Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F10076g5.436ON48248225650.0
TDEL0E018905.436ON47446712871e-174
SAKL0G02574g5.436ON48446710641e-140
KLTH0F16016g5.436ON4844769411e-122
Kwal_55.214185.436ON4844779281e-120
KLLA0E02223g5.436ON4804648201e-104
AER403C5.436ON4804667641e-95
Ecym_47605.436ON4784676927e-85
Kpol_1062.285.436ON4654695042e-57
TPHA0E017505.436ON4594693966e-42
TBLA0A028105.436ON4814882946e-28
KNAG0H019402.304ON4562761927e-15
Ecym_33422.304ON4951641812e-13
Kwal_27.114562.304ON4962251741e-12
SAKL0E07194g2.304ON4951571732e-12
TBLA0B060602.304ON5032021713e-12
Kpol_1003.512.304ON4782771695e-12
KAFR0H032502.304ON4622541686e-12
KLLA0E08735g2.304ON4922251671e-11
KLTH0G10824g2.304ON4952531599e-11
CAGL0M06853g2.304ON4662231562e-10
YNL026W (SAM50)2.304ON4842641534e-10
NCAS0G038602.304ON4611651517e-10
NCAS0G037502.304ON4611651517e-10
AGR392C2.304ON4951571482e-09
Skud_14.3022.304ON4841581482e-09
Suva_14.3192.304ON4841581463e-09
Smik_14.3042.304ON5001731464e-09
ZYRO0A02310g2.304ON4921741437e-09
TDEL0G023402.304ON4942031411e-08
NDAI0G007102.304ON4911341349e-08
TPHA0G008302.304ON4782061294e-07
NDAI0H034002.316ON110582761.2
CAGL0G02497g5.702ON1780135742.1
NCAS0I003507.8ON565114705.4
Smik_5.2357.380ON143076697.2
NCAS0J013004.222ON43543688.7
Kpol_1069.175.523ON63468689.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F10076g
         (482 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {...   992   0.0  
TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436    500   e-174
SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {...   414   e-140
KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON} cons...   367   e-122
Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026...   362   e-120
KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {...   320   e-104
AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}...   298   1e-95
Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar...   271   7e-85
Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON} (62316....   198   2e-57
TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436    157   6e-42
TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436    117   6e-28
KNAG0H01940 Chr8 (342815..344185) [1371 bp, 456 aa] {ON} Anc_2.3...    79   7e-15
Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar t...    74   2e-13
Kwal_27.11456 s27 complement(809084..810574) [1491 bp, 496 aa] {...    72   1e-12
SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {...    71   2e-12
TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON} Anc_2...    70   3e-12
Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON} (1170...    70   5e-12
KAFR0H03250 Chr8 (621316..622704) [1389 bp, 462 aa] {ON} Anc_2.3...    69   6e-12
KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} simila...    69   1e-11
KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} simila...    66   9e-11
CAGL0M06853g Chr13 (697615..699015) [1401 bp, 466 aa] {ON} simil...    65   2e-10
YNL026W Chr14 (581920..583374) [1455 bp, 484 aa] {ON}  SAM50Esse...    64   4e-10
NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {O...    63   7e-10
NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON}               63   7e-10
AGR392C Chr7 complement(1450059..1451546) [1488 bp, 495 aa] {ON}...    62   2e-09
Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026...    62   2e-09
Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026...    61   3e-09
Smik_14.304 Chr14 (544403..545905) [1503 bp, 500 aa] {ON} YNL026...    61   4e-09
ZYRO0A02310g Chr1 (183977..185455) [1479 bp, 492 aa] {ON} simila...    60   7e-09
TDEL0G02340 Chr7 (451314..452798) [1485 bp, 494 aa] {ON} Anc_2.3...    59   1e-08
NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {O...    56   9e-08
TPHA0G00830 Chr7 (155259..156695) [1437 bp, 478 aa] {ON} Anc_2.3...    54   4e-07
NDAI0H03400 Chr8 complement(821981..825298) [3318 bp, 1105 aa] {...    34   1.2  
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...    33   2.1  
NCAS0I00350 Chr9 complement(48759..50456) [1698 bp, 565 aa] {ON}...    32   5.4  
Smik_5.235 Chr5 complement(351897..356189) [4293 bp, 1430 aa] {O...    31   7.2  
NCAS0J01300 Chr10 (225659..226966) [1308 bp, 435 aa] {ON} Anc_4....    31   8.7  
Kpol_1069.17 s1069 complement(39974..41878) [1905 bp, 634 aa] {O...    31   9.4  

>ZYRO0F10076g Chr6 complement(817036..818484) [1449 bp, 482 aa] {ON}
           similar to gnl|GLV|KLLA0E02222g Kluyveromyces lactis
           KLLA0E02222g and some similarites with YNL026W
           uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 482

 Score =  992 bits (2565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/482 (100%), Positives = 482/482 (100%)

Query: 1   MAEAEAELIHTAHEHINLHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQ 60
           MAEAEAELIHTAHEHINLHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQ
Sbjct: 1   MAEAEAELIHTAHEHINLHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQ 60

Query: 61  SVENSINIFEDIRKKLLFTGLFSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAK 120
           SVENSINIFEDIRKKLLFTGLFSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAK
Sbjct: 61  SVENSINIFEDIRKKLLFTGLFSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAK 120

Query: 121 VLLKRPDYNTISGTTTLSDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDA 180
           VLLKRPDYNTISGTTTLSDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDA
Sbjct: 121 VLLKRPDYNTISGTTTLSDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDA 180

Query: 181 RFSFSLPLVKVPSVRAIVEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISK 240
           RFSFSLPLVKVPSVRAIVEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISK
Sbjct: 181 RFSFSLPLVKVPSVRAIVEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISK 240

Query: 241 SVPLLYTGVSVVRRNLNEFKPTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQ 300
           SVPLLYTGVSVVRRNLNEFKPTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQ
Sbjct: 241 SVPLLYTGVSVVRRNLNEFKPTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQ 300

Query: 301 FQLNNEYVISQSQGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSE 360
           FQLNNEYVISQSQGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSE
Sbjct: 301 FQLNNEYVISQSQGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSE 360

Query: 361 AQTVHPLDRFQLGGLNSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFF 420
           AQTVHPLDRFQLGGLNSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFF
Sbjct: 361 AQTVHPLDRFQLGGLNSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFF 420

Query: 421 NLGNASSDYKTIFNSYAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLT 480
           NLGNASSDYKTIFNSYAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLT
Sbjct: 421 NLGNASSDYKTIFNSYAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLT 480

Query: 481 FF 482
           FF
Sbjct: 481 FF 482

>TDEL0E01890 Chr5 (357689..359113) [1425 bp, 474 aa] {ON} Anc_5.436
          Length = 474

 Score =  500 bits (1287), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 244/467 (52%), Positives = 338/467 (72%), Gaps = 2/467 (0%)

Query: 17  NLHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINIFEDIRKKL 76
           ++  +ETKPLYISKI +DGDN  SPLS S+ +AI  +AL+ P+Q+V +S+  F DIR+KL
Sbjct: 9   DIQGSETKPLYISKISIDGDNSLSPLSGSVYKAILDQALSHPVQNVGSSLYTFGDIRRKL 68

Query: 77  LFTGLFSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKVLLKRPD-YNTISGTT 135
           L TGL+ DV ITL++D D  S    NK+  + YGIE+PL+T A+++LK    YN+ +GTT
Sbjct: 69  LCTGLYQDVRITLEQDHDAKSSEFANKDSPKEYGIESPLATHARIILKPSGVYNSTAGTT 128

Query: 136 TLSDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLPLVKVPSVR 195
           +L DD+ S+A S+++ NLLG+AD+E+  LG  +NP TS+W+GK  + SFSLPL K PSVR
Sbjct: 129 SLVDDSASVAISRSYMNLLGRADSESFHLGLKYNPQTSKWEGKSLKGSFSLPLAKNPSVR 188

Query: 196 AIVEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISKSVPLLYTGVSVVRRN 255
           A +  +G++ +  SK ++A  D+H + QY++  G QKRWI   + SVP  Y G++   R+
Sbjct: 189 ASLNFDGVKVNQRSKSYIAETDDHDEMQYSLSTGLQKRWILEQTNSVPNFYAGITSTNRD 248

Query: 256 LNEFKPTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQSQGS 315
           ++     AS++++ + G F+K S  + F +DTR++ G FP+SG +  +NNEYVISQ++GS
Sbjct: 249 ISGLGAQASKVFSNYSGKFNKVSLESKFHNDTRKYYGTFPVSGYELLVNNEYVISQTKGS 308

Query: 316 SKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQTVHPLDRFQLGGL 375
           S+ L  ++NF+K  F L+HH SHWK+K+T S  LQ GGI P  SE   VHP+D++ LGGL
Sbjct: 309 SQVLPQEDNFSKFDFSLQHHTSHWKNKLTNSLDLQFGGIIPF-SEKTEVHPMDKWYLGGL 367

Query: 376 NSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYKTIFNS 435
           +S+KGF  NGVG GG +FFYK+ L+ S KLINTP  SPLRL +F NLGNA +D  T  NS
Sbjct: 368 DSMKGFQTNGVGFGGNSFFYKVALTASQKLINTPIDSPLRLNFFMNLGNAFNDLNTATNS 427

