  ITTIPFKQFKHCSISTYPKTPSSFFETSKDVALYHNKQLYSSDDTNLIPQLEPAIAKLAN 95

Query: 64  PGNKLSHDRSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQ 123
           P   L+  R    K  +LGSDLY G+E F+P+ P+ LDS   C+++I  WE  N   Y  
Sbjct: 96  PSCSLNEARDL--KLPYLGSDLYDGYESFIPMDPDELDSIEPCFKYIESWELQNKHDYQL 153

Query: 124 RSPFVVISPRHYLVELTMQLFQQSK---YSILCTHLG--DGKIVLSQVENDKKSHQHTSR 178
            + F ++S RH++VE+TM +F + K   + +  T+ G  +G ++ S+  N K      S+
Sbjct: 154 GNKFTIVSARHHIVEMTMCIFNKRKMDDFILNVTYKGGSNGMLLFSRDVNKKDDGGIYSK 213

Query: 179 NTTMTKKILHSGYALEDLLTRGPRVE------------DDPFFAIIEAELDANISLVLRC 226
           +  + +KI +SG+ALEDLLT                  D   FAIIE +L+ +ISL+LRC
Sbjct: 214 DGVV-RKISYSGFALEDLLTTNKNDHNADNSDVTLVGGDKAVFAIIENKLNDDISLLLRC 272

Query: 227 ELDSYNELTETFTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQ 286
           E+DSYN + + FTE+KC+A L M+N  HR KLLK W+Q  + P  D+LIG+R+   G L 
Sbjct: 273 EMDSYNPVNKCFTEMKCFARLKMNNHNHRRKLLKAWVQTGVIPNSDILIGIRDPMFGELN 332

Query: 287 DLQYFTNKELYRKINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENVDRS---SP 343
           D+++F+   LYR+IN+RNLP++    NYNA++AVQW QHCI+SICKLV E++D++   + 
Sbjct: 333 DIEWFSRMNLYRQINNRNLPEAKLDLNYNAEIAVQWSQHCIKSICKLVDESIDKTRLNTS 392

Query: 344 QCFKLTIDESHKIQLEKLKHVPAHVEL 370
           Q F++ I+ S  IQ++KLK VP +V +
Sbjct: 393 QSFQIRINASRAIQIKKLKSVPNNVTM 419

>TDEL0B02180 Chr2 (388145..389401) [1257 bp, 418 aa] {ON} Anc_5.437
           YDR370C
          Length = 418

 Score =  286 bits (732), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 145/367 (39%), Positives = 228/367 (62%), Gaps = 13/367 (3%)

Query: 16  VPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQL--HDSISDSI--GLKSPGNKLSHD 71
           +PF++F+HS    FP +  + F   +E + Y  G L   DS    +   L+     ++ +
Sbjct: 50  IPFSKFEHSDLDYFPDDTADFFEGCEEVATYQNGYLFMKDSSKKPLYPCLQMFAALIAEN 109

Query: 72  RSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQRSPFVVIS 131
           R   NK  ++G DLYQG E + PL    LDSS  C+++I KWE    +         +IS
Sbjct: 110 RGPKNKLPYIGCDLYQGHERYKPLPSSELDSSIACFEYIKKWERRKISKSFNSGKVTIIS 169

Query: 132 PRHYLVELTMQLFQQSKYSILCTHLGDGKIVLSQVENDKKSHQHTSRNTTMTKKILHSGY 191
           PRH++V+L M LF   + SI+CT++G GK++ S   + ++ +   S+N+ MT+KI +SG+
Sbjct: 170 PRHHVVDLVMALFHDDEVSIICTNIGKGKLIFSGDRSKEERNGLNSKNS-MTRKICYSGF 228

Query: 192 ALEDLLTRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELTETFTELKCYAPLNMHN 251
           ALED LT        PF++I+E +++  +SL+LRCE+D+YN +   +TELKC+  LN+ +
Sbjct: 229 ALEDKLTTSHDERMGPFYSIVEGKINERLSLLLRCEMDAYNPIFNRYTELKCFTKLNVQD 288

Query: 252 AYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRNLPKSPKR 311
             HR KLLKTW+Q+ + P  DL+IG R+T +G L+DL +++   LY+K N+ ++ ++ K 
Sbjct: 289 TAHRRKLLKTWVQIGLIPDSDLIIGTRDTQVGQLEDLTWYSRGSLYKKFNNPSIARNNKY 348

Query: 312 FNYNADLAVQWCQHCIRSICKLVGENVDRSSP-------QCFKLTIDESHKIQLEKLKHV 364
            N+NA++AV+WC HCI SIC LV +N   SSP       + FK+ +D+SH I ++KL  V
Sbjct: 349 LNFNANIAVEWCFHCIESICDLVMKN-SLSSPDDPYPKYESFKVIVDKSHNIIVKKLTKV 407

Query: 365 PAHVELP 371
           P HV++P
Sbjct: 408 PRHVQIP 414

>Smik_4.636 Chr4 complement(1137846..1139186) [1341 bp, 446 aa] {ON}
           YDR370C (REAL)
          Length = 446

 Score =  266 bits (680), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 140/375 (37%), Positives = 226/375 (60%), Gaps = 21/375 (5%)

Query: 16  VPFNQFQHSSAFRFPSEP-RNLFTKYKEASYYYGGQLHDSISDSI--GLKSPGNKLSHDR 72
           V +  F HS   +FP++P R++F + KE + +  GQ + ++   I   LK    +L  +R
Sbjct: 66  VSYTSFSHSGMHKFPAKPPRDIFHESKEVALFTNGQAYTTVRKDILPNLKGDIAELC-ER 124

Query: 73  SCSNKRD----FLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTS-YSQRSPF 127
           S  + R+    +LG DL+     F+P++   LDS   C  +I  W  +NH   +     F
Sbjct: 125 SLLDARERKLPYLGHDLFANIGQFVPMTISELDSILPCISYIENWRLNNHGEDFKIGRKF 184

Query: 128 VVISPRHYLVELTMQLF--QQSKYSILCTHLGDGKIVLS--QVENDKKSHQHTSRNTTMT 183
            V++ RH++V++TM LF  +  K S++ T++G G I  S  Q  + + S +    +    
Sbjct: 185 TVVTTRHHIVDMTMHLFDRRNKKRSLVATYMGAGLISFSRNQKNDSRMSKEGIYSSDPNM 244

