Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F10054g5.435ON66066031780.0
TDEL0E019005.435ON7627247424e-87
NCAS0F033905.435ON8616836327e-71
NDAI0B056805.435ON8566995315e-57
Kwal_55.214225.435ON7826894872e-51
KAFR0E038305.435ON8454134681e-48
KLTH0F16038g5.435ON7926804617e-48
SAKL0G02552g5.435ON8344194555e-47
YDR369C (XRS2)5.435ON8543894512e-46
Kpol_1016.55.435ON8127284423e-45
Skud_4.6385.435ON8433884087e-41
Suva_2.5415.435ON8693824024e-40
TPHA0J025905.435ON7755593882e-38
KNAG0C049005.435ON7693813535e-34
Smik_4.6355.435ON8633983536e-34
CAGL0A02838g5.435ON8281913191e-29
Ecym_47615.435ON7985842851e-25
KLLA0E02201g5.435ON8353672832e-25
AER402C5.435ON8694182691e-23
TBLA0A028205.435ON9252482494e-21
Skud_5.1217.168ON76264810.43
Ecym_64862.6ON78170771.2
KAFR0D040801.54ON61367742.9
Suva_5.1097.168ON76160733.1
Smik_5.1387.168ON76060725.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F10054g
         (660 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {...  1228   0.0  
TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.4...   290   4e-87
NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {O...   248   7e-71
NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa] ...   209   5e-57
Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369...   192   2e-51
KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.4...   184   1e-48
KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weak...   182   7e-48
SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {...   179   5e-47
YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}...   178   2e-46
Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON} (10036.....   174   3e-45
Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {...   161   7e-41
Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON...   159   4e-40
TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {...   154   2e-38
KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.4...   140   5e-34
Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {...   140   6e-34
CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {...   127   1e-29
Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar...   114   1e-25
KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {...   113   2e-25
AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}...   108   1e-23
TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.4...   100   4e-21
Skud_5.121 Chr5 complement(186243..188531) [2289 bp, 762 aa] {ON...    36   0.43 
Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}...    34   1.2  
KAFR0D04080 Chr4 complement(804693..806534) [1842 bp, 613 aa] {O...    33   2.9  
Suva_5.109 Chr5 complement(165063..167348) [2286 bp, 761 aa] {ON...    33   3.1  
Smik_5.138 Chr5 complement(194172..196454) [2283 bp, 760 aa] {ON...    32   5.0  

>ZYRO0F10054g Chr6 complement(814872..816854) [1983 bp, 660 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 660

 Score = 1228 bits (3178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/660 (92%), Positives = 609/660 (92%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60
           MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR
Sbjct: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60

Query: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQGSR 120
           QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQGSR
Sbjct: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQGSR 120

Query: 121 SDHSALEELGIEVLSSELSRANLIVIDEQQNYSRWLYGLVKRIPLMNLEFLNVVSQKVSG 180
           SDHSALEELGIEVLSSELSRANLIVIDEQQNYSRWLYGLVKRIPLMNLEFLNVVSQKVSG
Sbjct: 121 SDHSALEELGIEVLSSELSRANLIVIDEQQNYSRWLYGLVKRIPLMNLEFLNVVSQKVSG 180

Query: 181 HETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDTSLAIEAAGGKYSAVLS 240
           HETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDTSLAIEAAGGKYSAVLS
Sbjct: 181 HETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDTSLAIEAAGGKYSAVLS 240

Query: 241 VEELREAVKRKGDLSNVVILKSHLTPAEELAPLGKTFTVQDVVEAILKDEVNSLKNGVIG 300
           VEELREAVKRKGDLSNVVILKSHLTPAEELAPLGKTFTVQDVVEAILKDEVNSLKNGVIG
Sbjct: 241 VEELREAVKRKGDLSNVVILKSHLTPAEELAPLGKTFTVQDVVEAILKDEVNSLKNGVIG 300

Query: 301 EVAKRPEAEVPMEKPVTKKRRLNRPRVKPLDILSFFAGGDSMKESQGESTMKLNSQEEES 360
           EVAKRPEAEVPMEKPVTKKRRLNRPRVKPLDILSFFAGGDSMKESQGESTMKLNSQEEES
Sbjct: 301 EVAKRPEAEVPMEKPVTKKRRLNRPRVKPLDILSFFAGGDSMKESQGESTMKLNSQEEES 360

Query: 361 KDPRKLEDPXXXXXXXXXVLQPEVPKEFNEYSKEEPGQKSYEESKADENEKSLEETVEPT 420
           KDPRKLEDP         VLQPEVPKEFNEYSKEEPGQKSYEESKADENEKSLEETVEPT
Sbjct: 361 KDPRKLEDPKEESKESKEVLQPEVPKEFNEYSKEEPGQKSYEESKADENEKSLEETVEPT 420

Query: 421 LQVTEPPPTSAAEKPNNARPHRKPTLSDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTII 480
           LQVTEPPPTSAAEKPNNARPHRKPTLSDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTII
Sbjct: 421 LQVTEPPPTSAAEKPNNARPHRKPTLSDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTII 480

Query: 481 QVGDEELTEDAINQLGNLVLVXXXXXXXXXXXXSPTVDSHXXXXXXXXXXXXXXXXXPKY 540
           QVGDEELTEDAINQLGNLVLV            SPTVDSH                 PKY
Sbjct: 481 QVGDEELTEDAINQLGNLVLVDRNDNLMRRRDRSPTVDSHNPNWNNRKNFKNFVKVWPKY 540

Query: 541 GGQDSTSREGSSDTIRNRAFLLTRQYVPTRTYTSGDSSKQAQEDLYDFPEPQPEAQSVPQ 600
           GGQDSTSREGSSDTIRNRAFLLTRQYVPTRTYTSGDSSKQAQEDLYDFPEPQPEAQSVPQ
Sbjct: 541 GGQDSTSREGSSDTIRNRAFLLTRQYVPTRTYTSGDSSKQAQEDLYDFPEPQPEAQSVPQ 600

Query: 601 VEAPGPNNLFVMDEDDSQDVALEEPEKPVLPSTSHLIXXXXXXXXXXXXXPKFQFKRRKR 660
           VEAPGPNNLFVMDEDDSQDVALEEPEKPVLPSTSHLI             PKFQFKRRKR
Sbjct: 601 VEAPGPNNLFVMDEDDSQDVALEEPEKPVLPSTSHLIDDRESDSDSDDDEPKFQFKRRKR 660