Query: 436 YAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
           YAAATG+SL YKTPQA +DLTYAHPLTSR QD++KPG S GV+ ++F
Sbjct: 428 YAAATGISLTYKTPQANMDLTYAHPLTSRSQDITKPGFSFGVTFSYF 474

>SAKL0G02574g Chr7 complement(212991..214445) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  414 bits (1064), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 217/467 (46%), Positives = 298/467 (63%), Gaps = 3/467 (0%)

Query: 18  LHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINIFEDIRKKLL 77
           L  + TKPLYI+ + +DGDN  +PLSD+L ++I    L+QPLQ+++N++N F +I+KKL 
Sbjct: 19  LSQSATKPLYITSVSVDGDNQFTPLSDALYKSILDPVLSQPLQNIDNAMNNFSEIKKKLF 78

Query: 78  FTGLFSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKVLLKRPDYNTISGTTTL 137
           FTGLF DV ITLD D    S   L + +S+ YG+E PL T AK+ L    YN +  T+  
Sbjct: 79  FTGLFQDVKITLDNDVSGASFDFLKENVSKEYGVELPLPTVAKIDLIPALYNKLCLTSGT 138

Query: 138 SDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLPLVKVPSVRAI 197
           SD   S+ G  ++ N LG+A+   L+   N+ P + + + K     F LPL K PS++A+
Sbjct: 139 SDMLSSMGGRISFINALGKAETLILQSDINYVPFSGKLNEKSLDGKFLLPLQKNPSIKAV 198

Query: 198 VEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISKSVPLLYTGVSVVRRNLN 257
           ++       L  +PF+A  D+H QQQY+   G QK W+CN + + P+L+ GVS V RNL 
Sbjct: 199 IDVNYAGIDLFKQPFLAAVDQHKQQQYSFNIGVQKNWLCNKTGNAPILFNGVSTVIRNLY 258

Query: 258 EFKPTA--SELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQSQGS 315
            F   A  SE    F G F K+SFV+  T+DTR+F+G FP+SG +F L NEYV++Q+   
Sbjct: 259 GFNDIANVSESIKQFNGSFIKSSFVSQITNDTRKFVGLFPISGSRFNLVNEYVLTQAFSK 318

Query: 316 SKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQTVHPLDRFQLGGL 375
           +K +  +NNF+K     E H S+  ++IT S     G I P GS+A  VH +DRF LGGL
Sbjct: 319 NKTVPQENNFDKACLSYEQHNSYLNNRITSSLDFSCGAIIPTGSKAAIVHTMDRFYLGGL 378

Query: 376 NSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYKTIFNS 435
            SLKGF LN VG+ G NFFY+LG++ S++L N    SPLR Q FFN G+ S + + +  S
Sbjct: 379 KSLKGFELNTVGSSGGNFFYRLGITSSYRLPNATANSPLRFQVFFNAGD-SLNKRELPQS 437

Query: 436 YAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
           +AAATG SLVYKT  A +DLTYA PLT R QD++KPG S GV L+FF
Sbjct: 438 FAAATGFSLVYKTALANMDLTYALPLTEREQDVAKPGFSFGVELSFF 484

>KLTH0F16016g Chr6 (1299984..1301438) [1455 bp, 484 aa] {ON}
           conserved hypothetical protein
          Length = 484

 Score =  367 bits (941), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 197/476 (41%), Positives = 286/476 (60%), Gaps = 3/476 (0%)

Query: 9   IHTAHEHINLHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINI 68
           +    E   +  +  KPLY + I +DGDNGSSPLS+++  ++    L QPLQ+++ S++ 
Sbjct: 10  LQKGSESSVVQRSSLKPLYFTSISVDGDNGSSPLSNTVYNSVLEPVLVQPLQTLDQSLSN 69

Query: 69  FEDIRKKLLFTGLFSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKVLLKRPDY 128
           F +I+KKL++TGLF DV I+LD +  +  L  L K++ + Y +E P+ T A++ L   + 
Sbjct: 70  FAEIKKKLIYTGLFRDVKISLDNEVSSDELQSLPKDLVKGYALEMPIPTIARIRLTPINL 129

Query: 129 NTISGTTTLSDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLPL 188
           N  S T+   D   S+ G  +  N  G+A+   L+    + P  S +D K       +PL
Sbjct: 130 NRASLTSFTGDTLSSMGGRYSVINNFGKAEVLTLQGKLAYQPFQSTFDEKVLEAKLLIPL 189

Query: 189 VKVPSVRAIVEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISKSVPLLYTG 248
            K PSV+A+ +A      L  +PF+   D+H Q+Q +V  G QK+W+   +   P+LY G
Sbjct: 190 QKNPSVKAVFDANYANIDLNGQPFIEKRDQHRQKQVSVNVGVQKQWVNIKTGLAPVLYNG 249

Query: 249 VSVVRRNLNEFKPTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYV 308
            SVV RNL+E +  ASE    F  PF K SFV+    D R+F G FP SG +F +NNEYV
Sbjct: 250 FSVVARNLDEVRKEASEAIRQFDAPFVKNSFVSQLLVDNRKFFGLFPASGLKFSINNEYV 309

Query: 309 ISQS--QGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQTVHP 366
           +S+S  + +   ++ +  F+K A   E H + + +KI  S +L  GGI+  G  +  VH 
Sbjct: 310 LSESFDKKAGTAVSQNEGFDKLAVDFEAHRAFFGNKIINSLELACGGIFSAGKSSSLVHH 369

Query: 367 LDRFQLGGLNSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNAS 426
           +D+F LGG++SLKGF  N VG  G   FYKLGL+ S KL NTP  SPLRLQ+FFN G+  
Sbjct: 370 IDKFYLGGMSSLKGFERNSVGQHGGKLFYKLGLASSFKLPNTPANSPLRLQFFFNAGDVQ 429

Query: 427 SDYKTIFNSYAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
           +   T F S AA++G+SL+YK+  A +DLTYA PLT+R QD+ KPG S GVSL+ +
Sbjct: 430 NKKPTQF-SCAASSGVSLLYKSSLANMDLTYAFPLTNRGQDIQKPGFSFGVSLSLY 484

>Kwal_55.21418 s55 (828257..829711) [1455 bp, 484 aa] {ON} YNL026W -
           Essential protein with similarity to S. pombe
           hypothetical protein E241976 [contig 130] FULL
          Length = 484

 Score =  362 bits (928), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 200/477 (41%), Positives = 285/477 (59%), Gaps = 4/477 (0%)

Query: 8   LIHTAHEHINLHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSIN 67
           L   A EH+ L  +  KPLY + I +DG+    PLSD+   ++    L+QPLQ++E S+ 
Sbjct: 10  LQQEAEEHL-LQKSSLKPLYFTSISVDGEKKLRPLSDATYNSVLEPVLSQPLQTLEQSLA 68

Query: 68  IFEDIRKKLLFTGLFSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKVLLKRPD 127
            F +I+KKL++TG+FSDV I+LDKD     L  L+++  +   +E+P+ T A++LLK  +
Sbjct: 69  NFTEIKKKLIYTGMFSDVKISLDKDTSGNGLKDLHQDAIKELSLESPVPTIARILLKPLE 128

Query: 128 YNTISGTTTLSDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLP 187
           +N +  T++ +D   SL    ++ N LG+A+   L+    + P  +    K       +P
Sbjct: 129 FNKLCFTSSTNDTVPSLGARYSFVNALGKAEIVTLQSEVKYIPFKNTALEKTLDAKVVVP 188

Query: 188 LVKVPSVRAIVEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISKSVPLLYT 247
           L K PSV+A+ +       L  +PFV  +D+H Q+Q +V  G QK+W+ +     P+ Y 
Sbjct: 189 LQKNPSVKAVFDTNYANIDLHGQPFVEKKDQHRQRQVSVNVGVQKQWLTSKMNLSPVFYN 248

Query: 248 GVSVVRRNLNEFKPTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEY 307
           G SVV RNL++    AS     F  PF K SFV+    D R+F G FP SG +  LNNEY
Sbjct: 249 GFSVVARNLHDVPNEASGAIRQFNAPFLKNSFVSQLVIDNRKFFGLFPASGVKIALNNEY 308

Query: 308 VISQ--SQGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQTVH 365
           V+SQ   + S   +  D  FNK A  LE   S +K+KI  S  +  GGI P G+ A  VH
Sbjct: 309 VLSQRFEKDSGNDMALDEGFNKCALSLEAQRSFFKNKIINSLDIACGGILPTGNSASLVH 368

Query: 366 PLDRFQLGGLNSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNA 425
            +D+F LGGL SLKGF  N VG  G NFFYKL ++ S KL  TP +SPLRLQ+F N G  
Sbjct: 369 HMDKFYLGGLASLKGFERNAVGQHGGNFFYKLHVASSFKLPRTPQQSPLRLQFFLNAGEV 428

Query: 426 SSDYKTIFNSYAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
           S++  T   S AA++G+SL+YK+P A +DLTYA PL++R QD++KPG S GVSL+ +
Sbjct: 429 SNEKPTSV-SCAASSGISLLYKSPLANMDLTYALPLSNRAQDVAKPGFSFGVSLSLY 484

>KLLA0E02223g Chr5 complement(208267..209709) [1443 bp, 480 aa] {ON}
           conserved hypothetical protein
          Length = 480

 Score =  320 bits (820), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/464 (40%), Positives = 266/464 (57%), Gaps = 5/464 (1%)