Query: 184 KKILHSGYALEDLLTRGPRVEDD-----PFFAIIEAELDANISLVLRCELDSYNELTETF 238
           KKI +SG+  E+ +T G +  D      P F+++E++L   I L++RCE+D++N ++   
Sbjct: 245 KKICYSGFEFENWVTEGIKAADLNGSKLPVFSVVESKLSEEIGLLIRCEMDAFNPVSGAN 304

Query: 239 TELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYR 298
           TELKC+APL+MHN+ HR KLLKTWIQ  +SP  D++IG+R++H G L D+Q+++   L  
Sbjct: 305 TELKCFAPLSMHNSNHRRKLLKTWIQTGLSPNSDIMIGLRDSHSGQLLDIQWYSRDSLCM 364

Query: 299 KINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENVDRSS---PQCFKLTIDESHK 355
           K N   LP + +  NYNA +AV+WC HCI+SIC+L+G N+   S   P+ F+++ID ++ 
Sbjct: 365 KFNHSGLPSNKRELNYNAKVAVEWCNHCIKSICELLGANISDYSCKNPESFEISIDSNNT 424

Query: 356 IQLEKLKHVPAHVEL 370
           I + KLK++P HVEL
Sbjct: 425 IAITKLKNIPKHVEL 439

>NCAS0F03400 Chr6 complement(686480..687727) [1248 bp, 415 aa] {ON}
           Anc_5.437 YDR370C
          Length = 415

 Score =  259 bits (662), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 147/398 (36%), Positives = 232/398 (58%), Gaps = 39/398 (9%)

Query: 7   SRNRAQLPSVPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSI--GLKS- 63
           S+ +A +  VPF +F HSS   FP+  +  +    + + Y+  +L+ +    I   LK+ 
Sbjct: 17  SQKQAPITRVPFGEFSHSSISLFPTCTQPFYESSNQVALYHNHKLYPASQYDIIPHLKND 76

Query: 64  ----PGNKLSHDRSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHT 119
               P    S  R+   KR +LGSDLY G+E F+P+S + LDS   C  +I  WE    T
Sbjct: 77  IAQLPKKSASEARTL--KRSYLGSDLYDGFETFVPMSAKDLDSLEPCMSFIKDWERKAST 134

Query: 120 SYSQRSPFVVISPRHYLVELTMQLF-----------QQSKYSILCTHLGD--GKIVLSQV 166
            Y     F ++S RH++VE+TM+LF           +   Y +   + GD  G+++ ++ 
Sbjct: 135 KYKPGRKFNIVSTRHHIVEMTMKLFTGKTNNYNNTKKVQDYVLNVVYTGDETGRLLFTKD 194

Query: 167 ENDKKSHQHT---SRNTTMTKKILHSGYALEDLLTR--------GPRVE--DDPFFAIIE 213
            ++  +  +    S+N  + K+I +SG+ALEDL+T         G ++   +   FA++E
Sbjct: 195 WSNTGNSMNEGIYSKNIIL-KRICYSGFALEDLMTETTSELEKEGEKLTGGEKAVFAVVE 253

Query: 214 AELDANISLVLRCELDSYNELTETFTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDL 273
            +LD +I ++LRCELD++N   + FTELKC++PL M N  HR KLLK W+Q  + P  D+
Sbjct: 254 NKLDDDICILLRCELDAFNGAEKKFTELKCFSPLKMSNFSHRRKLLKAWVQTGVLPDSDI 313

Query: 274 LIGVRNTHMGLLQDLQYFTNKELYRKINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKL 333
           LIG+R++  G L+D+++++   L  KIN+RNLP+S   +N+NA +A QW QHCIRSICKL
Sbjct: 314 LIGIRDSSFGELEDVEWYSRDRLRSKINNRNLPESKIDWNFNAQVATQWSQHCIRSICKL 373

Query: 334 VGENVDR---SSPQCFKLTIDESHKIQLEKLKHVPAHV 368
           V EN+D+   S+PQ F++ ID    I+++ L  VP  +
Sbjct: 374 VDENLDQKAISNPQGFQIRIDSRRNIRIKCLSKVPKDI 411

>YDR370C Chr4 complement(1217782..1219110) [1329 bp, 442 aa] {ON}
           Putative protein of unknown function
          Length = 442

 Score =  251 bits (640), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 140/384 (36%), Positives = 226/384 (58%), Gaps = 23/384 (5%)

Query: 8   RNRAQLPSVPFNQFQHSSAFRFPSEP-RNLFTKYKEASYYYGGQLHDSISDSI--GLKSP 64
           + R +L  +P+  F H+    F ++P R++F + KE + +  G+ +  +   +   LK  
Sbjct: 58  KRRPKLICIPYTSFLHTGMHNFLTKPPRDIFHESKEVALFTNGRAYTILRKDLIPNLKES 117

Query: 65  GNKLSHDRSCSNKR---DFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDN-HTS 120
             +L        K+    +LG DL+   ++F+P++   LDS   C+ +I  W  DN    
Sbjct: 118 IAELYESSLLEAKKRKVPYLGHDLFANIDEFVPMTISELDSVSPCFSYIENWILDNPGKD 177

Query: 121 YSQRSPFVVISPRHYLVELTMQLFQQS--KYSILCTHLGDGKIVLSQVENDKKSHQHTSR 178
           +     F V++ RH++V+LTM LF +   + S++ T++G G  +LS   N KK  Q +  
Sbjct: 178 FKIGKKFTVVTTRHHIVDLTMHLFNRRNRQTSLIVTYMGAG--LLSFCRNVKKDSQMSKE 235

Query: 179 ----NTTMTKKILHSGYALEDLLTRGPRVEDD-----PFFAIIEAELDANISLVLRCELD 229
               N    KKI +SG+  E+ +T   +V D      P F+++E++L   I L++RCE+D
Sbjct: 236 GIYSNDPNMKKICYSGFEFENWVTENSKVADLTGSKCPIFSLVESKLSEEIGLLIRCEMD 295

Query: 230 SYNELTETFTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQ 289
           ++N ++ET TELKC+APL+MHN+ HR KLLKTW+Q  + P  D++IG+R++H G L D+Q
Sbjct: 296 AFNPVSETNTELKCFAPLSMHNSNHRRKLLKTWVQTGLLPNSDIMIGLRDSHSGQLLDIQ 355