>TDEL0E01900 Chr5 (359266..361554) [2289 bp, 762 aa] {ON} Anc_5.435
           YDR369C
          Length = 762

 Score =  290 bits (742), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 232/724 (32%), Positives = 357/724 (49%), Gaps = 125/724 (17%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60
           MWIL+Y Y+LEDG ++ VS CL   +T++IGRSSKN LNIKNDKSISR H+S+ WD + +
Sbjct: 1   MWILKYTYELEDGTIRRVSSCLVKQQTFSIGRSSKNPLNIKNDKSISRNHISVVWDSEVK 60

Query: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGT---VLVELGTKPLKMQLQWMDSIWMVPQ 117
            ++LINQG++TA   KYLK+GES+ F + +     +++ELGTKP+K+++ W D ++ +P 
Sbjct: 61  LIRLINQGRLTAAGGKYLKVGESMDFEEKLHIREPIIIELGTKPIKVEVVWQDVVFDLPS 120

Query: 118 GSRSDHSALEELGIEVLSSEL-SRANLIVIDEQQNYS-RWLYGLVKRIPLMNLEFLNVVS 175
                   L+ +GI V +  + +R+  I++ ++  ++ + L+GL+    + N +FL  V+
Sbjct: 121 QLSQFIDTLDHVGIGVKADTVDNRSTTIIVTDKIKFAYKCLFGLINGAVIRNSQFLVEVT 180

Query: 176 QKVSGHETEFDSIW-TKIMNDGSLRY-KSWEVQAQVLQNLEFLTVGKDEDTSL----AIE 229
             +S   T F+  W + I N+  + Y  +      +L+  +F  +  D  T      A+E
Sbjct: 181 NILSKPTTTFEESWDSLIQNESYMLYPNNLGPHEVILKGYKFYLIASDVITMAYVQEALE 240

Query: 230 AAGGKYSAVLSVEELREAVKRKGDLSNVVILKSHLT---PAEELAPLGKTFTVQDVVEAI 286
              G+   V + E+L + +K++    ++++LK+  T   P +++    K  T+ D+V A+
Sbjct: 241 RGNGELIVVENTEQLLDRLKQENSTDDLIVLKAEETTKIPGDKI----KLHTLVDLVNAV 296

Query: 287 LKDEVNSLKNG----------VIG---------EVAKR---------PEAEV-PMEKPVT 317
             + V +L  G          VIG         EV+           PE  V P EKP  
Sbjct: 297 SHNTVKTLLGGVPPMEAGPGDVIGSHQPTLTKTEVSSSQSLSNKEHTPEHTVTPAEKPPV 356

Query: 318 KKRRLNRPRVKPLDILSFFAGGD-SMKESQGE-STMKLNSQEEESKDPRKLEDPXXXXXX 375
           K+RR N  RVKPLD L FFAGGD S +E + E ST  +N        P   +        
Sbjct: 357 KRRRYN--RVKPLDSLMFFAGGDYSTEEPEQEISTQPVN--------PAASDTAKTSITT 406

Query: 376 XXXVLQPEVPKEFNEYSKEEP------------------GQKSYEESKADENEKSLEETV 417
              V + +  +E + + K +P                     ++E + A+++ K + + +
Sbjct: 407 QINVPENDASQESSAFDKFQPNIVLKNSAKPLTIDSPGDAHNTHEINTANQHVKDIAQQI 466

Query: 418 EPTLQVTEPPPTSAAEKPN------NARP-HRKPTLSDYRK------GESPSQNDMIQMI 464
           E    +  P     +E+ N        RP  RK TL D++         + S   ++ +I
Sbjct: 467 E----MNHPESEQQSEQANLNMVETTPRPTARKKTLQDFKSTVNNPDNSASSTEGLVDLI 522

Query: 465 QDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVXXXXXXXXXXXXSPTVDSHXXXX 524
           +D K+ EVKRL ST++QV  +ELTEDAINQLG+L +V                 S     
Sbjct: 523 KDAKSREVKRLKSTLVQVDTDELTEDAINQLGDLAIVQPNDSLIRRQKIDSAETSRNDQH 582

Query: 525 ---XXXXXXXXXXXXXPKYGGQ--DSTSREGSSDTIRNRAFLLTRQYVPTRTYTSGDSSK 579
                            KY  Q      REGSSD IRN  +LLTRQYVP++ YT     K
Sbjct: 583 PPWDGRKNFKNFVKVQAKYKEQRMGENYREGSSDFIRNSGYLLTRQYVPSKIYT-----K 637

Query: 580 QAQEDLYDFPEPQPEAQ---SVPQV-----------------EAPGPNNLFVMDEDDSQ- 618
           ++ +++ DFPE   +     SVPQV                   P  N LFV+DEDDSQ 
Sbjct: 638 ESSKEMQDFPEASEQTSRQFSVPQVIDDPEDAEPFTFTRHTSGTPANNGLFVVDEDDSQN 697

Query: 619 DVAL 622
           DV L
Sbjct: 698 DVVL 701

>NCAS0F03390 Chr6 complement(683109..685694) [2586 bp, 861 aa] {ON}
           Anc_5.435 YDR369C
          Length = 861

 Score =  248 bits (632), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 188/683 (27%), Positives = 333/683 (48%), Gaps = 104/683 (15%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60
           MW+LRYQYDLEDG+ + +S C++    Y IGRS+KN L+IKNDKSISRQH+S+ W+ ++ 
Sbjct: 1   MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRN- 59

Query: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQGSR 120
            + +INQGK+T + E+YL +G+S++FG ++ ++ ++LGTKP+ + L++  S W++P G  
Sbjct: 60  DIHIINQGKLTYIGEQYLDVGQSLTFG-NVNSLSIKLGTKPVMVHLEFYSSNWLIPNGLT 118

Query: 121 SDHSALEELGIEVLS----SELSRANLIVIDEQQNYSRWLYGLVKRIPLMNLEFLNVVSQ 176
             H  L++ G+ V +     + ++ +LIV +   +    L+G +K IP+   +F +   +
Sbjct: 119 QFHETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTACE 178