Query: 24  KPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINIFEDIRKKLLFTGLFS 83
           K +Y +K+ +DGDN  SP+SD L ++IF   L  PLQ V+++    EDI+KKLLFTGLF 
Sbjct: 17  KTVYFTKVTVDGDNQLSPVSDDLYQSIFNRILADPLQKVDSAFKSCEDIQKKLLFTGLFQ 76

Query: 84  DVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKVLLKRPDYNTISGTTTLSDDNIS 143
              ITLD D D  S   L + + ++  IE P+ T A+V L    YN  S +TT  D   S
Sbjct: 77  SAEITLDHDVDVRSSRLLTENVPKTLDIELPIPTIAQVKLVPAVYNKGSLSTTTRDTYSS 136

Query: 144 LAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLPLVKVPSVRAIVEAEGI 203
                 W N  G A+  +L+   N+ P   + D +      +LP  K PSV+A V A   
Sbjct: 137 AGARLFWINKFGNAETISLQGDVNYTPFNGKLDERLLGAKLALPFPKNPSVKAAVYANHT 196

Query: 204 QRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISKSVPLLYTGVSVVRRNLNEFKP-- 261
              L  +PF+   DEH Q Q+ + AG +K ++ N +KSV   + G+++V RN+  F    
Sbjct: 197 YLDLFKQPFIGESDEHKQSQFGLSAGIEKNFLYNNNKSVIETFNGMTMVARNIYGFADAL 256

Query: 262 TASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQSQGSSKQLNH 321
             S+    F+G F K+SF++    D+R F   FP+SG + QL +EY++SQ   +SK L H
Sbjct: 257 AVSDSIKQFQGTFTKSSFISELKSDSREFYNRFPVSGKRVQLFHEYILSQGFTNSKPLPH 316

Query: 322 DNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQ-TVHPLDRFQLGGLNSLKG 380
           ++NF+K +   E H   +  K+  S  L  G I+P  ++++  VH LD F LGG  SLKG
Sbjct: 317 ESNFDKLSVSYETHRPFFNTKLVTSLHLDAGAIFPWKNKSKPLVHLLDSFYLGGPKSLKG 376

Query: 381 FHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYK--TIFNSYAA 438
           F  N VG  G  +FYKLG+S S KL NTP  SPLRLQ F N G+  ++++   +    A 
Sbjct: 377 FERNCVGNRGGLYFYKLGISSSFKLPNTPIDSPLRLQSFINFGDVLNNWRDANLERKPAL 436

Query: 439 ATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
           +TG+SL+Y    A LDL+Y+ PL  R  D++KPGL+ G+ L+FF
Sbjct: 437 STGISLIYSASFANLDLSYSLPLRVRDYDIAKPGLTFGLDLSFF 480

>AER403C Chr5 complement(1410760..1412202) [1443 bp, 480 aa] {ON}
           NOHBY530; No homolog in Saccharomyces cerevisiae'
          Length = 480

 Score =  298 bits (764), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 180/466 (38%), Positives = 256/466 (54%), Gaps = 7/466 (1%)

Query: 18  LHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINIFEDIRKKLL 77
           L  ++TKPLYI+ + ++ D    PLSD + ++I    L +PLQS+ +++   E I K L+
Sbjct: 19  LGKSQTKPLYITSVQVE-DGKDYPLSDGVLKSILSPVLAKPLQSLSSTLASLETIEKNLM 77

Query: 78  FTGLFSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKVLLKRPDYNTISGTTTL 137
           +TGL+ D++ITLD D        L+    + Y IE PL  +A V +    Y  +S  TT 
Sbjct: 78  YTGLYQDISITLDHDKSRLVNQFLSNIAPKEYDIELPLPVKALVKVLPAPYQRLSLVTTT 137

Query: 138 SDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLPLVKVPSVRAI 197
            D   S  G     N  G A+  +L+   N+ P + + D K       +P    PS++A+
Sbjct: 138 RDSYASAGGRLASVNKFGLAEVFSLQADVNYTPFSGKLDDKLVDLRCLVPFQNNPSIKAV 197

Query: 198 VEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISKSVPLLYTGVSVVRRNLN 257
            +       L ++P++  +D+H Q+Q     G QK+W+     S P  + GVS+V RNL+
Sbjct: 198 FDVNYAMLDLYNQPWINEDDQHKQRQIGFNIGIQKQWLSKRLYS-PTAFAGVSIVGRNLH 256

Query: 258 EFK-PTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQSQGSS 316
             +   AS   + +     KTSFVT F H  R+ IG FP+ G +F   NE V+SQ+   +
Sbjct: 257 GIQLDRASYHVSAWADSSLKTSFVTQFLHSNRKLIGTFPVQGMKFNAVNELVLSQTVAGT 316

Query: 317 KQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQ-TVHPLDRFQLGGL 375
            Q   +  FNK     E H S  ++ +T S  L  G +      A+  VH +D+F LGGL
Sbjct: 317 PQ---EETFNKFLVTYEKHVSFLRNLVTTSLDLSCGSLISTKQAAKPMVHIMDQFYLGGL 373

Query: 376 NSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYKTIFNS 435
           +SLKGFH N VG+ G + FY+L L  S  L  TP  SPLRLQ FFN G+     + I   
Sbjct: 374 SSLKGFHRNSVGSRGGDLFYRLSLKSSVHLPGTPLDSPLRLQAFFNAGDVFHFRRQIPED 433

Query: 436 YAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTF 481
            AAATGLSLVY++P A LDLTYA PLTSRP DL+KPG S GV++ +
Sbjct: 434 VAAATGLSLVYESPIANLDLTYALPLTSRPVDLAKPGFSFGVAIAY 479

>Ecym_4760 Chr4 (1477953..1479389) [1437 bp, 478 aa] {ON} similar to
           Ashbya gossypii AER403C
          Length = 478

 Score =  271 bits (692), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 168/467 (35%), Positives = 254/467 (54%), Gaps = 7/467 (1%)

Query: 18  LHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINIFEDIRKKLL 77
           L   +TKPL+I+ + ++ D   SPLS+S+  +I    L+QP Q++ ++++    I KKL+
Sbjct: 17  LAKVQTKPLFITSVYVN-DVKLSPLSNSIFESILKPVLSQPFQNLRSTLSALGTIEKKLM 75

Query: 78  FTGLFSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKVLLKRPDYNTISGTTTL 137
           +TGL+ DVNITLD+D        L +   + YG+E P+  +A++ L    Y  +S  TT 
Sbjct: 76  YTGLYDDVNITLDQDKSQYISDYLEEVAPKEYGLELPVPIKAQIQLVPAFYQPLSLVTTT 135

Query: 138 SDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLPLVKVPSVRAI 197
            D   +     +  N   QA+   L+   N  P + + D K       +PL K+PS++A+
Sbjct: 136 RDSYAAAGIHLSSLNKFQQAETIILQGELNCTPFSGKIDEKLLSLKCLVPLQKLPSMKAV 195

Query: 198 VEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISKSVPLLYTGVSVVRRNLN 257
            +       L  + ++   D+H Q Q     G Q++ I +     P++Y+G+S++ RNL 
Sbjct: 196 FDINYALVDLFKQSWLPESDQHKQNQIGFNIGIQEQQISSSKFRGPIIYSGISILGRNLL 255

Query: 258 EFKPTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQSQGSSK 317
           + K T             K S+V     + ++F+G  P+SG +F L NE V+ Q+    K
Sbjct: 256 DLKKTEVSSSINSWVESSKVSYVFQILQNNKKFLGTLPISGWKFNLFNEAVLGQTVAGEK 315

Query: 318 QLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGI--YPLGSEAQTVHPLDRFQLGGL 375
           Q   ++ F K AF  E ++S  ++ I  S  L  G I  Y  GSE + VH +D+F LGGL
Sbjct: 316 Q---ESGFGKVAFSYEGYSSFLRNHIITSLDLSFGTIFRYKSGSELK-VHIMDQFYLGGL 371

Query: 376 NSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYKTIFNS 435
           +SLKGF  N VGT G N FYK+    S  +  TP  SPLRLQ F N G+  +  + I   
Sbjct: 372 SSLKGFQRNSVGTRGGNSFYKVAFKSSFHIPGTPLASPLRLQAFVNAGDVFNSERGIPED 431

Query: 436 YAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
            A ATG+SLVY++  A LDLTYA PL+ R QD++KPG S GVS+ + 
Sbjct: 432 LATATGISLVYQSHLASLDLTYALPLSLRAQDVAKPGFSFGVSIAYM 478

>Kpol_1062.28 s1062 (62316..63713) [1398 bp, 465 aa] {ON}
           (62316..63713) [1398 nt, 466 aa]
          Length = 465

 Score =  198 bits (504), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 139/469 (29%), Positives = 237/469 (50%), Gaps = 24/469 (5%)

Query: 17  NLHDNETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINIFEDIRKKL 76
           N+  + TKPLYIS++ ++ D+   PLS S  + +    ++ P+Q+V+ ++  F DI++ L
Sbjct: 16  NISSSRTKPLYISQVSVENDSSDHPLSSSFLQNVLENVVSNPIQNVDTALGSFIDIKRNL 75

Query: 77  LFTGLFSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKVLLKRPDYNT-ISGTT 135
           LFTGL++DV++TL  D   + L+   K +++  GIE+ + T A + LK  D  T +  T 
Sbjct: 76  LFTGLYNDVDVTLGADKGGSLLNLSLKMVTDKIGIESIVPTSATIRLKPNDLVTNLQTTF 135