Query: 290 YFTNKELYRKINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENV-DRSS--PQCF 346
           +++   L +K N   LP + K  NYNA +AV+WC +CI +ICKLV  N+ D SS  P+ F
Sbjct: 356 WYSRDLLCKKFNHPGLPTNKKELNYNAQIAVEWCHYCIEAICKLVEANISDYSSTKPESF 415

Query: 347 KLTIDESHKIQLEKLKHVPAHVEL 370
           ++ ID ++ I + KLK  P +VEL
Sbjct: 416 EIGIDTNNAIVITKLKTTPRNVEL 439

>Suva_2.542 Chr2 complement(968396..969724) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  242 bits (618), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 133/381 (34%), Positives = 222/381 (58%), Gaps = 23/381 (6%)

Query: 11  AQLPSVPFNQFQHSSAFRFPSEPR-NLFTKYKEASYYYGGQLHDSISDSI--GLKSPGNK 67
           ++   VP++ F H+S   FP++P  ++F + KE + +   QL+ +    +   LK   + 
Sbjct: 61  SEFTRVPYSSFLHTSIRNFPTKPPPDIFYESKEVALFTDNQLYVAARKDVIPNLKEDISH 120

Query: 68  LSHD---RSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWE-NDNHTSYSQ 123
           L       +   K  +LG DL+   ++ +P++   LD+   C  +I  W  N++   +  
Sbjct: 121 LYESPLLEARKLKTLYLGLDLFANIDELVPMTISELDTIAPCISYIEDWRLNNSGKPFKI 180

Query: 124 RSPFVVISPRHYLVELTMQLF--QQSKYSILCTHLGDGKIVLSQVENDKKSHQHTSRNT- 180
              F V++ RH++V+LTM  F  +  + SI+ T++G+G I LS+  N K  H+ +     
Sbjct: 181 GKKFTVVTTRHHIVDLTMHPFDRRNKQKSIIATYMGNGFISLSR--NPKYDHKASKEGIY 238

Query: 181 ---TMTKKILHSGYALEDLLTR-----GPRVEDDPFFAIIEAELDANISLVLRCELDSYN 232
                 KKI HSG+  E+ LT      G      P F+I+E +L  +I L++RCE+D++N
Sbjct: 239 SGDPNIKKICHSGFEFENCLTENTKNSGSSASKCPVFSIVEGKLSEDIGLLMRCEMDAFN 298

Query: 233 ELTETFTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFT 292
            +++T TELKC+ PL+M N+ HR+KLLKTWIQ  + P  D+++G+R+++ G L D+Q+++
Sbjct: 299 PVSKTNTELKCFGPLSMQNSSHRKKLLKTWIQTGLLPNSDIMVGLRDSYSGQLLDIQWYS 358

Query: 293 NKELYRKINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENVDR---SSPQCFKLT 349
              L+RK N   LP + K  NYNA +AV+WC+HCI+SIC LV  N+ R   + P+ F++ 
Sbjct: 359 RDTLFRKFNHPGLPLNKKEMNYNAKVAVEWCKHCIKSICDLVEANISRYNCNKPEPFEIN 418

Query: 350 IDESHKIQLEKLKHVPAHVEL 370
           ID +  I + KL  +P +VE+
Sbjct: 419 IDANGTIIITKLSTIPRNVEI 439

>Skud_4.639 Chr4 complement(1140646..1141974) [1329 bp, 442 aa] {ON}
           YDR370C (REAL)
          Length = 442

 Score =  241 bits (615), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 137/389 (35%), Positives = 223/389 (57%), Gaps = 29/389 (7%)

Query: 4   SKCSRNRAQLPSVPFNQFQHSSAFRFPSEP-RNLFTKYKEASYYYGGQ--------LHDS 54
           ++CSR +     VP+  F H+S      +P  ++F   KE + +   Q        L  S
Sbjct: 58  NRCSRFKC----VPYTSFVHTSIHDLSRKPPGDIFQDSKEVALFTNYQAYTTARKDLIPS 113

Query: 55  ISDSIGLKSPGNKLSHDRSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWE 114
           + D I      + L   R    K  +LG DL+   + F+P++   LDS   C  ++  W+
Sbjct: 114 LRDGITELYESSLLEARR---RKVPYLGHDLFANIDQFVPMTISELDSISPCISYVENWK 170

Query: 115 NDNH-TSYSQRSPFVVISPRHYLVELTMQLF--QQSKYSILCTHLGDGKIVLSQ-VEND- 169
             NH  ++     F ++S RH++V+LTM  F  +  + S++ T++G G I  S+  +ND 
Sbjct: 171 LSNHGKNFKIGKKFTIVSARHHIVDLTMHRFDRRNKRKSLIVTYMGAGLISFSRNPKNDF 230

Query: 170 KKSHQHTSRNTTMTKKILHSGYALEDLLTRGPRVED-----DPFFAIIEAELDANISLVL 224
           + S +    +    KKI +SG+  E  +T   +  D      P F+++E++L  +I L++
Sbjct: 231 QMSKEGIYSSDPNMKKICYSGFEFEHWVTEDIKATDLNGPKHPIFSVVESKLSEDIGLLM 290

Query: 225 RCELDSYNELTETFTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGL 284
           RCE+D++N ++ T TELKC+ PL+MHN+ HR+KLLKTWIQ  + P  D++IG+R++H G 
Sbjct: 291 RCEIDAFNPVSRTNTELKCFGPLSMHNSNHRKKLLKTWIQTGLLPNSDIVIGLRDSHSGQ 350

Query: 285 LQDLQYFTNKELYRKINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENV---DRS 341
           L D+Q+++   LY+K N   LP S K  N+NA +AV+WC HCI+SIC+LV  N+   + +
Sbjct: 351 LLDIQWYSRDSLYKKFNHPGLPPSKKELNFNAKVAVEWCNHCIKSICELVEANISHYNST 410

Query: 342 SPQCFKLTIDESHKIQLEKLKHVPAHVEL 370
            P+ F+++ID +  I + KL  VP +VEL
Sbjct: 411 RPESFEVSIDANGTIAITKLNTVPKNVEL 439

>KNAG0C04890 Chr3 (945616..946833) [1218 bp, 405 aa] {ON} Anc_5.437
           YDR370C
          Length = 405