Query: 177 KVSGHETEFDSIWTKIMNDGSL----RYKSWEVQAQVLQNLEFLTVGKDEDTSLAIEA-- 230
            +S ++ +FD+ W ++    +      Y S + ++++ +N   L +  +E    A++   
Sbjct: 179 ILSSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNETNKDAVKTLK 238

Query: 231 -----AGGKYSAVLSVEELREAVKRKGDLSN----VVILKSHLTPAEELAPLGKTFTVQD 281
                 G   +    +   ++ +      +N    +V   S  +P ++L  L + F ++D
Sbjct: 239 TALNLGGAIVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFKSPNDQLPDL-EYFKLED 297

Query: 282 VVEAILKDE-----------------------------------------VNSLKNGVIG 300
           ++ AI  D+                                         V+S+ N    
Sbjct: 298 IITAIRDDKIMKLITTIPEREQVMNQDVSLIPEITYPSDRKTNIQPSHHTVDSIHNDKKN 357

Query: 301 EVAKRPEAEVPMEKPVTKKRRLNRPRVKPLDILSFFAGGDSMK------ESQGESTMKLN 354
            ++ R   E  +  P+ KKRRLNR RVKPLD L+FFAGG S K      +   ++T   +
Sbjct: 358 VLSNRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGGASPKIGSPAVQETAQATKDES 417

Query: 355 SQEEESKDPRKLEDPXXXXX----XXXXVLQPEVPKEFNEYSKEEP----------GQKS 400
           ++ ++ +    L  P             VL+  +  + N+  +E P            + 
Sbjct: 418 AESDKFRTNNGLTQPSGNSQPLIHSEPIVLKEVLEADHNKNIQEGPTTAVPVIQSKSTQP 477

Query: 401 YEESKADENEKSLEETVEPTLQVTEPPPTSAAEKPNNAR-PHRKPTLSDYRKGESPSQND 459
            E ++ ++N +       PT +V      +  E+PN  + P  +  +S++++ ++   N 
Sbjct: 478 LEHTEQNKNSEIGSVAATPTPEVLT---GNGVERPNTPQVPSTQALVSNHKEKKNLKSNS 534

Query: 460 M------IQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVX-----XXXXXX 508
           +      +Q IQ+TKN EV RL ST++++  +ELTE AINQLG+LV+V            
Sbjct: 535 LEEPKSFVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKAS 594

Query: 509 XXXXXSPT---VDSHXXXXXXXXXXXXXXXXXPKYGGQDSTSREGSSDTIRNRAFLLTRQ 565
                +PT    D                   PKY  +D+ S   ++D IRN AFL+TR 
Sbjct: 595 RCECRTPTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTES--DTTDLIRNNAFLITRN 652

Query: 566 YVPTRTYTSG-DSSKQAQEDLYD 587
           YVP + +T   ++     ED+Y+
Sbjct: 653 YVPMKKFTGQYNNVPNDDEDMYE 675

>NDAI0B05680 Chr2 complement(1384354..1386924) [2571 bp, 856 aa]
           {ON} Anc_5.435 YDR369C
          Length = 856

 Score =  209 bits (531), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 201/699 (28%), Positives = 293/699 (41%), Gaps = 125/699 (17%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60
           MWILRYQY LEDG +K VS CL     Y+IGRSSKN L+IKNDKSISRQH++I W+    
Sbjct: 1   MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSG- 59

Query: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVL-VELGTKPLKMQLQWMDSIWMVPQGS 119
           QL L+NQGK+T+V E+YL + ES+ F       L V LGT P+ +Q++W      +P   
Sbjct: 60  QLHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPNMY 119

Query: 120 RSDHSALEELGIEVLSSELSRANLI--VIDEQQNYSRWLYGLVKRIPLMNLEFLNVVSQK 177
                 L + GIEV S  L   + I  V+    +Y   L  L   IP+   ++L  VS  
Sbjct: 120 EQFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLTEVSNM 179

Query: 178 VSGHETEFDSIWTKIMNDGSLR----YKSWEVQAQVLQNLEFL------TVGKDEDTSL- 226
           +      FD+   KI +  SL+    +          Q+  F+      +V +  D S  
Sbjct: 180 LRPDNITFDTDVQKINSMESLKLVPSFSLSNNSKNFFQDYFFIITLNKSSVSEHADKSFI 239

Query: 227 ---AIEAAGGKYSAVLSVEELREAVKRKGDLS--NVVILKSHLTPAEELAPLGKTFTVQD 281
              +++  GG+   +    EL+ +V +    S  N+VI+         +    +   V+D
Sbjct: 240 LRKSLQLIGGEEEIIKDPTELQNSVTKILSTSGKNIVIVTDEDNGKRMIMNF-ECRNVKD 298

Query: 282 VVEAILKDEVNSLKNGVIGEVAKRPEA--------------EVPMEKPVT---------- 317
           + ++ +K++   LK+ +       P+A              E P+E  +T          
Sbjct: 299 IFDSFVKNDPKLLKSNLTETGVVSPKAPEIFENEKLMVEIQEPPIEAAITEESTSSKNLK 358

Query: 318 ------------KKRRLNRPRVKPLDILSFFAGGDSMKESQGESTMKLNSQEEESKDPRK 365
                       KKRRL R RVKPL+ L FF GG +       S+  L   ++E  +P+ 
Sbjct: 359 HTPPEPVTTHIVKKRRLARKRVKPLESLDFFVGGSTTGTPFETSSTTL---QQEIIEPKV 415

Query: 366 LEDPXXXXXXXXXVLQPEVPKEFNEYSKEEPGQKSYEESKADENEKSL-------EETVE 418
              P         + Q +V K  N     EP +  Y    +D  E +        +   E
Sbjct: 416 ---PDVAPILNEQIQQSQVNKSIN-----EPAKDIYSIGGSDRKETAALTYATIDKHMQE 467

Query: 419 PTLQVTEPP-------PTSAA-------------------------EKPNNARPHRKPTL 446
           PT Q+ + P       P   +                         EK +NA+  +    
Sbjct: 468 PTQQIDDIPSQHIDISPHGNSNEQEKRSNSSEKSPMITQQVNDEKDEKISNAKALKIGKR 527

Query: 447 SDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVXXXXX 506
            D ++    +   M++ IQD KN EV RL S+I  V  EELTEDAIN+  NL +V     
Sbjct: 528 EDSKRYSETTPKSMVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNAS 587