Query: 136 TLSDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLPLVKVPSVR 195
           T + ++ S+   K W N LG AD E +  G  +N  ++ W  K  +  F LP  KVPS+R
Sbjct: 136 TTTSNDCSVNFHKLWPNFLGIADREAIDFGAKYNLQSTSWIQKYFKGEFILPFTKVPSLR 195

Query: 196 AIVEAEGIQRSLCSKPFVAPEDE--HVQQ-QYAVGAGFQKRWICNISKSVPLLYTGVSVV 252
            ++  +              ED+  H+Q+      AG QK W+ +   + P+ Y+G+S+V
Sbjct: 196 TVLSVD------------VSEDKVSHLQRLNCNYKAGIQKLWLKDDLNTFPVFYSGLSIV 243

Query: 253 RRNLNEFKPTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQS 312
                       ++ +P + P  ++ ++T+F+ D+ +++G+FP SG    L NEYV+SQ 
Sbjct: 244 NNKPIFNGEIPIDVPSPEQTPSYQSGWLTTFSKDSTKWLGSFPNSGECLNLKNEYVLSQL 303

Query: 313 QGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQTVHPLDRFQL 372
              +K +N   N N+   + E + S    ++  +  + GG  +P+    ++    + +  
Sbjct: 304 DSDNKPIN--TNINRFEANFEKYVSILNSRVITTVLMNGGFQFPIDESTRSTFVGESWD- 360

Query: 373 GGLNSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYKTI 432
              NSL    +  +     +  +K G   S KL NT   SPLRLQ      N        
Sbjct: 361 -KRNSL----IKDIILNKSDMNFKCGFISSFKLPNTELDSPLRLQISALTENKFKGLANY 415

Query: 433 FNSYAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTF 481
           F+  AA TG+SLVYKT    + L+Y  PL       +  G S  +++T+
Sbjct: 416 FDGCAADTGVSLVYKTKDTNMALSYKVPLMQSSNSPATSGFSFDIAITY 464

>TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436
          Length = 459

 Score =  157 bits (396), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 123/469 (26%), Positives = 222/469 (47%), Gaps = 29/469 (6%)

Query: 22  ETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINIFEDIRKKLLFTGL 81
           +TKP+Y++++++        LSD+    I  + ++ P++SV++   IF++IR  L+ +GL
Sbjct: 10  DTKPIYVTQVLVKNGGPGVVLSDTFYENILYDVISNPVKSVQDVNLIFQNIRNNLILSGL 69

Query: 82  FSDVNITLDKDPDTTSLSQLNKEISESYGIETPLSTQAKV----LLKRPDYNTISGTTTL 137
           + +V++ LD D   + L+   K  +E  GIE+ +   A +    L   P  N ++  T+ 
Sbjct: 70  YKNVDVKLDLDERASLLNHSLKLSTEQIGIESVVPISATLNMTPLYLTPYKNYVTFNTSN 129

Query: 138 SDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFSFSLPLVKVPSVRAI 197
           + +++SL  ++ W NL G +D   ++L  + N   S+ D K     F++PL++  S+R I
Sbjct: 130 TQNSVSL--NRDWINLFGTSDTGTIKLSADLNQTKSEIDKKSIDAKFTMPLLRNSSIRTI 187

Query: 198 VEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQKRWICNISKSVPLLYTGVSVVRRNLN 257
           +E++      CS   +A       +Q+ +  G  K  +    KS+P+ Y+G+++ R+   
Sbjct: 188 LESK------CS---IAKPRNDTMKQFELNIGLTKLKLIGGIKSLPIFYSGLNIQRKQTT 238

Query: 258 EFKPTASELYAPFKG-----PFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQS 312
               +  E      G       +  S  + +  D+R +   FP  G  F+L +++V++++
Sbjct: 239 LGPLSDEESETEIIGNISDEVINSLSLKSEYITDSRFYTSKFPSGGHLFKLVHQHVLNET 298

Query: 313 QGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQTVHPLDRFQL 372
              S ++    N +      E H S   D+IT SF   G    PL S    ++    F  
Sbjct: 299 NSISNEIKK--NISNINMSFEKHISTLNDQITSSFIFDGHVGVPLQSTFANLNS-GEFWD 355

Query: 373 GGLNSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQYFFNLGNASSDYKTI 432
                 K    N +        +K+GL  S ++ N P  SP+R Q      N S      
Sbjct: 356 NEKEIFKTLCQNDIKVS-----HKVGLVSSFRVPNIPITSPIRFQLSVLGINKSKRMAEY 410

Query: 433 FNSYAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTF 481
             +Y+A TG+SLVYK   + + L+Y  PL     D    GLS  V++T+
Sbjct: 411 LKNYSADTGVSLVYKGDHSQMKLSYQIPLI-HGNDNKHSGLSFDVAVTY 458

>TBLA0A02810 Chr1 (676946..678391) [1446 bp, 481 aa] {ON} Anc_5.436
          Length = 481

 Score =  117 bits (294), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 131/488 (26%), Positives = 224/488 (45%), Gaps = 51/488 (10%)

Query: 21  NETKPLYISKIVLDGDNGSSPLSDSLCRAIFGEALNQPLQSVENSINIFEDIRKKLLFTG 80
           N TKPLYISK+ +   N    +SDS  +++    L+ PLQ+++ ++  FE+I  KL  T 
Sbjct: 19  NSTKPLYISKVTITSSNEDLFVSDSFLKSLLNPVLSTPLQNLKTTLQTFENIEDKLYQTD 78

Query: 81  LFSDVNITLDKDPDTTS-LSQLNKEIS-ESYGIETPLSTQAKVLLK------RPDYNTIS 132
           LF DV I+LD +  T+S +  L  +IS     +++P+   A + +K       P+Y    
Sbjct: 79  LFEDVKISLDTNQATSSKIKTLFDDISVYDIKVDSPIPITANIFIKPNKPLVDPNY---- 134

Query: 133 GTTTLSDDNISLAGSKTWKNLLGQADAENLRLGFNWNPVTSQWDGKDARFS--FSLPLVK 190
            T T+S++    + SK W N L +AD   +     ++  +++W  K+ +F    + PLV 
Sbjct: 135 -TWTISNNKSIFSWSKNWINSLNRADQHYINASATYDLDSTKW--KNFKFDGLSTYPLVP 191

Query: 191 VPSVRAIVEAEGIQRSLCSKPFVAPEDEHVQQQYAVGAGFQK--RWICNISKSVPLLYTG 248
             SV+++    GI      KP    +D     QY V +GF+K  R+   +      LYTG
Sbjct: 192 FTSVKSV---SGIS---LFKPLQQSKD---YIQYLVESGFRKDMRFPEEVGVKSSNLYTG 242

Query: 249 VSV---VRRNLNEFKPTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQLNN 305
           +++   ++   N      ++        + KTS ++ F+ D+R F+   P  G  F +  
Sbjct: 243 LAINGAIKDEGNNNCLVLNKTILENMQIYKKTSILSKFSTDSRIFVKGIPRYGSYFNIYY 302

Query: 306 EYV---ISQSQGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQ-GGGIYP---LG 358
           EYV   ++ S+  S +L H +N ++   + E + + ++D I  S  ++ G  I P   + 
Sbjct: 303 EYVLNGLNDSKKLSPELLHLSNVSRFGINFEKYFTLFQDAILCSLLVRTGTSIKPSINMF 362

Query: 359 SEAQTVHPLDRFQLGGLNSLKGFHLN-GVGTGGQNFFYKLGLSISHKLINTPTKSPLRLQ 417
           +        + F +      +    N G+       FY + L+ S  L +    SPLR Q
Sbjct: 363 NWETKRREANEFPVPSYLEERPHEKNDGIA------FYNVCLNASVPLFSKCKFSPLRFQ 416

Query: 418 YFFNLG--NASSDYKTIFNSYAAATG-LSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLS 474
               L   N    +K         TG L LVYK+  A  D+ Y  P+       +K G +
Sbjct: 417 NSIQLERYNNCCPHK---QRKPDITGTLGLVYKSESAYFDIGYTLPIGKIAGHDTKAGFA 473

Query: 475 LGVSLTFF 482
           +  S++F 
Sbjct: 474 MNASISFL 481

>KNAG0H01940 Chr8 (342815..344185) [1371 bp, 456 aa] {ON} Anc_2.304
           YNL026W
          Length = 456

 Score = 78.6 bits (192), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 80/276 (28%), Positives = 121/276 (43%), Gaps = 30/276 (10%)

Query: 226 VGAGFQKRWICNISKSVPLLYTGVSVVRRNL--NEFKPTA-SELYAPFKGPFDKTSFVTS 282
           VGA F  R   N  K   + +    +VRR     + K T  SE     +G F ++    +
Sbjct: 192 VGASFGVRSWYNDPKKWNMSF-DYELVRRKFLGTDTKETKLSEYLLIQEGSFVRSVIKNN 250

Query: 283 FTHDTRRFIGNFPLSGCQFQLNNEYVISQSQGSSKQLNHDNNFNKTAFHLEHHASHW-KD 341
           FT D R    N P  G  +++NNE + +   GSS        F KT   L H  S + +D
Sbjct: 251 FTKDNRDSPFN-PTKGTMYKINNE-LGAMDNGSS--------FWKTVLELNHVKSWFPRD 300