 Score =  238 bits (608), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 129/377 (34%), Positives = 217/377 (57%), Gaps = 24/377 (6%)

Query: 16  VPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSIGL----------KSPG 65
           V F +F H    ++ S+P ++F K KE + Y GG+L+ +  ++  L           +  
Sbjct: 28  VRFKEFHHHDPGKYVSKPAHIFQKSKEVACYTGGKLYINDGNTTNLTILPLLKEDIAALA 87

Query: 66  NKLSHDRSCSNKRDFLGSDLYQGWEDFL-PLSPEILDSSRGCYQWINKWE--NDNHTSYS 122
              +  +S S K  +LG  LY G+ED++  +SP++LDS++ C  +IN+W   +     + 
Sbjct: 88  QSKNTQKSGSFKSKYLGLSLYAGFEDYVFTMSPDMLDSAKPCLDYINEWNRGSKGEKKFG 147

Query: 123 QRSPFVVISPRHYLVELTMQLF-QQSKYSILCTHLGDGKIVLSQVENDKKSHQHTSRNTT 181
           +    +++ PRH+LVELTM LF   S Y ++CT L    IVLSQ   D  S ++ +   T
Sbjct: 148 ESYRHIIVGPRHHLVELTMALFANDSDYKLVCTVLRGKFIVLSQF--DDGSQRNRNEGIT 205

Query: 182 M----TKKILHSGYALEDLLTRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELTET 237
           +    T+ + +SG+ +  + +    +    FF         +++    CE+D+YN++   
Sbjct: 206 LSDRRTRMLCYSGFVICKIWSLNRGIIPSQFFYYGTPIRRGHLA-TFTCEMDAYNQIENH 264

Query: 238 FTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELY 297
           +TELKCY PLNM ++YH+ KLL+TW+Q  +SP  D++IG RN + G LQD+   + + LY
Sbjct: 265 YTELKCYGPLNMKSSYHKSKLLRTWVQTEVSPDTDVVIGCRNAYDGTLQDITQLSRESLY 324

Query: 298 RKINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENVDRSS---PQCFKLTIDESH 354
           RK N+++ P++   FNYNA +AV+W Q+ +++I +L+  N+++ S   PQ F +T+   H
Sbjct: 325 RKFNNKHQPRAHTNFNYNAQVAVEWSQYAMKAIIRLIEGNLNQKSVLEPQAFVVTVYRGH 384

Query: 355 KIQLEKLKHVPAHVELP 371
            I + KLK VP + E+P
Sbjct: 385 DIGIRKLKGVPKYAEIP 401

>Kpol_1016.4 s1016 (8493..9362,9366..9737) [1242 bp, 413 aa] {ON}
           (8493..9362,9366..9737) [1242 nt, 414 aa]
          Length = 413

 Score =  236 bits (601), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 129/367 (35%), Positives = 219/367 (59%), Gaps = 15/367 (4%)

Query: 16  VPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSIG--LKSPGNKLSHDRS 73
           +PF++F HS+A  FP + ++LF + K  +++   QL  ++ D+    LK     +S    
Sbjct: 41  IPFHRFVHSNARSFPQKTKDLFLESKTVAFFQKDQLFINVEDAALPLLKKDIANISGKSV 100

Query: 74  CSNKR---DFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTS-YSQRSPFVV 129
            ++K+    +LGSDLY   + + PL  ++LDS + C+ +I  WEN++    Y   + + +
Sbjct: 101 LNSKKYKLPYLGSDLYASTDKYGPLPEDVLDSPKPCFDFIRHWENEHRGEHYGAHADYTI 160

Query: 130 ISPRHYLVELTMQLFQQSK---YSILCTHLGDGKIVLSQVENDKKSHQHT---SRNTTMT 183
           +SPRH++ E+ M LF+  K     +LCT+L +G I+LS+ +    S+ +T   + +  MT
Sbjct: 161 LSPRHHITEIVMSLFEDEKNCSVYLLCTYLKNGIILLSKDDASSSSNSNTTGLNSSNPMT 220

Query: 184 KKILHSGYALEDLLTRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELTETFTELKC 243
           +KI +SG+A EDL+         P F+++E++L  +I+L+LR ELD YN +T  FTELKC
Sbjct: 221 RKICYSGFAFEDLVLEDIAENARPIFSVVESKLTESINLLLRNELDGYNNVTNMFTELKC 280

Query: 244 YAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDR 303
           +APL     +  +++LKTW+Q  + P  D++IG+R+T  GLL+DL ++  K+L R  N+ 
Sbjct: 281 FAPLKC--MFSAKEVLKTWVQTGLIPESDIVIGIRDTQSGLLEDLVWYNRKDLCRTFNNP 338

Query: 304 NLPKSPKRFNYNADLAVQWCQHCIR-SICKLVGENVDRSSPQCFKLTIDESHKIQLEKLK 362
           +LP +P  FN+NA++AV+W +  +   +  +     D + P  FKL ID    I ++KL 
Sbjct: 339 SLPPAPSHFNFNANIAVEWLKFTMESIVSLVSSSIADSNHPCSFKLKIDNHKTISIQKLS 398

Query: 363 HVPAHVE 369
            +P  V+
Sbjct: 399 RIPQTVQ 405

>SAKL0G02596g Chr7 complement(214675..215877) [1203 bp, 400 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 400

 Score =  218 bits (555), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 123/362 (33%), Positives = 198/362 (54%), Gaps = 22/362 (6%)

Query: 21  FQHSSAFRFPSEPRNLFTKYKEASYYY-----GGQLHDSISDSIGLKSPGNKLSH----- 70
           F HS+   FPS P   F + +E   +      G  L D   D +GL+   + +       
Sbjct: 30  FVHSNVSHFPSVPCKFFQESREIGTFTRMVSSGKYLFD---DKLGLRPLKDDICEYIHNP 86

Query: 71  -DRSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQRSPFVV 129
              +   K  +LG DL  G+ED++PLS + L++  G   +I  WE  N   Y   + F +
Sbjct: 87  AKNASKIKTQYLGYDLLNGFEDYIPLSEDELNNMDGILNFIGNWEEKNGKKYGSENKFTI 146