Query: 507 XXXXXXXSPTV-------------DSHXXXXXXXXXXXXXXXXXPKY--GGQDSTSR--- 548
                  +                D+                  PKY     DS +    
Sbjct: 588 LIRRTENNDNTNKSTNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGD 647

Query: 549 EGSSDTIRNRAFLLTRQYVPTRTYTSGDSSKQAQEDLYD 587
            G+SD IRN AFL+TR YVP + Y+  D S   +    D
Sbjct: 648 NGASDFIRNNAFLITRNYVPLKQYSKYDDSHGGKNGFND 686

>Kwal_55.21422 s55 (830578..832926) [2349 bp, 782 aa] {ON} YDR369C
           (XRS2) - DNA repair protein [contig 130] FULL
          Length = 782

 Score =  192 bits (487), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 180/689 (26%), Positives = 300/689 (43%), Gaps = 84/689 (12%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWD-GKD 59
           MWILRYQY   +G   HVSCCL+ G  Y+IGRS+KN L IK+DKSISR HV +  D   +
Sbjct: 1   MWILRYQYVAGNGMDVHVSCCLKQGLQYSIGRSTKNPLQIKSDKSISRNHVELEVDQSCN 60

Query: 60  RQLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQG- 118
             L+++  GK+T VS K +K G+ + F      VL E+G  P+K  +    S W +P   
Sbjct: 61  VVLRVV--GKLTKVSGKSVKAGQHLQFTADE-EVLFEMGASPIKATVVKQQSFWKIPHDL 117

Query: 119 --SRSDHSALEELGIEVLSSELSRANL-IVIDEQQNYSRWLYGLVKRIPLMNLEFLNVVS 175
             S+S    L +  I+V +S  S  ++ I+ D  +++S  L+ L+K IP++   F+    
Sbjct: 118 SLSQSLSRHLADFDIQVTNSLSSTTSIQIIKDSSKSFSNCLFSLIKNIPILREHFIGDFV 177

Query: 176 QKVSGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDTSLA--IEAAGG 233
            +++    +FDS W +++ + + ++ +++ + +    + FL   +         I+A  G
Sbjct: 178 TQINDVHADFDSRWDRMVVENA-QFPNYKCECRPFTTIHFLVTNRRAFAIFKHIIDAGSG 236

Query: 234 KYSAVLSVEELREAVKRKGDLSNVVILKSHLTPAEELAPLGKTFTVQDVVEA-ILKDEVN 292
                  +  L   +K K    NV++L  HL   +      +  +  DV EA +LK++  
Sbjct: 237 TLWLCDDISNLDHFIKHKITSDNVILL-VHLNNGKSSISSTEQSSDLDVQEAKLLKNKAQ 295

Query: 293 SLK------NGVIGEV------------------AKRPEAEVPME--------------K 314
           +L       N ++G V                  +K P    P+E              K
Sbjct: 296 NLGFRIHDVNDIVGAVLDHNFEKLLERVPVRNLPSKAPTG-FPLEEATNKSVIKSADTPK 354

Query: 315 PVTKKRRLNRPRVKPLDILSFFAGGDSMKESQGESTMKLNSQEEESKDPRKLE----DPX 370
           P  K++R NR +V PLD L+FF GG + +  Q  + +  + +  E+      E    +P 
Sbjct: 355 PSNKRKRTNR-QVVPLDSLAFFGGGSAAESKQNPTEVPESERGHETSQNTTTEFAEGEPS 413

Query: 371 XXXXXXXXVLQPEVPKEFNEYSKEEPGQKSYEESKADENEKSLEETVEP-----TLQVTE 425
                   + +P++P    E  KE   Q   + +     + S+     P     TLQ +E
Sbjct: 414 PKKARIGALRKPDIPNVSEERVKEPVVQTRSKRASERSADTSILVQANPKRSRKTLQASE 473

Query: 426 -----------------PPPTSAAEKPNNARPHRKPTLSDYRKGESPSQNDMIQMIQDTK 468
                            P P + +    N     +      R+ + P      Q +++TK
Sbjct: 474 GHTILENDNNSLNIESGPLPKTKSTSLGNEAAQAQADAVQTREAKRPVS--FAQAVKETK 531

Query: 469 NHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVXXXXXXXXXXXXSPTVDSHXXXX-XXX 527
           +HEV RL   I+ V  EELTE+AIN+L  L LV            +    S         
Sbjct: 532 SHEVDRLEKDIVNVTSEELTEEAINKLDKLALVETKDLMRADREYAVCGQSGGSEQWAGR 591

Query: 528 XXXXXXXXXXPKYGGQDSTSREGSSDTIRNRAFLLTRQYVPTRTYTSGDSSKQAQEDLYD 587
                     P    ++S   + +++ +RNRA L+TR+YVP R Y   +++ Q    L +
Sbjct: 592 KNFKKFVKLWPSRSSRNSP--DSATNALRNRAHLITREYVPLRPYEGQNANNQDDSFLKN 649

Query: 588 FPEPQPEAQSVPQVEAPGPNNLFVMDEDD 616
             +   E  + P +       +  ++ DD
Sbjct: 650 SQDDLQEEATCPSIPPVSSTTILGVEVDD 678

>KAFR0E03830 Chr5 (759871..762408) [2538 bp, 845 aa] {ON} Anc_5.435
           YDR369C
          Length = 845

 Score =  184 bits (468), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 131/413 (31%), Positives = 209/413 (50%), Gaps = 78/413 (18%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWD---- 56
           MWILRY+ +LEDG L+ VSCCL+  + Y+IGRSSKN L IKNDKSISRQH++I WD    
Sbjct: 1   MWILRYENELEDGTLRKVSCCLQKWKMYSIGRSSKNPLTIKNDKSISRQHITIRWDCNNE 60

Query: 57  GKDRQLKLINQGKMTAVSEKYLKMGESISF-GKSMGTVLVELGTKPLKMQLQWMDSIWMV 115
           G    L ++NQGK+TA+ E Y+K  ES +F  ++  TV+V+LGTKP+ +++ W    W +
Sbjct: 61  GTGTVLSVVNQGKLTAIDENYMKSDESKAFDDETYSTVVVKLGTKPVVVRISWTPIFWDL 120