Query: 342 KITRSFQLQGGGIYPLGSEAQTVHPLDRFQLGGLNSLKGFHLNGVG------TGGQNFFY 395
            IT S  L+ G I  L      +H  D+FQ GG N ++ F LNG+G      + G + F 
Sbjct: 301 FITLSTTLRSGYIKNLNPAKSYIHFTDKFQNGGPNDVRNFQLNGIGPRHMHHSMGGDAFI 360

Query: 396 KLGLSISHKL-INTPTKSPLRLQYFFNLGN--------ASSDYKTIFNSYAAATGLSLVY 446
             G+S+  K+ +     S  RL ++FN G           +  + +   ++ + G  +V 
Sbjct: 361 AYGVSLFSKIPLKRFQDSNFRLHWYFNGGKLINHNNLPIHTLLRELTLEHSTSIGAGIVM 420

Query: 447 KTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
           + P A  +L +  PLTS   DL + G   G+   F 
Sbjct: 421 RHPMARFELNFGVPLTSHVGDLQRKGFQFGLGFEFL 456

>Ecym_3342 Chr3 (649920..651407) [1488 bp, 495 aa] {ON} similar to
           Ashbya gossypii AGR392C
          Length = 495

 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 83/164 (50%), Gaps = 17/164 (10%)

Query: 336 ASHWKDK--ITRSFQLQGGGIYPLGSEAQTVHPLDRFQLGGLNSLKGFHLNGVG------ 387
           A  W DK  IT S  ++GG I  L S+ + +H  D+F  GG N ++GF   G+G      
Sbjct: 332 AKSWLDKDFITMSTTIKGGYIANLNSDNKFIHMKDKFHSGGSNDVRGFQQMGLGPRDIYD 391

Query: 388 TGGQNFFYKLGLSISHKL-INTPTKSPLRLQYFFNLG----NASSDYKTIFN----SYAA 438
           + G + F   G+S+  +L +N  + S  RL +F N G    + +SD   + +     ++ 
Sbjct: 392 SIGGDTFVAYGISVFSRLPVNKWSNSGFRLHWFLNGGRLINHNNSDLSGVLDQLCMEHSI 451

Query: 439 ATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
           ATG+ +++K P A  +L +  PL +   D  + G   G+ L+F 
Sbjct: 452 ATGIGILFKHPVARFELNFTLPLAAHSSDSVRKGFQYGIGLSFL 495

>Kwal_27.11456 s27 complement(809084..810574) [1491 bp, 496 aa] {ON}
           YNL026W - 1:1 [contig 27] FULL
          Length = 496

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 67/225 (29%), Positives = 105/225 (46%), Gaps = 34/225 (15%)

Query: 276 KTSFVTSFTHDTR-RFIGNFPLSGCQFQLNNEYVISQSQGSSKQLNHDNNFNKTAFHLEH 334
           K S   S   DTR + I  FPL+G   +++NE  +             N F K++F   +
Sbjct: 288 KNSLCHSIFWDTRDKPI--FPLAGSFLKISNEIAL-------------NKFWKSSFEFSN 332

Query: 335 HASHW--KDKITRSFQLQGGGIYPLGSEAQTVHPLDRFQLGGLNSLKGFHLNGVG----- 387
             S W   D  T S  ++GG I     + + +H  D+F  GG N ++ F L G+G     
Sbjct: 333 VRS-WCNNDFFTASGTVKGGYINNFHPQTKPLHVSDKFHNGGSNDVRSFQLMGLGPKDLY 391

Query: 388 -TGGQNFFYKLGLSISHKL-INTPTKSPLRLQYFFN---LGNAS-----SDYKTIFNSYA 437
            + G + F   G+SI  +L I   ++S  RL  FFN   L N +     S   T+ + ++
Sbjct: 392 DSMGGDAFVSYGVSIFSRLPIKRWSESNFRLHAFFNGARLINTNGTPFKSSLSTLASEHS 451

Query: 438 AATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
            +TG+ LV+  P A  +L +  PLT+   D  + G   G+ L+F 
Sbjct: 452 TSTGVGLVFGHPVARFELNFCVPLTAHSSDSIRKGFQYGIGLSFL 496

>SAKL0E07194g Chr5 complement(590515..592002) [1488 bp, 495 aa] {ON}
           similar to uniprot|P53969 Saccharomyces cerevisiae
           YNL026W SAM50 Essential component of the Sorting and
           Assembly Machinery (SAM complex) of the mitochondrial
           outer membrane the authentic non-tagged protein was
           localized to the mitochondria
          Length = 495

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 79/157 (50%), Gaps = 15/157 (9%)

Query: 341 DKITRSFQLQGGGIYPLGSEAQTVHPLDRFQLGGLNSLKGFHLNGVG------TGGQNFF 394
           D IT +  L+GG I     ++Q +H  D+F  GG N ++GF   G+G      + G + F
Sbjct: 339 DFITMTGTLKGGYISNFHPKSQPLHMGDKFHNGGSNDVRGFQAMGLGPKDLYDSMGGDAF 398

Query: 395 YKLGLSISHKL-INTPTKSPLRLQYFFNLG--------NASSDYKTIFNSYAAATGLSLV 445
              G+S+  +L +    +S  RL +F N G        N SS  K++   ++ +TG+ LV
Sbjct: 399 VAYGVSLFSRLPVRRWYESNFRLHWFVNGGRLINHNNTNLSSCIKSLAQEHSTSTGVGLV 458

Query: 446 YKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
           +K P A  +L +  P+++   D  + G   G+ LTF 
Sbjct: 459 FKHPVARFELNFTVPISAHSSDSVRKGFQYGIGLTFL 495

>TBLA0B06060 Chr2 (1427723..1429234) [1512 bp, 503 aa] {ON}
           Anc_2.304 YNL026W
          Length = 503

 Score = 70.5 bits (171), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/202 (25%), Positives = 101/202 (50%), Gaps = 20/202 (9%)

Query: 299 CQFQLNNEYVISQSQGSSKQLNHD---NNFNKTAFHLEHHASHWKDK-ITRSFQLQGGGI 354
           C F   +  ++S S+G+  +L ++   + F KT   +  + S ++D  IT +   + G I
Sbjct: 302 CTFDSRDHPIVS-SRGTLIKLGNEFAPDRFFKTNLEIVKNKSFFRDDFITMACTFKTGYI 360

Query: 355 YPLGSEAQTVHPLDRFQLGGLNSLKGFHLNGVG------TGGQNFFYKLGLSISHKL-IN 407
           +     ++ +H  D+FQ GG N ++GF   G+G      + G + F   G S+ +K+ I 
Sbjct: 361 HNFFPNSKAIHRNDKFQNGGANDIRGFQFMGLGPKDRFDSVGGDAFISYGFSVMNKIPIW 420

Query: 408 TPTKSPLRLQYFFNLGN-ASSDYKTIFNSY-------AAATGLSLVYKTPQALLDLTYAH 459
               S  R  +F N G   +S+ K + N++       + + G+ +V++ P A  +L +A 
Sbjct: 421 KFYDSNFRFHWFVNGGKLINSNGKGLLNTFNDLSKQNSMSVGMGIVFRHPMARFELNFAI 480

Query: 460 PLTSRPQDLSKPGLSLGVSLTF 481
           P+ +   D+++ G   G+ L+F
Sbjct: 481 PVVTHSGDITRKGFQYGIGLSF 502

>Kpol_1003.51 s1003 (117089..118525) [1437 bp, 478 aa] {ON}
           (117089..118525) [1437 nt, 479 aa]
          Length = 478

 Score = 69.7 bits (169), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 70/277 (25%), Positives = 120/277 (43%), Gaps = 42/277 (15%)

Query: 238 ISKSVPLLYTGV-SVVRRNLNEFKPTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNFPL 296
           +  S+ ++ TG+ S VR N ++F+    E Y   +G   KT    S   D+  F      
Sbjct: 212 LGTSIDMIVTGLRSSVRGNFDDFEKLKQEFY--LEGILRKTKLTASNCSDSLLF-----Q 264

Query: 297 SGCQFQLNNEYVISQ---------SQGSSKQLNHD---NNFNKTAFHLEHHASHWKDKIT 344
           +G   +L   + IS          ++G+  +++++   N + K+        S ++D   
Sbjct: 265 AGSDAKLTIGHSISWDTRDVPVTPNKGNLLKISNELALNQYFKSQMEFSSSKSWYQDNF- 323

Query: 345 RSFQLQG----GGIYPLGSEAQTVHPLDRFQLGGLNSLKGFHLNGVGTG------GQNFF 394
             F L G    G I  +    + +H  D+F LGG N ++GF L G+G        G + F
Sbjct: 324 --FTLMGTYKFGWITKIDDNDKPLHISDKFHLGGSNDVRGFQLMGLGPKQINDAIGGDMF 381

Query: 395 YKLGLSISHKL-INTPTKSPLRLQYFFNLGNA--------SSDYKTIFNSYAAATGLSLV 445
              G+S+  KL     + S  RL  FFN G            + +++F   + A G  ++
Sbjct: 382 SAYGISLFSKLPFKKFSDSNFRLHAFFNGGKLVNQNTNTFDRNLQSLFKENSLAIGTGII 441

Query: 446 YKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
           +K P A  +L +  PLTS   D  + G   G+ ++F 
Sbjct: 442 FKHPVARFELNFTLPLTSYSTDHVRKGFQYGIGMSFL 478

>KAFR0H03250 Chr8 (621316..622704) [1389 bp, 462 aa] {ON} Anc_2.304
           YNL026W
          Length = 462