Query: 130 ISPRHYLVELTMQLFQQSKYSILCTHLGDGKIVLSQVENDKKSHQHTSRNTTMTKKILHS 189
           +S RH+L++L M  F   + +++ THL DG +++S  ++  K         T  +K+ ++
Sbjct: 147 VSNRHHLIDLIMCPFSLEEANLIVTHL-DGLLIISSDKSKPKVDSGIRSKDTRVRKLCYT 205

Query: 190 GYALEDLLTRGPRVEDDP-----FFAIIEAELDANISLVLRCELDSYNELTETFTELKCY 244
           G+ LE+L+T+G    D P     F++I+E +L   +SL+L+ E+DSYN  T+ + ELKC 
Sbjct: 206 GFELENLVTKGKV--DSPGMHTCFYSIVENKLTEGVSLLLQAEMDSYNPKTDNYVELKCS 263

Query: 245 APLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRN 304
               + N+ HR KLL+ WIQ  + PR DLL+G R+ +   L  L+ +T  E+Y+K + RN
Sbjct: 264 VNFQLKNSNHRRKLLRMWIQTGLVPRTDLLVGFRDPYYNQLDALKPYTRDEIYKKFSTRN 323

Query: 305 LPKSPKRFNYNADLAVQWCQHCIRSICKLVGENVDRSSPQCFKLTIDESHKIQLEKLKHV 364
           L ++ K +N+N+ +AVQW  H I  I +LV +N+     Q FKLT+    ++ L KL + 
Sbjct: 324 LNENRKYYNFNSTVAVQWSHHVIAKITELVDKNLTDEPLQSFKLTLTRDLQLSLTKLANT 383

Query: 365 PA 366
           PA
Sbjct: 384 PA 385

>TPHA0J02600 Chr10 complement(577310..578635) [1326 bp, 441 aa] {ON}
           Anc_5.437 YDR370C
          Length = 441

 Score =  211 bits (538), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 121/378 (32%), Positives = 207/378 (54%), Gaps = 25/378 (6%)

Query: 16  VPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSIGLKSPGNKLSHDRSCS 75
           +PF  F +S+A    S+P N+F + K  + YY  ++    ++   L +  N     +  S
Sbjct: 63  IPFKHFSYSNAHIGKSQP-NIFQEAKGVALYYDKRITKITNNEAELINESNPPFLTKDIS 121

Query: 76  N------------KRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQ 123
           N            K  ++G +LY   E F P+   +LDS+  C++++   +         
Sbjct: 122 NLSEISLLDSKKFKLPYMGYNLYDEIEKFGPMDSTLLDSTVPCFEYLRTLKISEEDKL-Y 180

Query: 124 RSPFVVISPRHYLVELTMQLFQQ-----SKYSILCTHLGDGKIVLSQ---VENDKKSHQH 175
            +P+  ++PRH+L EL M +++      +  S L T + D  IV+S+    EN+     H
Sbjct: 181 NTPYTFMTPRHHLTELMMTVYESRESELTGKSWLFTRIKDDLIVISEDLAKENNPSPQNH 240

Query: 176 TSRNTTMTKKILHSGYALEDLLTRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELT 235
             +N+  +KK+++SG+  E+L+    +    P+F I E  L    + ++R E+DSYN  T
Sbjct: 241 KLQNS-FSKKVINSGFTFEELVIENFQECHKPYFYISENRLTPKSTFIIRSEMDSYNNKT 299

Query: 236 ETFTELKCYAPLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKE 295
           ETFTELKC+  L++  A HR+KLLKTW Q  +SP CD++IG+R+T  G+L+DL +++ + 
Sbjct: 300 ETFTELKCFNKLHLGVAQHRKKLLKTWFQTGLSPNCDIVIGIRDTSSGILEDLLWYSREN 359

Query: 296 LYRKINDRNLPKSPKRFNYNADLAVQWCQHCIRSICKLVGENVD--RSSPQCFKLTIDES 353
           +Y+K+ D +LPK    F++   + +QW  HCI +I     ++     S+P  +K+ ID+ 
Sbjct: 360 MYQKLQDPSLPKFKNSFDFKPHIGIQWLNHCIHAIESAFTKDTSDTASNPMTYKVIIDKH 419

Query: 354 HKIQLEKLKHVPAHVELP 371
             I ++KL  VP +VE+P
Sbjct: 420 KSIIIKKLSIVPKNVEIP 437

>KLTH0F15994g Chr6 (1298649..1299821) [1173 bp, 390 aa] {ON} weakly
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370C Hypothetical ORF
          Length = 390

 Score =  201 bits (510), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 109/363 (30%), Positives = 196/363 (53%), Gaps = 17/363 (4%)

Query: 21  FQHSSAFRFPSEPRNLFTKYKEASYYYGGQLH--DSISDSIGLKSPGNKLSHD------- 71
           F+ +S   FP+EP + F + KE     G   H  DS    +G K     L  D       
Sbjct: 24  FERASISHFPAEPLHFFDEVKEI----GTMTHWIDSDKFELGRKQSAPHLKKDLGLFTIT 79

Query: 72  RSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQRSPFVVIS 131
           +  +    ++G DL + ++DF PL+P  L+   G ++++NKWE D+   YS  S F ++ 
Sbjct: 80  KKLAKTNSYVGHDLLEHYDDFQPLTPNQLEDMSGVFEFLNKWEGDHGKPYSSGSDFTIVC 139

Query: 132 PRHYLVELTMQLFQQSKYSILCTHLGDGKIVLSQVENDKKSHQHTSRNTTMTKKILHSGY 191
            RH L++L M  F          ++     +    +  KK     S  + + ++I ++G+
Sbjct: 140 SRHNLIDLIMAPFSDEDVHFNVKYINGYLHIFPDKQFQKKDDGIYSSESNI-RRICYTGF 198

Query: 192 ALEDLLTRG-PRVEDDPFFAIIEAELDANISLVLRCELDSYNELTETFTELKCYAPLNMH 250
            LEDL+T   P      F+++++ ++  NI L+ + E+D +N    ++TE+KC   L + 
Sbjct: 199 ELEDLVTETQPGAPKSAFYSLVQGKISKNIKLLFKAEMDCFNPAKRSYTEIKCTTGLKVK 258

Query: 251 NAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRNLPKSPK 310
           +A+HR KLL+ W+Q ++ P  DLLIG+R+ +   L   + +T +ELY+K N+RNL    K
Sbjct: 259 SAFHRRKLLRMWVQTSLVPSTDLLIGLRDPYYHQLSSFECYTRQELYQKFNNRNLSLLKK 318