Query: 116 PQGSRSDHSALEELGI--EVLSSELSRANLIVIDEQQNYSRWLYGLVKR-----IPLMNL 168
            +       ++  +GI  ++ SS +   +L++ DE+ N+SR ++ L+K+      P++  
Sbjct: 121 SKDFLQFEKSINSMGICTQMQSSNVRDISLVINDEKSNWSRIMFALLKQNCTLVKPVLLS 180

Query: 169 EFLNVVSQKVSGHETEFDSIWTKIMNDGS--LRYKSWEVQA----QVLQNLEFLTVGK-D 221
           E  NV+   ++  +T FD IW ++    S    Y  + V+     +  Q+++F TVG   
Sbjct: 181 EVCNVL---LADCQTNFDEIWAQLFESFSNYTVYPGFTVEGNDILRAFQDVQFYTVGSIS 237

Query: 222 EDTSLAIEAA----GGKYSAVLSVEELREAVKR-KGDLSNVVILKSHLTPAEELAPLGKT 276
            D  L ++A      G + +  + ++L   +K    +L   + LK      +E+  + K 
Sbjct: 238 HDDLLYLKATVSELQGNFKSFDTADDLVTYIKTVNHNLLKCIALKQEDPAPDEIQGI-KI 296

Query: 277 FTVQDVVEAILK----------------------------------------DEVNSLKN 296
           + ++++V+AIL                                         D  ++L  
Sbjct: 297 YAIKEIVQAILDGNFKNLPTHIGRSNTSRKRNFTDSISHYNEDAQRNSHVHPDNTSTLNT 356

Query: 297 GVIGEVAKRPEAEV----PMEKPV------TKKRRLNRPRVKPLDILSFFAGG 339
                ++   EA       +E P       TK+RRL R  VKPLD LSFFAGG
Sbjct: 357 NTHATISAAAEASREGGESLEPPTVMGPSPTKRRRLVRRTVKPLDSLSFFAGG 409

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 68/151 (45%), Gaps = 16/151 (10%)

Query: 440 PHRKPTLSDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLV 499
           PH K  +S  ++ +SP+    I+ +Q TK  EVKR+ + I+ V   EL+E+AIN+L NL 
Sbjct: 565 PH-KFDVSLTKRSKSPAA--FIEAVQSTKTREVKRIRTKIVDVSPSELSEEAINKLSNLT 621

Query: 500 LVXXXXXXXXXXXXSPTVDSHXXXXXXXXXXXXXXXXXPKYGGQDSTSREGSSDTIRNRA 559
           +V                DS                  P++       R+G  D++RN A
Sbjct: 622 IVESNPNLIRERRADKN-DSVNDMWKGRRNFKKFNKVWPQH-------RDG-YDSLRNNA 672

Query: 560 FLLTRQYVPTRTYTSGDSSKQAQEDLYDFPE 590
           FL+ R YV  + Y      K+   D  DF E
Sbjct: 673 FLIIRNYVELKPY----DGKRNDNDSSDFHE 699

>KLTH0F16038g Chr6 (1302028..1304406) [2379 bp, 792 aa] {ON} weakly
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369C XRS2 classified as an early recombination
           function required for DNA repair but dispensable for
           mitotic recombination (xrs2 is hyper-Rec during
           vegatative growth) required for double strand breaks
           meiotic recombination and spore viability DNA repair
           protein
          Length = 792

 Score =  182 bits (461), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 178/680 (26%), Positives = 293/680 (43%), Gaps = 82/680 (12%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60
           MWILRYQY  E G+   VSCCL+ G  Y +GRS K+ L IK DKSISR+HV +    ++ 
Sbjct: 1   MWILRYQYIDETGSEIRVSCCLKKGTQYVVGRSVKSPLQIKGDKSISRKHVQLEVR-QNS 59

Query: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQG-- 118
           +L+++N GK+T +    +KM + + FG    +V +E+G  P+K  + +  +IW +P    
Sbjct: 60  KLEVLNAGKLTKIGGDNVKMDQMLEFGADQ-SVALEMGAGPVKGTVTYEPAIWKIPHDLA 118

Query: 119 ---SRSDHSALEELGIEVLSSELSRANLIVIDE-QQNYSRWLYGLVKRIPLMNLEFLNVV 174
              S  +H +L +  I+V +S  S+ ++ +I E Q+++   L+ LVK+IP+M   F+   
Sbjct: 119 ITESLKNHLSLYD--IQVTNSLTSKTSVQIIKEHQKSHGNCLFALVKKIPIMCEGFIGDF 176

Query: 175 SQKVSGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDTSLA--IEAAG 232
             + +  + +FD+ W +I    +  +   + +    + L F+   +         I+A  
Sbjct: 177 VSQFADTQIDFDAKWEQITLKNA-PFLELQTKDAAFKGLNFVVTNQKTFAIYKSIIDAGS 235

Query: 233 GKYSAVLSVEELREAVKRKGDLSNVVILKSHLTPAEELA--------------------P 272
           G       V  L   ++++    NVVIL   +  A  LA                     
Sbjct: 236 GNLWLCGDVSNLGTFIEKQIKSENVVILIHLIEEAPALASEQNNSMHIQEAKLLKNKARS 295

Query: 273 LG-KTFTVQDVVEAILKDEVNSL-----------KNGVIGEVA-KRPEAEVPMEKP--VT 317
           LG KT  V D+V+A+LK+++ SL           +N   G +A  +  A++  + P    
Sbjct: 296 LGFKTRDVNDIVDAVLKNDILSLLDRVPQEKALEENSAGGSIAGSQVLADIVADAPNLRN 355

Query: 318 KKRRLNRPRVKPLDILSFFAGGDSMKESQGESTMKLNSQEEE----------------SK 361
           K++R NR +++PL+ L+FF GG S+ +   + +     Q  E                SK
Sbjct: 356 KRKRANR-QIQPLNSLAFFGGGSSLSQKLEQVSTPAKEQNLELQEGLGVHTNPEVHPLSK 414

Query: 362 DPRKLEDPXXXXXXXXXVLQPEVP----------KEFNEYSKEEPGQKSYEESKADENEK 411
            PR+ ++              E P          +  N  +      K  E +  DE  K
Sbjct: 415 KPREEKNTLHSAGNNSTTTFSETPIHQEDVQIGSEPLNHSAAHSVISKEDESTHTDERNK 474