 Score = 69.3 bits (168), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 115/254 (45%), Gaps = 31/254 (12%)

Query: 248 GVSVVRRNLNEFKPTASELYAPF----KGPFDKTSFVTSFTHDTRRFIGNFPLSGCQFQL 303
           G+ +V+RN N  K  +S++ + +    +G F KT+  ++   D R      P  G  F++
Sbjct: 221 GLEMVKRNFNH-KLNSSKVVSDYLLIQEGEFYKTTLRSTMVWDGRNG-KTAPTKGRLFKI 278

Query: 304 NNEYVISQSQGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQT 363
           NN+  +     + +   H   FN     L+       D IT S  ++ G I  L  +   
Sbjct: 279 NND--LGFGTNNLQFWRHVTEFNLVKSWLK------DDFITMSNTIKFGYIKNLSQDY-- 328

Query: 364 VHPLDRFQLGGLNSLKGFHLNGVG------TGGQNFFYKLGLSISHKL-INTPTKSPLRL 416
           +H  D+FQ GG N ++ F   G+G      + G + F   G+SI  KL I     S  RL
Sbjct: 329 IHFTDKFQNGGPNDIRSFQSMGIGPRHNSYSLGGDAFLSYGVSIFSKLPIQKFHDSNFRL 388

Query: 417 QYFFNLGN-ASSDYKTIFNSY-------AAATGLSLVYKTPQALLDLTYAHPLTSRPQDL 468
            +FFN G   + D  +I+N         + + G+ +V + P A  ++ +A P+T    DL
Sbjct: 389 HWFFNGGKLINHDNASIWNCMQNLTIENSTSAGVGVVLRHPMARFEMNFAVPITDHQDDL 448

Query: 469 SKPGLSLGVSLTFF 482
           ++ G   G+   F 
Sbjct: 449 TRKGFQFGLGFEFL 462

>KLLA0E08735g Chr5 (779165..780643) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 68.9 bits (167), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/225 (28%), Positives = 102/225 (45%), Gaps = 36/225 (16%)

Query: 276 KTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQSQGSSKQLNHDNNFNKTAFHLEHH 335
           K S V S T DTR  I   P SG  ++  NE     S G   + N + NF K+ F+    
Sbjct: 284 KHSVVHSITRDTRDNIIA-PSSGQMWKFINEV----SLGKFWKTNLEYNFTKSWFN---- 334

Query: 336 ASHWKDKITRSFQLQGGGIYPLGSEAQTVHPLDRFQLGGLNSLKGFHLNGVG-------T 388
               ++ IT S  ++ G I+   ++   +H  D+F  GG N ++ F L G+G        
Sbjct: 335 ----RNFITMSSTVKAGYIHNFHAKTYPLHLADKFYNGGSNDVRSFQLMGLGPKDIYDYV 390

Query: 389 GGQNFFYKLGLSISHKLINTPTK----SPLRLQYFFNLG--------NASSDYKTIFNSY 436
           GG       GLS+  +L   P K    S  RL  FFN G        N +     + + +
Sbjct: 391 GGDTSL-SYGLSLFSRL---PFKRFYDSNFRLHLFFNGGRLINRNNANTTDTLMQMLSQH 446

Query: 437 AAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTF 481
           + +TG  LV++ P A  +L +  P+T+   D ++ G   G+ ++F
Sbjct: 447 SLSTGFGLVFRHPVARFELNFTVPITAHTSDATRKGFQYGIGISF 491

>KLTH0G10824g Chr7 (910133..911620) [1488 bp, 495 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 495

 Score = 65.9 bits (159), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 73/253 (28%), Positives = 111/253 (43%), Gaps = 35/253 (13%)

Query: 248 GVSVVRRNLNEFKPTASELYAPFKGPFDKTSFVTSFTHDTR-RFIGNFPLSGCQFQLNNE 306
           GV  + R+       +S+      G   K S   S   DTR R I  FPL+G  ++L NE
Sbjct: 260 GVESLWRSTQATSTHSSDSLLLLAGDEVKNSLSHSVFWDTRDRPI--FPLAGSFYKLTNE 317

Query: 307 YVISQSQGSSKQLNHDNNFNKTAFHLEHHASHWK--DKITRSFQLQGGGIYPLGSEAQTV 364
              S+             + K  F      S W+  D  T SF L+GG I    S ++ +
Sbjct: 318 LSPSK-------------YWKCFFEASKVKS-WRKNDFFTASFTLKGGYINNF-SASKPL 362

Query: 365 HPLDRFQLGGLNSLKGFHLNGVG------TGGQNFFYKLGLSISHKL-INTPTKSPLRLQ 417
           H  D+F  GG N ++ F L G+G      + G + F   G+S+  +L     + S  RL 
Sbjct: 363 HISDKFHNGGSNDVRSFQLMGLGPKDLHDSLGGDAFVSYGVSLFSRLPFKRWSDSNFRLH 422

Query: 418 YFFN---LGNASSD-----YKTIFNSYAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLS 469
            FFN   L N + D       ++   ++ +TG+ LV   P A  +L +  PLT+   D +
Sbjct: 423 AFFNGARLINTNGDQLKNCISSLAREHSTSTGIGLVLGHPVARFELNFGIPLTAHTSDSA 482

Query: 470 KPGLSLGVSLTFF 482
           + G   G+ L+F 
Sbjct: 483 RKGFQYGIGLSFL 495

>CAGL0M06853g Chr13 (697615..699015) [1401 bp, 466 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026w
          Length = 466

 Score = 64.7 bits (156), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 62/223 (27%), Positives = 101/223 (45%), Gaps = 30/223 (13%)

Query: 276 KTSFVTSFTHDTRRFIGNFPLSGCQFQLNNEYVISQSQGSSKQLNHDNNFNKTAFHLEHH 335
           K+S   ++  DTR  +   P  G  F+LNNE  + +             + K+ F L   
Sbjct: 258 KSSIGHTYAIDTRDSVMA-PNRGNLFKLNNEVALGK-------------YWKSQFELSKV 303

Query: 336 ASHWK-DKITRSFQLQGGGIYPLGSEAQTVHPLDRFQLGGLNSLKGFHLNGVGTG----- 389
            S +K D IT +  L+GG +     + +T+H  D+F  GG N ++ F   GVG       
Sbjct: 304 QSWFKNDFITTTTTLKGGYLGNFHPDKKTLHINDKFMSGGPNDIRSFQSFGVGPKDLQDA 363

Query: 390 -GQNFFYKLGLSISHKL-INTPTKSPLRLQYFFNLGN-ASSDYKTIFNS-------YAAA 439
            G + F   G+SI  KL I     S  RL +FFN G   +   K + ++       ++ +
Sbjct: 364 IGGDTFLSYGVSIFSKLPIKKFEDSHFRLHWFFNGGKLINHQNKPVIDTLHDLSRQHSTS 423

Query: 440 TGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
            G  +V + P A  +L ++ PLT   +D  + G   G+ ++F 
Sbjct: 424 VGCGIVLRHPVARFELNFSLPLTVSTEDSLRKGFQFGLGMSFL 466

>YNL026W Chr14 (581920..583374) [1455 bp, 484 aa] {ON}
           SAM50Essential component of the Sorting and Assembly
           Machinery (SAM or TOB complex) of the mitochondrial
           outer membrane, which binds precursors of beta-barrel
           proteins and facilitates their outer membrane insertion;
           homologous to bacterial Omp85
          Length = 484

 Score = 63.5 bits (153), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 108/264 (40%), Gaps = 46/264 (17%)

Query: 235 ICNISKSVPLLYTGVSVVRRNLNEFKPTASELYAPFKGPFDKTSFVTSFTHDTRRFIGNF 294
           IC+   S P +Y+G  + +                  G   +T    +F  D R  I   
Sbjct: 251 ICSQGTSAPYMYSGTMLSQ-----------------AGDQLRTILGHTFVLDKRDHI-MC 292

Query: 295 PLSGCQFQLNNEYVISQSQGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGI 354
           P  G   + +NE    +   +  +LN   ++    F            IT S  ++ G +
Sbjct: 293 PTKGSMLKWSNELSPGKHLKTQLELNSVKSWMNDDF------------ITFSTTIKTGYL 340

Query: 355 YPLGSEAQT-VHPLDRFQLGGLNSLKGFHLNGVG------TGGQNFFYKLGLSISHKL-I 406
             L S+    VH  D+FQ GG + ++GF   G+G        G + F   GLS+  +L  
Sbjct: 341 KNLSSQQSLPVHICDKFQSGGPSDIRGFQTFGLGPRDLYDAVGGDAFVSYGLSVFSRLPW 400

Query: 407 NTPTKSPLRLQYFFNLGN-ASSDYKTIFNS-------YAAATGLSLVYKTPQALLDLTYA 458
               KS  RL +FFN G   + D  ++ N        ++ +TG+ LV + P A  +L + 
Sbjct: 401 KKVEKSNFRLHWFFNGGKLVNHDNTSLGNCIGQLSKEHSTSTGIGLVLRHPMARFELNFT 460

Query: 459 HPLTSRPQDLSKPGLSLGVSLTFF 482
            P+T+   DL + G   G+ L F 
Sbjct: 461 LPITAHENDLIRKGFQFGLGLAFL 484

>NCAS0G03860 Chr7 complement(715064..716449) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 78/165 (47%), Gaps = 19/165 (11%)