Query: 311 RFNYNADLAVQWCQHCIRSICKLVGENVDRSSPQC--FKLTIDESHKIQLEKLKHVPAHV 368
           ++NYNA+++VQW +H ++ +C+ +   V+++  +   FKLT+ +  +++L K++      
Sbjct: 319 KYNYNANISVQWFRHLVKRLCQTITPYVEKTPTEAVSFKLTLTKQLELRLRKIETPSTAK 378

Query: 369 ELP 371
           E P
Sbjct: 379 ESP 381

>CAGL0A02860g Chr1 complement(300736..301944) [1209 bp, 402 aa] {ON}
           similar to uniprot|Q06349 Saccharomyces cerevisiae
           YDR370c
          Length = 402

 Score =  192 bits (487), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 99/289 (34%), Positives = 170/289 (58%), Gaps = 8/289 (2%)

Query: 78  RDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQRSPFVVISPRHYLV 137
           R FLG  LY+  + + P++ + LD++  C  +++++EN +   Y +   FV+++ RH+++
Sbjct: 109 RPFLGISLYENHDKYSPMTAKELDTTEACSTYLDQYENSHGQKYGEDRDFVIVTARHHMI 168

Query: 138 ELTMQLF--QQSKYSILCTHLGDGKIVLSQVENDKKSHQ-HTSRNTTMTKKILHSGYALE 194
           +L +  F  Q +  ++LC +     + +SQ   D  + +   + +  + KKI  SG+ALE
Sbjct: 169 DLAILPFSRQFTNVNLLCAYTPGNLLEISQDPADNTNDKVGVNTDNPILKKICFSGFALE 228

Query: 195 DLLTRGPRVED-DPFFAIIEAELDANISLVLRCELDSYNELTETFTELKCYAPLNMHNAY 253
           D+LT     E+ +P F I+E E+ AN  L++RCE+D+YN +T  +TELKCYA  N  N  
Sbjct: 229 DILTESANDEERNPTFLIVENEI-ANTRLLMRCEIDAYNPITSHYTELKCYAKYNFGNPN 287

Query: 254 HREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRNLPKSPKRFN 313
           HR KLLK+WIQ  + P  D++IGVR+T  G LQD++ +    LY K+  ++LP+     N
Sbjct: 288 HRRKLLKSWIQTGVIPTTDIVIGVRDTESGCLQDVRCYNRNLLYNKLISKSLPRCDSELN 347

Query: 314 YNADLAVQWCQHCIRSICKLVGENVD---RSSPQCFKLTIDESHKIQLE 359
           Y+  ++V W +  I ++   +   +D   R  PQ F + +D +  I++E
Sbjct: 348 YDPAISVVWYRSLINTLTTTIASLLDKFGRDEPQLFSIKVDNNCNIRIE 396

>Kwal_55.21415 s55 (826461..827630) [1170 bp, 389 aa] {ON} YDR370C -
           Hypothetical ORF [contig 130] FULL
          Length = 389

 Score =  184 bits (467), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 101/356 (28%), Positives = 193/356 (54%), Gaps = 13/356 (3%)

Query: 21  FQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDS----ISDSIGLKSPGNKL---SHDRS 73
           FQH+   +FP      F + +E +      L D+    + D +G+      L   +    
Sbjct: 24  FQHAQINQFPKNVLPFFDEVQEVATI--THLLDTDEFLLDDKLGMPELVQDLCEFTESGK 81

Query: 74  CSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQRSPFVVISPR 133
            +NK  ++G DL   +++++P++P+ L+   G   ++ +W+  +  S+   + F ++  R
Sbjct: 82  LANKGKYIGHDLLDHFDEYVPITPKQLEDMAGVQAFLERWKQLHGRSFCDNADFTIVCSR 141

Query: 134 HYLVELTMQLFQQSKYSILCTHLGDGKIVLSQVENDKKSHQHTSRNTTMTKKILHSGYAL 193
           H L++L M  F       L     +G + LS     +K+ Q      T  KKI ++G+ L
Sbjct: 142 HNLIDLIMMPFSDEDVH-LKIQFSNGYLNLSPDAQYQKTDQGIHSGDTKIKKICYTGFEL 200

Query: 194 EDLLTRGPRVE-DDPFFAIIEAELDANISLVLRCELDSYNELTETFTELKCYAPLNMHNA 252
           E+L+T   + +    F++++E +L   I L+L+ E+D +N  T ++TE+KC + L + + 
Sbjct: 201 ENLITATSKPDVRSSFYSLVEGKLGDGIKLLLKAEMDCFNSSTRSYTEIKCSSGLKVKST 260

Query: 253 YHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRNLPKSPKRF 312
           YHR KLL+ W+Q ++ P  +LL+G+R+ +   L   + +T  +LYRK N++ L    K +
Sbjct: 261 YHRRKLLRMWVQTSLVPSTNLLVGIRDPYYHQLTSFECYTRSQLYRKFNNQRLTVMRKNY 320

Query: 313 NYNADLAVQWCQHCIRSICKLVGENVDRSSPQ--CFKLTIDESHKIQLEKLKHVPA 366
           NYNA ++VQW +H I+ +C+++   +++ S +   F+LT+ ++  I+L K+   PA
Sbjct: 321 NYNATISVQWFRHVIQQLCQMIKPFIEKGSKEEVNFRLTLRKNLTIKLRKMPETPA 376

>AER404C Chr5 complement(1412412..1413572) [1161 bp, 386 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR370C
          Length = 386

 Score =  178 bits (452), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 113/356 (31%), Positives = 191/356 (53%), Gaps = 16/356 (4%)

Query: 9   NRAQLPSVPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSIGLKSPGNKL 68
           N  + P  P  +     + R  SE R + T +++   Y    L D  +  +        +
Sbjct: 26  NMKKFPHGPITRRGKERSIRIFSESREVGTAFRQGLVY---DLDDKKNLPLLNDEICEYI 82

Query: 69  SHDRSCSNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWINKWENDNHTSYSQRSPFV 128
           SH RS S    ++GSDL    E F P++ E L    G  ++I KWE DN  +Y+ RS F 
Sbjct: 83  SH-RSKSKLIGYVGSDLSVESETFHPVTSEELHCLHGLLKFIAKWEADNEVNYASRSKFT 141