Query: 412 SLEETVEPTLQVTEPPP-----TSAAEKPNNARPHRKPTLSDYRKGESPSQNDMIQMIQD 466
           +L  + +    VT P        S+    N A+     + +D           +IQ  Q+
Sbjct: 475 TLVNSAKDARTVTFPSIHKNELKSSRTLSNEAKVEGNISHADTEVQAIKRPRSLIQAFQE 534

Query: 467 TKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVXXXXXXXXXXXXSPTVDSHXXXXXX 526
            K HEV RL   +  VG EELTE+AIN+L NL  V                +        
Sbjct: 535 AKQHEVHRLKKNMADVGSEELTEEAINKLDNLASVEKVDLMRRPSEVPENSNQRILTNPQ 594

Query: 527 XXXXXXXXXXXPKYGGQDS-TSREGSSDTIRNRAFLLTRQYVPTRTYTSGDSSKQAQEDL 585
                        +    S +S +  +D +RN+A+L+TR YV    Y  G  +  A +  
Sbjct: 595 WARRKNFKKFVKLWPSHSSRSSPDNITDAVRNKAYLITRDYVSLCPY-DGTRNNSADDGF 653

Query: 586 YDFPEPQPEAQSVPQVEAPG 605
            D  +    A+      +PG
Sbjct: 654 GDACQQHAAAEQSNLTASPG 673

>SAKL0G02552g Chr7 complement(209978..212482) [2505 bp, 834 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 834

 Score =  179 bits (455), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 126/419 (30%), Positives = 205/419 (48%), Gaps = 76/419 (18%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60
           MWILRY+YD EDGN   +SCCL+ G  Y+IGRS+K+ L+IKNDKSISR+H+ +  + K+ 
Sbjct: 1   MWILRYRYDTEDGNWCSISCCLKQGLIYDIGRSTKSPLHIKNDKSISRKHIQLKVN-KEN 59

Query: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQ--- 117
           +L L+N GK+T ++ + L + +S++F    G + +ELG KP+   ++W D +W V     
Sbjct: 60  ELNLLNTGKLTTLNAEVLMVDQSLNFHPK-GQLRLELGIKPIIATIEWQDQVWKVSHDLL 118

Query: 118 -GSRSDHSALEELGIEVLSSELSRANLIVIDEQQN-YSRWLYGLVKRIPLMNLEFLNVVS 175
             S          GI V ++  +R NL +I + Q+ YS  L+ LVK I ++   FL+   
Sbjct: 119 YNSMFKRQEFNSYGISVTTTMSTRTNLQIIKQNQDTYSNCLFSLVKGIDIVRESFLSDFQ 178

Query: 176 QKVSGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKD--EDTSLAIEAAGG 233
             +    T++D IW  ++    + + ++     + QN+  +   K         IE AGG
Sbjct: 179 SHLYMTPTDYDGIWKNLLQ-KHMVFPNFTTCVSIFQNISIIVASKSIYNLFKYTIEVAGG 237

Query: 234 KYSAVLSVEELREAVKRKGDLSNVVILKSHLTPA-------------------EELAP-- 272
           +     ++E+  + ++      +V+ILK H+T A                   EEL    
Sbjct: 238 ELLYCENMEKFEQFIQEAAHSKDVIILK-HITEANLTNDKNSNIDMSEDARKLEELKAAA 296

Query: 273 --LG-KTFTVQDVVEAILKDEVNSLKNGVIGEVAKRPEAE----------------VP-- 311
             LG K   V D+V+A+LK +   L   +  +++ R E +                VP  
Sbjct: 297 ESLGYKLHDVNDLVDAVLKRDPRQLLEKIPTKISFRSEKDLEEPKLPLKIDEFITPVPDK 356

Query: 312 ----------------------MEKPV-TKKRRLNRPRVKPLDILSFFAGGDSMKESQG 347
                                 ME+ +  K++R NR +V+PLD L FFAGG+   +++G
Sbjct: 357 VSETAPFKGQLENSTARNDFEIMEQKIPVKRKRTNRSKVRPLDSLDFFAGGNIQAKNEG 415

 Score = 65.1 bits (157), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 57/113 (50%), Gaps = 1/113 (0%)

Query: 460 MIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVXXXXXXXXXXXXSPTVDS 519
           +++ IQDTK+ EV RL +T+IQ+   ELTE+AIN L NL +V               + S
Sbjct: 575 LVEAIQDTKSREVSRLKNTLIQIDKNELTENAINSLSNLAIVEKKDLIRKNSERGHCISS 634

Query: 520 HXXXXXXXXXXXXXXXXXPKYGGQDSTSREGSSDTIRNRAFLLTRQYVPTRTY 572
                             P+   +++   +G  + ++N AFL+TR+YVP + +
Sbjct: 635 DTCLWEGRKNFKKFIKVQPRRSQRETFDSDG-KNIVKNSAFLITREYVPLKKF 686

>YDR369C Chr4 complement(1215016..1217580) [2565 bp, 854 aa] {ON}
           XRS2Protein required for DNA repair; component of the
           Mre11 complex, which is involved in double strand
           breaks, meiotic recombination, telomere maintenance, and
           checkpoint signaling
          Length = 854

 Score =  178 bits (451), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 127/389 (32%), Positives = 203/389 (52%), Gaps = 56/389 (14%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICW----- 55
           MW++RYQ  LEDG++  +SCCL+  +TY+IGRSSKN L IKNDKSISRQH++  W     
Sbjct: 1   MWVVRYQNTLEDGSISFISCCLQAFKTYSIGRSSKNPLIIKNDKSISRQHITFKWEINNS 60

Query: 56  -DGKDRQLKLINQGKMTAVSEKYLKMGESISFGKS--MGTVLVELGTKPLKMQLQWMDSI 112
            D K   L L+N+GK+T++++K++K+GE+ +   S  + + ++ELGT P++++ +W++ +
Sbjct: 61  SDLKHSSLCLVNKGKLTSLNKKFMKVGETFTINASDVLKSTIIELGTTPIRIEFEWINEV 120