Query: 335 HASHWKDK--ITRSFQLQGGGIYPLGSEAQTVHPLDRFQLGGLNSLKGFHLNGVG----- 387
           H   W D   +T S   + G I+ L S  Q+VH  D+FQ GG N ++ F   G+G     
Sbjct: 299 HLKSWFDNDFVTMSCNFKTGYIHSLSS--QSVHISDKFQSGGPNDIRSFQSMGLGPKDHM 356

Query: 388 -TGGQNFFYKLGLSISHKL-INTPTKSPLRLQYFFNLGN-------ASSD-YKTIFNSYA 437
            + G + F   G+S+  +L I   + S  RL  F N GN       A +D    +   ++
Sbjct: 357 NSIGGDAFVSYGVSVFSRLPIEKWSASNFRLHGFINGGNLIDHNGQALTDCLAALSRQHS 416

Query: 438 AATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
            + G+ ++ + P A  +L ++ PLT    D  + GL  GV L+F 
Sbjct: 417 TSAGVGIILRHPMARFELNFSVPLTMHSGDDVRKGLQFGVGLSFL 461

>NCAS0G03750 Chr7 (692032..693417) [1386 bp, 461 aa] {ON} 
          Length = 461

 Score = 62.8 bits (151), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 50/165 (30%), Positives = 78/165 (47%), Gaps = 19/165 (11%)

Query: 335 HASHWKDK--ITRSFQLQGGGIYPLGSEAQTVHPLDRFQLGGLNSLKGFHLNGVG----- 387
           H   W D   +T S   + G I+ L S  Q+VH  D+FQ GG N ++ F   G+G     
Sbjct: 299 HLKSWFDNDFVTMSCNFKTGYIHSLSS--QSVHISDKFQSGGPNDIRSFQSMGLGPKDHM 356

Query: 388 -TGGQNFFYKLGLSISHKL-INTPTKSPLRLQYFFNLGN-------ASSD-YKTIFNSYA 437
            + G + F   G+S+  +L I   + S  RL  F N GN       A +D    +   ++
Sbjct: 357 NSIGGDAFVSYGVSVFSRLPIEKWSASNFRLHGFINGGNLIDHNGQALTDCLAALSRQHS 416

Query: 438 AATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
            + G+ ++ + P A  +L ++ PLT    D  + GL  GV L+F 
Sbjct: 417 TSAGVGIILRHPMARFELNFSVPLTMHSGDDVRKGLQFGVGLSFL 461

>AGR392C Chr7 complement(1450059..1451546) [1488 bp, 495 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL026W
           (SAM50)
          Length = 495

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 74/157 (47%), Gaps = 15/157 (9%)

Query: 341 DKITRSFQLQGGGIYPLGSEAQTVHPLDRFQLGGLNSLKGFHLNGVG------TGGQNFF 394
           D +T S  L+ G I  L    + +H  D+F  GG N ++GF L G+G      + G + F
Sbjct: 339 DFLTLSTTLKAGYIKNLQPGLRPIHIRDKFHCGGANDVRGFQLMGLGPKDAQDSLGGDAF 398

Query: 395 YKLGLSISHKL-INTPTKSPLRLQYFFNLG-----NASSDYK---TIFNSYAAATGLSLV 445
              GLS+  +L +     S  RL +F N G     N +S      T+   ++ + G  L+
Sbjct: 399 LTYGLSLFSRLPVQRWAGSDFRLHWFLNGGRLLSHNGASLLDVGTTLLEEHSISCGTGLL 458

Query: 446 YKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
           ++ P A  +L +  PL +   D ++ G   G+ ++F 
Sbjct: 459 FQHPVARFELNFTLPLATHSSDTARKGFQYGIGVSFL 495

>Skud_14.302 Chr14 (552625..554079) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 75/158 (47%), Gaps = 16/158 (10%)

Query: 341 DKITRSFQLQGGGIYPLGSE-AQTVHPLDRFQLGGLNSLKGFHLNGVG------TGGQNF 393
           D IT S   + G +  + S+ +  +H  D+FQ GG N ++ F   G+G      T G + 
Sbjct: 327 DFITFSTTFKTGYLENISSQRSLPIHICDKFQSGGPNDIRSFQTFGLGPRDLYDTIGGDA 386

Query: 394 FYKLGLSISHKL-INTPTKSPLRLQYFFNLG--------NASSDYKTIFNSYAAATGLSL 444
           F   G+S+  +L      KS  RL +FFN G        + S+    +   ++ +TGL L
Sbjct: 387 FVSYGVSVFSRLPWEKVKKSNFRLHWFFNGGKLINHDNMSLSNCMGRLSKEHSTSTGLGL 446

Query: 445 VYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
           V + P A  +L ++ P+ +   DL + G   G+ L F 
Sbjct: 447 VLRHPMARFELNFSLPIAAHENDLMRKGFQFGLGLVFL 484

>Suva_14.319 Chr14 (564528..565982) [1455 bp, 484 aa] {ON} YNL026W
           (REAL)
          Length = 484

 Score = 60.8 bits (146), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 47/158 (29%), Positives = 75/158 (47%), Gaps = 16/158 (10%)

Query: 341 DKITRSFQLQGGGIYPLGSEAQT-VHPLDRFQLGGLNSLKGFHLNGVG------TGGQNF 393
           D IT S   + G +  + S+    VH  D+FQ GG N ++ F   G+G        G + 
Sbjct: 327 DFITFSTTFKTGYLKNISSQQSLPVHICDKFQNGGPNDIRSFQTFGLGPRDLYDAIGGDA 386

Query: 394 FYKLGLSISHKL-INTPTKSPLRLQYFFNLGN-ASSDYKTIFNS-------YAAATGLSL 444
           F   G+S+  +L      KS  RL +FFN G   + D  ++ N        ++ +TG+ L
Sbjct: 387 FVSYGVSVFSRLPWKKVQKSNFRLHWFFNGGKLINHDNMSLSNCIGQLSKEHSTSTGIGL 446

Query: 445 VYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
           V + P A  +L ++ P+ +   DL + GL  G+ L F 
Sbjct: 447 VLRHPMARFELNFSLPIAAHENDLMRKGLQFGIGLAFL 484

>Smik_14.304 Chr14 (544403..545905) [1503 bp, 500 aa] {ON} YNL026W
           (REAL)
          Length = 500

 Score = 60.8 bits (146), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 80/173 (46%), Gaps = 17/173 (9%)

Query: 327 KTAFHLEHHASHWKDK-ITRSFQLQGGGIYPLGSEAQT-VHPLDRFQLGGLNSLKGFHLN 384
           KT F L    S   D  IT S   + G +  + S+    VH  D+FQ GG N ++ F   
Sbjct: 328 KTQFELNSVKSWLNDDFITFSTTFKTGYLKNISSQQSLPVHICDKFQSGGPNDIRSFQTF 387

Query: 385 GVG------TGGQNFFYKLGLSISHKL-INTPTKSPLRLQYFFNLGN-ASSDYKTIFNS- 435
           G+G        G + F   G+S+  +L      KS  RL +FFN G   + D  ++ N  
Sbjct: 388 GLGPRDLYDAIGGDAFVSYGVSMFSRLPWKKVEKSNFRLHWFFNGGKLINHDNTSLSNCI 447

Query: 436 ------YAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
                 ++ +TG+ LV + P A  +L ++ P+T+   DL + G   G+ L F 
Sbjct: 448 GQLSREHSTSTGIGLVLRHPLARFELNFSLPITAHENDLMRKGFQFGLGLAFL 500

>ZYRO0A02310g Chr1 (183977..185455) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53969 Saccharomyces cerevisiae YNL026W SAM50
           Essential component of the Sorting and Assembly
           Machinery (SAM complex) of the mitochondrial outer
           membrane the authentic non-tagged protein was localized
           to the mitochondria
          Length = 492

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 82/174 (47%), Gaps = 16/174 (9%)

Query: 325 FNKTAFHLEHHASHWKDK-ITRSFQLQGGGIYPLGSEAQTVHPLDRFQLGGLNSLKGFHL 383
           F K+   L    S ++D  +T +  L+ G I+     +Q+++  D+FQ GG N ++ F  
Sbjct: 319 FWKSQIELSKAQSWFRDDWLTVNGTLKTGYIHNFHPTSQSLNICDKFQNGGGNDVRSFQY 378

Query: 384 NGVG------TGGQNFFYKLGLSISHKL-INTPTKSPLRLQYFFNLG-----NASSDYKT 431
            G+G      + G + F   G+S+  +L  +  + S  RL +F N G     N SS    
Sbjct: 379 MGLGPKDIYDSIGGDAFVSYGVSVFTRLPFHKISHSNFRLHWFLNGGKLINHNNSSLQDV 438

Query: 432 IFN---SYAAATGLSLVYKTPQALLDLTYAHPLTSRPQDLSKPGLSLGVSLTFF 482
           I N    ++ + G  LV K P A  +L +A P+T    D  + G   G+ L+F 
Sbjct: 439 IKNLSTQHSTSIGFGLVLKHPVARFELNFALPVTCHTGDCIRKGFQYGIGLSFL 492

>TDEL0G02340 Chr7 (451314..452798) [1485 bp, 494 aa] {ON} Anc_2.304
           YNL026W
          Length = 494

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/203 (24%), Positives = 89/203 (43%), Gaps = 27/203 (13%)