Query: 129 VISPRHYLVELTMQLFQQSKYSILCT-HLGDGKIVLSQVENDKKSHQHTSRNT--TMTKK 185
           ++SPRH+++++ M  F   +  ++ T H G   I L+       S + T  N+  + T+K
Sbjct: 142 IVSPRHHILDILMIPFGNERCRLVFTAHRGLFVITLA------PSQRPTGINSPSSATRK 195

Query: 186 ILHSGYALEDLLTRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELTETFTELKCYA 245
           I ++G+ LE LLT     E   F++ IEA+L+ +I+++L+CE+D+YN   + +TE+K   
Sbjct: 196 ICYTGFELERLLTATSGTERGSFYSFIEAKLEPDITILLQCEMDAYNPKRQKYTEIKSSV 255

Query: 246 PLNMHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRNL 305
             N+ N  H  KLLK W Q A+ P  D+L+G R+    +L+ +  ++  ++  K+  R+ 
Sbjct: 256 DFNVRNVRHLSKLLKIWAQTALLPSTDILVGFRDPSTHVLKTVVPYSVDQIAEKLYIRDR 315

Query: 306 PKS-PKRFNYNADLAVQWCQHCIRSICKLVGENVD--RSSPQCFKLTIDESHKIQL 358
            +S P  FN+N ++A  W  + IR IC+ +   VD   SSPQ F + ID++ ++++
Sbjct: 316 TRSHPSYFNFNPEVAKDWTHYAIREICERLSSLVDATSSSPQSFLVEIDKNLQMKI 371

>TBLA0A02800 Chr1 (675150..676511) [1362 bp, 453 aa] {ON} Anc_5.437
           YDR370C
          Length = 453

 Score =  176 bits (446), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 120/410 (29%), Positives = 208/410 (50%), Gaps = 46/410 (11%)

Query: 2   SHSKCSRNRAQLPSVPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSIGL 61
           SHS   + + Q  S+ FN F   S   F     +L+   KE + Y+ G L+ +   +I  
Sbjct: 30  SHSLPGK-KYQGGSIRFNSFVKPSKTHF----SDLYRTSKEVATYHLGNLNINTDPTIE- 83

Query: 62  KSPGNKLSHDRSC-----------SNKRDFLGSDLYQGWEDFLPLSPEILDSSRGCYQWI 110
            + G     D  C             K  ++G+DL++ +E +  +  E L     C+++I
Sbjct: 84  HTKGVPCLKDDICQIAGKSLLDSKKYKAKYIGADLFKDYEKYHAMEKEPLHDPISCFKYI 143

Query: 111 NKWEN---DNHTSYSQRSPFVVISPRHYLVELTMQLFQQ---SKYSILCTHLGDGKIVLS 164
             ++    +    Y     FV+I+ RH++ +L +  F++    + S+L T+LGD +I+LS
Sbjct: 144 QYYDKKHANEKKKYGMDKEFVIITSRHHINDLVLAPFKKISDPEVSVLLTYLGDNRILLS 203

Query: 165 Q-VENDKKSHQHTSRNTTMTKKILHSGYALEDLLTRG-------PRVED----DP----- 207
           Q   ++    +   +     +KI++SG+A EDL+ +        P +E+    DP     
Sbjct: 204 QDYAHEPPDWRENKQFYNSMRKIVNSGFAFEDLVIKDYTSSKLTPSLEEQQKKDPSITNN 263

Query: 208 FFAIIEAELDANISLVLRCELDSYNELTETFTELKCYAPLNMHNAYHREKLLKTWIQLAI 267
           +F+++E ++   ++++LR E+D YN LT ++TELKC+  LNM + +HR+KLLKTW+Q+  
Sbjct: 264 YFSVVENDISPKLTILLRSEMDGYNPLTNSYTELKCFTRLNMGSPFHRQKLLKTWVQIGQ 323

Query: 268 SPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRNLPKSPKRFNYNADLAVQWCQHCI 327
            P  DLL+G R+T  GLL D+ +F+  +L  K +    P+     N     A  W  H +
Sbjct: 324 LPNSDLLVGSRDTQTGLLNDITWFSRDDLVTKCDSYYSPRLRFHQNTTPTNASAWYYHVL 383

Query: 328 RSICKLVGENVDR------SSPQCFKLTIDESHKIQLEKLKHVPAHVELP 371
            +I  L  + + +      S P  F+L ++++  I L  LK VPA V +P
Sbjct: 384 SAITSLTRDYLKKTPKAPSSVPVPFRLIVEKNRTITLLPLKKVPASVPIP 433

>KLLA0E02245g Chr5 complement(210001..211212) [1212 bp, 403 aa] {ON}
           weakly similar to uniprot|Q06349 Saccharomyces
           cerevisiae YDR370C Hypothetical ORF
          Length = 403

 Score =  157 bits (396), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 95/284 (33%), Positives = 160/284 (56%), Gaps = 18/284 (6%)

Query: 77  KRDFLGSDLYQGWEDFLPLSPEILDSS---RGCYQWINKWENDNHTSYSQRSPFVVISPR 133
           K  F+G DL +G++D++PL   +L+S    +  YQ   K  N   T++        +S R
Sbjct: 111 KDSFIGIDLTKGYDDYVPLDRNVLNSLVILKEAYQRYEKTLNPEKTTF--------VSLR 162

Query: 134 HYLVELTMQLFQQSKYSILCTHLGDGKIVLS-QVENDKKSHQHTSRNTTMTKKILHSGYA 192
           H+++++ M  F     S+L T   D  I++S     DK +  H +RN+   KKI ++G+A
Sbjct: 163 HHIIDIIMCPFLDEPLSLLMTVQPDKNILISVDKSKDKPNGIHETRNS-FNKKICYTGFA 221

Query: 193 LEDLL----TRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELTETFTELKCYAPLN 248
           LEDLL    T G  +E + +++I+   L+  I L+++ E+DS N LT+T+TE+K      
Sbjct: 222 LEDLLIESPTEGHILEHELYYSIVHGSLNDEIDLLIQAEMDSINTLTDTYTEIKSSVHFK 281

Query: 249 MHNAYHREKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRNLPKS 308
           + N YHR KLL+ WIQ  + P+ DLLIG RN++   L+ L+ +  +++Y KIN+ ++   
Sbjct: 282 LGNTYHRRKLLRMWIQTNLLPKSDLLIGFRNSYSNELEQLKAYKIQDIYHKINNSSIVGK 341