Query: 113 WMVPQGSRSDHSALEELGIEVLSSELSR----ANLIVID---EQQNYSRWLYGLVKRIPL 165
           W +P       + L E GI   S+E+S     ANL++ D    + N  R LY LV  IP+
Sbjct: 121 WNIPPHLTQFRTMLSEYGI---STEISINDIPANLMISDYPKSEDNSIRELYALVSTIPM 177

Query: 166 MNLEFLNVVSQKV---SGHETEFDSIWTKIMNDGSLRYKSWEVQAQV-------LQNLEF 215
               FL  +   +   S    +FD +W  ++++    Y  ++    +       L N+  
Sbjct: 178 KKSRFLMELCNTLLPTSKTNLKFDEMWNDMISNP--EYNVFDFDPNILLSKFMRLNNIRV 235

Query: 216 LTVGKDE-DTSLAIEAAGGKYSAVLSVEELREAVKRKGDLSNVVILKSHLTPAEELAPLG 274
           LT  K E   S  +        A  +++ L + V      +  +IL +  T  +E   + 
Sbjct: 236 LTTIKSEPRLSSLLRTFNINLFAFDNIDSLYKYVDSLEASTEYLILTT--TDKKENGKIL 293

Query: 275 KTF--TVQDVVEAILKDEVN-------SLKNG----------VIGEVAKRPEAEV-PMEK 314
            T    +  +++  L   +N       +L NG           I + ++ PE E  P+  
Sbjct: 294 CTIKTMLTSIIDGTLSAVINMKGASSRTLDNGKFDQISEGMSTILKTSRAPEVEASPV-- 351

Query: 315 PVTKKRRLNRPRVKPLDILSFFAGGDSMK 343
            V+KKR+LNR RV PLD L FFAGG S K
Sbjct: 352 -VSKKRKLNRRRVLPLDSLDFFAGGLSTK 379

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 52/160 (32%), Positives = 77/160 (48%), Gaps = 23/160 (14%)

Query: 451 KGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVX------XX 504
           K +S + +  ++ IQ+TKN EVKR+ STI+++ DEEL+E+AINQL NL +V         
Sbjct: 550 KEKSGTPHAFVEAIQETKNREVKRVKSTIVELKDEELSEEAINQLKNLAIVEPSNNLLRK 609

Query: 505 XXXXXXXXXSPTVDS----------HXXXXXXXXXXXXXXXXXPKYGGQDSTSREGSSDT 554
                    S T +           H                  K  G+++T    SSD 
Sbjct: 610 SFDSEGNKTSRTTEKWENSLMEPEWHKRKNFKTFVKVRPKSKAHKEEGKNNTQ---SSDF 666

Query: 555 IRNRAFLLTRQYVPTRTYTSGDSS----KQAQEDLYDFPE 590
           IRN AFL+TR YVP + Y+  D++     +  ED++   E
Sbjct: 667 IRNAAFLITRNYVPLKKYSKKDTTTKWGTEENEDMFALTE 706

>Kpol_1016.5 s1016 (10036..12474) [2439 bp, 812 aa] {ON}
           (10036..12474) [2439 nt, 813 aa]
          Length = 812

 Score =  174 bits (442), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 194/728 (26%), Positives = 321/728 (44%), Gaps = 131/728 (17%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60
           MW+LRYQY L+DG+++ +SCC+R  ETY +GRSSKN L+++NDKSISRQ +SI WD    
Sbjct: 1   MWVLRYQYSLDDGSVEKISCCIRNEETYYLGRSSKNQLSVRNDKSISRQQISIQWDRDKD 60

Query: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQGSR 120
            + + N GK+T V E+YL  GE++SF      V +++GT P+ + L W        +   
Sbjct: 61  CIMVKNLGKVTMVEERYLSDGETLSFQSKNDLVTMKIGTTPIVVNLSWEVKRCNYMKTDM 120

Query: 121 SDHSALEELGIEVLSSELSRA-NLIVIDEQQNYS-RWL--YGLVKRIPLMNLEFLNVVSQ 176
                L+  G +  + E S + ++I+ ++    S ++L  Y ++    L+N + L  +  
Sbjct: 121 DMVHLLQSYGFQPTTIENSHSLDMIIQNDVTTISDKYLKCYSMIHDTILINSKTLRDILT 180

Query: 177 KVSGHETEFDSIWTKI-MNDGSLRYKSWEVQ--AQVLQNL-------------------- 213
                  +FDS W K+  ++ +++  +  V   A+ L+ +                    
Sbjct: 181 NNIIMTKKFDSYWVKLNSHESNIQNHTINVTKLAKSLKGMHMFLLDPESYNCEYFEKFLE 240

Query: 214 -------EFLTVGKDEDTSLAIEAAGGKYSAVLSVEELREAVKRKGDLSNVVILKSHLTP 266
                  +FL +  D +T L  +  GG++  +LS  +L E   R     ++ +       
Sbjct: 241 EIGCIPRKFLNIN-DLETYLETQFKGGEF-LLLSSAKL-ENQSRLERFISIPLESFLDKL 297

Query: 267 AEELAPLGKTFT-----VQDVVEAILKDEVNSLKNGVIGEVAKRPEAEVPMEK------P 315
                  G++        ++V+E +LK+         +G V +  EA VP+ K      P
Sbjct: 298 LFLDLDFGQSINRSKEESKNVIEPVLKE---------VG-VEQTTEA-VPISKNVEIYEP 346

Query: 316 VTKKRRLNRPRVKPLDILSFFAGGDS------------------------MKESQGESTM 351
             KKRRLNR RVKPLD L+FFAGG +                        + +SQG+  +
Sbjct: 347 QPKKRRLNRSRVKPLDSLNFFAGGVTSIGASQLPLPVEEANNITRKKDKEVIKSQGKGEI 406

Query: 352 KLNSQEEESKDPRKLEDPXXXXXXXXXVLQPEVPKEFNEYSKEEPGQKSYEESKADEN-- 409
            + ++ +ES +   L            V Q ++ K         P  +  ++ K +EN  
Sbjct: 407 NIETEMDESGNGELLSTASEFKKPKSDV-QHKLEKRMQVAIDRSP--EKIKKPKLEENIS 463

Query: 410 -EKSLEETVEPTLQVTEPPPTSAAEKPNNARP-----HRKPTLSDYR-----KGESPSQN 458
            ++ L   V+ T   +     +   K +N +       R+ TL+DY+     + E PS  
Sbjct: 464 IQQLLSNKVKSTSDTSSVLIETQIAKESNTKAIEYGKVRQKTLTDYKHTSDERIERPSV- 522