Query: 295 PLSGCQFQLNNEYVISQSQGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGI 354
           P  G   +L NE  I Q      +++ +N++ K  F            +     L+ G I
Sbjct: 304 PSRGSLLKLTNELAIGQFWKGQIEVSQNNSWLKDDF------------LGSCCTLRSGYI 351

Query: 355 YPLGSEAQTVHPLDRFQLGGLNSLKGFHLNGVG------TGGQNFFYKLGLSISHKL-IN 407
             L S  + ++  D+F  GG N ++ FH+ G+G      + G + F   G+S   +L I 
Sbjct: 352 QNLSSSRKPINTFDKFHNGGANDIRSFHIMGLGPKDLYDSIGGDAFVAYGVSFFSRLPIK 411

Query: 408 TPTKSPLRLQYFFNLG------NA--SSDYKTIFNSYAAATGLSLVYKTPQALLDLTYAH 459
             + S  RL +FFN G      NA  ++  + + + ++ + G  ++ +   A  +L +  
Sbjct: 412 RWSHSNFRLHWFFNGGKLINHNNAPFTNILEQLASEHSTSVGFGILLRHQVARFELNFTL 471

Query: 460 PLTSRPQDLSKPGLSLGVSLTFF 482
           PLT    D  + G   G+ ++F 
Sbjct: 472 PLTCHSGDALRKGFQYGIGISFL 494

>NDAI0G00710 Chr7 complement(153261..154736) [1476 bp, 491 aa] {ON}
           Anc_2.304
          Length = 491

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 66/134 (49%), Gaps = 15/134 (11%)

Query: 364 VHPLDRFQLGGLNSLKGFHLNGVG------TGGQNFFYKLGLSISHKL-INTPTKSPLRL 416
           +H  D+FQ GG N ++ F   G+G      + G + F   G+SI  KL I   +KS  RL
Sbjct: 358 LHISDKFQNGGPNDIRSFQTMGLGPKDIFNSIGGDAFVSYGISIFSKLPIKDWSKSNFRL 417

Query: 417 QYFFNLG--------NASSDYKTIFNSYAAATGLSLVYKTPQALLDLTYAHPLTSRPQDL 468
            +F N G        + ++ +  +   ++ +TG+ ++ + P A  +L ++ PLT    D 
Sbjct: 418 HWFLNGGKLINHNGMSINNCFTDLSRQHSISTGVGILLRHPMARFELNFSVPLTIHQGDD 477

Query: 469 SKPGLSLGVSLTFF 482
            + G   GV L+F 
Sbjct: 478 VRKGFQFGVGLSFL 491

>TPHA0G00830 Chr7 (155259..156695) [1437 bp, 478 aa] {ON} Anc_2.304
           YNL026W
          Length = 478

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/206 (23%), Positives = 91/206 (44%), Gaps = 29/206 (14%)

Query: 294 FPLSGCQFQLNNEYVISQSQGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGG 353
            P  G   ++ NE  +++   S  ++N   +F K +             IT +  ++ G 
Sbjct: 285 IPTYGSFLKVFNEVALNRYLKSQIEVNTAMSFLKNSL------------ITVNGTMRLGY 332

Query: 354 IYPLGSEAQTVHPLDRFQLGGLNSLKGFHLNGVG------TGGQNFFYKLGLSISHKL-I 406
           I  + S  + +H  DRFQLGG N ++ F   G+G      + G N +   G+S+   L  
Sbjct: 333 ISNISSTLRPLHIGDRFQLGGGNDVRSFQPMGLGPKDIYDSIGGNSYTAYGISVFTALPF 392

Query: 407 NTPTKSPLRLQYFFNLG-----NASSD-----YKTIFNSYAAATGLSLVYKTPQALLDLT 456
            +   S  ++  F N G     N+S+       K +    + +TG+ +++K P A  +L 
Sbjct: 393 KSLMTSNFKIHTFINGGKLINHNSSNGTFTDAVKDLIKENSLSTGVGIIFKHPVARFELN 452

Query: 457 YAHPLTSRPQDLSKPGLSLGVSLTFF 482
           +  PL +   D+ + G   G+ ++F 
Sbjct: 453 FTLPLITHKSDMVRKGFQYGIGISFL 478

>NDAI0H03400 Chr8 complement(821981..825298) [3318 bp, 1105 aa] {ON}
           Anc_2.316 YGL151W
          Length = 1105

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 40/82 (48%), Gaps = 7/82 (8%)

Query: 168 WNPVTSQWDGKDARFSFSL---PLVKVPSVRAIVEAEGIQRSL-CSKPFVAPEDEHVQQQ 223
           W P+ S +  K A  + SL   P+  +PS   ++  + I+ S  C   FV+ +  H  Q 
Sbjct: 291 WEPINSDFLSKYATIASSLFKEPIQPLPSTDHLL-TDLIETSFTCFAQFVSNKQYH--QT 347

Query: 224 YAVGAGFQKRWICNISKSVPLL 245
            A     +KRW   ISK +PLL
Sbjct: 348 NANLNLLEKRWTIFISKQLPLL 369

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 65/135 (48%), Gaps = 29/135 (21%)

Query: 7    ELIHTAHEHINLHD--------NETKPLYISKIVLDGDNGSSPLSDSLCR--AIFGEALN 56
            E+I   H+ +N+ D        NETK L  +K+       ++ L+D   R      E LN
Sbjct: 1307 EMIE-KHQKVNVDDYTKLEETLNETKQLLDNKV-----QETNELNDRFNRLKKQAHEKLN 1360

Query: 57   --QPLQS-----VENSINIFEDIRKKLLF-----TGLFSDVNITLDKDPDTTSL-SQLNK 103
              + LQS     + N I+  +DIRK+L       + L S++N   +K  D  +L  +LNK
Sbjct: 1361 TSKELQSSLQEQISNLISEKDDIRKQLDVKTEENSELLSELNNFREKQNDLETLREELNK 1420

Query: 104  EISESYGIETPLSTQ 118
            EIS+S  +E  L  +
Sbjct: 1421 EISKSEELEVKLQNE 1435

>NCAS0I00350 Chr9 complement(48759..50456) [1698 bp, 565 aa] {ON}
           Anc_7.8 YOR372C
          Length = 565

 Score = 31.6 bits (70), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 44/114 (38%), Gaps = 24/114 (21%)

Query: 303 LNNEYVISQSQGSSKQLNHDNNFNKTAFHLEHHASHWKDKITRSFQLQGGGIYPLGSEAQ 362
           + N  +   S G+S   NH  N + +   +E + +     I  S  LQ G  +P      
Sbjct: 103 MENSILPGLSLGASTNANHQTNKDPSRNTVEENLNDMN--IQPSSALQFGSSFP------ 154

Query: 363 TVHPLDRFQLGGLNSLKGFHLNGVGTGGQNFFYKLGLSISHKLINTPTKSPLRL 416
                + F L     LK F L+    GG NFF K           TP K+PLR 
Sbjct: 155 -----NEFLLTSPAQLKEFLLDSPAPGGFNFFQK-----------TPAKTPLRF 192

>Smik_5.235 Chr5 complement(351897..356189) [4293 bp, 1430 aa] {ON}
            YER093C (REAL)
          Length = 1430

 Score = 31.2 bits (69), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 8/76 (10%)

Query: 80   GLFSDVNITLDK-DPDTTSLS-----QLNKEISESYGIETPLSTQAKVLLKRPDYNTISG 133
            G ++D  I  DK D D           L+K + E    E PL+   K+++++ D +  S 
Sbjct: 1250 GEYTDEMIVFDKTDGDLIEKCVPIEFDLDKLLREKNTAENPLN--EKIIIRKYDNDITSQ 1307

Query: 134  TTTLSDDNISLAGSKT 149
            + T+SD+N SLA + T
Sbjct: 1308 SITISDENTSLAANGT 1323

>NCAS0J01300 Chr10 (225659..226966) [1308 bp, 435 aa] {ON} Anc_4.222
          Length = 435

 Score = 30.8 bits (68), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 14/43 (32%), Positives = 19/43 (44%)

Query: 332 LEHHASHWKDKITRSFQLQGGGIYPLGSEAQTVHPLDRFQLGG 374
           + H   HWKD +    +  GGG    G+E+   H     QL G
Sbjct: 295 IRHQKRHWKDALPEGKKASGGGAVANGTESAHDHLKSLHQLSG 337

>Kpol_1069.17 s1069 complement(39974..41878) [1905 bp, 634 aa] {ON}
           complement(39974..41878) [1905 nt, 635 aa]
          Length = 634

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 18/68 (26%), Positives = 27/68 (39%), Gaps = 4/68 (5%)

Query: 243 PLLYTGVSVVRRNLNEFKPTASELYAPFKGPFDKTSFVTSFTH----DTRRFIGNFPLSG 298
           PL    V +    + + K +  E+    KG + K     S  H    DT  FIGN+    
Sbjct: 496 PLKQFNVVISNFEILDMKKSVIEMIGNVKGDYSKKDLPESIPHAEPRDTEVFIGNWKCQD 555

Query: 299 CQFQLNNE 306
           C  +  +E
Sbjct: 556 CNIEFESE 563

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,891,791
Number of extensions: 2470920
Number of successful extensions: 7238
Number of sequences better than 10.0: 57
Number of HSP's gapped: 7444
Number of HSP's successfully gapped: 57
Length of query: 482
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 369
Effective length of database: 40,524,141
Effective search space: 14953408029
Effective search space used: 14953408029
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)