Query: 309 PKRF-NYNADLAVQWCQHCIRSICKLVGENVDRSSPQCFKLTID 351
           P +F  +N ++A  W QH  + + + +      S+   FK+ ID
Sbjct: 342 PGKFYKFNPNVANDWFQHIFQVLKQNLLLLSQESTSTTFKVQID 385

>KLLA0E12893g Chr5 complement(1140409..1141563) [1155 bp, 384 aa]
           {ON} similar to uniprot|P53063 Saccharomyces cerevisiae
           YGL246C RAI1 Nuclear protein that binds to and
           stabilizes the exoribonuclease Rat1p required for
           pre-rRNA processing
          Length = 384

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 50/243 (20%), Positives = 101/243 (41%), Gaps = 36/243 (14%)

Query: 84  DLYQGWEDFLPLSPEILDSSR--GCYQWINKWENDNHTSYSQRSPFVVISPRHYLVELTM 141
           DL  G + F   + E  DS+   G    + ++E       S+++   +I+ R  + +L  
Sbjct: 58  DLLSGIKKFKECNTEEFDSTTLHGLLSTLEEYERRK----SKKTKVDIITFRGIIRKLIS 113

Query: 142 QLFQQSKYSILCTHLG--DGKIVLSQVENDKKSHQHTSRNTTMTKKILHSGYALEDLLTR 199
             F  S+++ +   +   DG++ + +V+ D           ++  +  +SGY  E L T 
Sbjct: 114 SAFDSSQFNPVNFRIVSFDGQLFIKEVKTDASETSINKNRESLQARAYYSGYKFEALATL 173

Query: 200 G------PRV-----------EDDPFFAIIEAELDANISLVLRCELDSYNELTET----- 237
                  PR              D F +++   +     +++  E+D   +  E      
Sbjct: 174 SLPLPLVPRTTLEKRPKKIINNGDQFISMVRTGI-GKCKILIGAEVDCIFDFKEDSDDNL 232

Query: 238 --FTELKCYAPLNMHNAYHR--EKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTN 293
             + ELKC   +N  +  H+   KL KTW+Q  +     ++ G R+ +  +L+ ++ FT 
Sbjct: 233 KHYAELKCTTMVNTVSDAHKFERKLFKTWLQCFLVGINRIIYGFRDDNF-MLKTVEEFTT 291

Query: 294 KEL 296
            E+
Sbjct: 292 SEV 294

>KLLA0E23013g Chr5 complement(2049719..2050726) [1008 bp, 335 aa]
           {ON} some similarities with uniprot|P53324 Saccharomyces
           cerevisiae YGR263C
          Length = 335

 Score = 36.6 bits (83), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 7/91 (7%)

Query: 191 YALEDLLTRGPRVEDDPFFAIIEAELDANISLVLRCELDSYNELTETFTELKCYAP---- 246
           + L  L T G +++DD    +++  + AN    +      Y ELTETFTE+         
Sbjct: 118 WMLIVLWTVGKKLDDDVAILVLDYPVMANCPETIDYVWKEYLELTETFTEINLIGDSCGG 177

Query: 247 ---LNMHNAYHREKLLKTWIQLAISPRCDLL 274
              LN+    H  K+      +AISP C++L
Sbjct: 178 NLILNILLKCHENKMTIPKRAIAISPWCNVL 208

>KLTH0E09702g Chr5 (874177..876000) [1824 bp, 607 aa] {ON} similar
           to uniprot|Q07471 Saccharomyces cerevisiae YDL080C THI3
           Probable decarboxylase required for expression of
           enzymes involved in thiamine biosynthesis may have a
           role in catabolism of amino acids to long-chain and
           complex alcohols
          Length = 607

 Score = 32.3 bits (72), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 3/44 (6%)

Query: 121 YSQRSPFVVISP---RHYLVELTMQLFQQSKYSILCTHLGDGKI 161
           Y  RSP +V+     RH +V    QL + +++ + CT +G G I
Sbjct: 220 YKCRSPAIVVDACVSRHNVVAEVRQLVELTQFPVFCTPMGKGAI 263

>YLR128W Chr12 (398530..398532,398627..399433) [810 bp, 269 aa] {ON}
            DCN1Scaffold-type E3 ligase required for cullin
           neddylation and ubiquitin ligase activation; contains a
           ubiquitin-binding domain (UBA) for ubiquitin and Nedd8
           (Rub1p) interaction and a PONY domain involved in cullin
           binding and neddylation
          Length = 269

 Score = 31.6 bits (70), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 30/68 (44%), Gaps = 4/68 (5%)

Query: 255 REKLLKTWIQLAISPRCDLLIGVRNTHMGLLQDLQYFTNKELYRKINDRNLPKSPKRFNY 314
           RE  L TW     S   D+   ++   + L +DLQYFT    Y      NL   P R + 
Sbjct: 127 REDFLSTWFMQGCSTISDMQECIKTLDVKLHEDLQYFTQIYNYA----FNLILDPNRKDI 182

Query: 315 NADLAVQW 322
           + D  +Q+
Sbjct: 183 DTDEGIQY 190

>YKL178C Chr11 complement(113215..114627) [1413 bp, 470 aa] {ON}
           STE3Receptor for a factor pheromone, couples to MAP
           kinase cascade to mediate pheromone response;
           transcribed in alpha cells and required for mating by
           alpha cells, ligand bound receptors endocytosed and
           recycled to the plasma membrane; GPCR
          Length = 470

 Score = 30.4 bits (67), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 2/59 (3%)

Query: 4   SKCSRNRAQLPSVPFNQFQHSSAFRFPSEPRNLFTKYKEASYYYGGQLHDSISDSIGLK 62
           S C+ N +     P +Q      +R P +PR   ++ K   Y +  +  D I D I LK
Sbjct: 343 STCTENYSPCVGTPISQAHFYVDYRIPDDPRK--SQNKSKKYLFADKETDDILDEIDLK 399

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.135    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,672,329
Number of extensions: 1988248
Number of successful extensions: 5226
Number of sequences better than 10.0: 35
Number of HSP's gapped: 5305
Number of HSP's successfully gapped: 35
Length of query: 373
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 262
Effective length of database: 40,753,473
Effective search space: 10677409926
Effective search space used: 10677409926
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)