Query: 459 DMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVXXXXXXXXXXXXS---- 514
           D++  IQD K  E  R+ ++I+++ + ELTE+AIN+  +L +V                 
Sbjct: 523 DLVHAIQDIKERETLRVKTSIVEIKENELTEEAINKFSDLTVVDINTRLFKDKSLDINKP 582

Query: 515 PTVDSHXXXXXXXXXXXXXXXXXPKY-----GGQDSTSREGSSDTIRNRAFLLTRQYVPT 569
              + +                 PKY      GQ + S    S  IRN A L+TR +VP 
Sbjct: 583 ANSNQNNMDWSGKKNFKKFVKMVPKYKRSQGNGQHADS---CSTFIRNSAMLITRNFVPM 639

Query: 570 RTYTSGDSSKQAQEDLYDFP---------EPQPEAQSV-PQVEAP--------GPNNLFV 611
           + Y+  D++  + E + DF          E   EA S    V+ P            LFV
Sbjct: 640 KQYSKLDNNSNSNE-MTDFSNIEVNKKPVEKNREAYSSDDSVDEPSFTFTRNSSSKQLFV 698

Query: 612 MDEDDSQD 619
           MDE  ++D
Sbjct: 699 MDESINED 706

>Skud_4.638 Chr4 complement(1137885..1140416) [2532 bp, 843 aa] {ON}
           YDR369C (REAL)
          Length = 843

 Score =  161 bits (408), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 119/388 (30%), Positives = 191/388 (49%), Gaps = 51/388 (13%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICW----- 55
           MW++RYQ  +EDG++ H+SCCL+  ++Y+IGRSSKN L IKNDKSISRQH++  W     
Sbjct: 1   MWVIRYQNTVEDGHISHISCCLQASKSYSIGRSSKNSLIIKNDKSISRQHITFKWEINGG 60

Query: 56  -DGKDRQLKLINQGKMTAVSEKYLKMGES-ISFGKSMGTV-LVELGTKPLKMQLQWMDSI 112
            + K   L LINQGK+T++++K+LK+GE  I +   +  +  +ELGT P  +++ W+  I
Sbjct: 61  LNLKASHLSLINQGKLTSINKKFLKVGEKFIIYAPEVSNLTTIELGTSPFHIEVAWVSEI 120

Query: 113 WMVPQGSRSDHSALEELGIEVLSS-ELSRANLIVID---EQQNYSRWLYGLVKRIPLMNL 168
           W +P       + L + GI   SS +    NL++ D      N  R LY LV  IPL  L
Sbjct: 121 WNIPSHLTEFRTTLSQFGISTESSIDDGPINLMISDFPSSDDNGMRELYALVNAIPLKKL 180

Query: 169 EFLNVVSQKV---SGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQN--------LEFLT 217
             L  V + +   S    +FD +W  ++N  S  +  +   A VL +        +   T
Sbjct: 181 RLLVDVCKTLLPASVRNLKFDEMWKDVLN--SPEFNVFNFDASVLSSKFMKLNRIIVLTT 238

Query: 218 VGKDEDTSLAIEAAGGKYSAVLSVEELREAVK-RKGDLSNVVILKSHLTPAEELAPLGKT 276
              +   S  +     K     +++ L E V   K  +  +++  ++ T   ++      
Sbjct: 239 TSNERRLSATLRGLNVKLLNFDNMKSLYEHVDGLKPSIKYLILTSTNKTENGQIQ----- 293

Query: 277 FTVQDVVEAILKDEVNSLKN--GVIGEVAKRPEAEVPMEKPVTKKRRLNRPR-------- 326
            T+  ++ ++++D + ++ N   V  E+  +    V  E   T  + L+ P         
Sbjct: 294 CTINGLITSVIEDALPAITNTKSVPCEIQNKKFERVS-EVQSTSSKTLHTPEIEVGPAIL 352

Query: 327 ---------VKPLDILSFFAGGDSMKES 345
                    V+PLD LSFFAGG S K S
Sbjct: 353 KKRRLNRRRVQPLDSLSFFAGGLSSKSS 380

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 86/190 (45%), Gaps = 18/190 (9%)

Query: 408 ENEKSLEETVEPTLQVTEPPPTSAAEKPNNARPHRKPTLSDY---RKGESPSQNDMIQMI 464
           EN KS    +  TL+    PP  + EK + ++  RK  + +    RK  +P     ++ I
Sbjct: 498 ENGKSSTRDIIQTLEENHEPPEQSQEKNSYSQVDRKSPVKELLQKRKSNTPLS--FVEAI 555

Query: 465 QDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVXXXXXXXXXXXXSPTVDSHXXXX 524
           Q+TKN EV+R  STI+Q+ D+EL+E+ INQL NL +V              T        
Sbjct: 556 QETKNREVERFKSTIVQLEDDELSEEGINQLKNLAIVEPNEDLLRKPQILGTNSVRTRAQ 615

Query: 525 XXXX-----------XXXXXXXXXPKYGGQDSTSREGS--SDTIRNRAFLLTRQYVPTRT 571
                                   PK+  Q+  ++  +  SD IR+ AFL+TR YVP R 
Sbjct: 616 KNESGIMRQEWHERKNFKTFIKVWPKFKMQNEGNKGDTQNSDFIRSAAFLITRNYVPLRK 675

Query: 572 YTSGDSSKQA 581
           Y+  + + + 
Sbjct: 676 YSKNNKATEC 685

>Suva_2.541 Chr2 complement(965557..968166) [2610 bp, 869 aa] {ON}
           YDR369C (REAL)
          Length = 869

 Score =  159 bits (402), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 116/382 (30%), Positives = 191/382 (50%), Gaps = 50/382 (13%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKD- 59
           MW++RYQ  LEDG++  +SCCL+  ++Y+IGRSSKN L IKNDKSISRQHV+  W+  D 
Sbjct: 1   MWVIRYQNILEDGSINSISCCLQASKSYSIGRSSKNELVIKNDKSISRQHVTFKWEINDS 60

Query: 60  -----RQLKLINQGKMTAVSEKYLKMGE--SISFGKSMGTVLVELGTKPLKMQLQWMDSI 112
                 +L L+NQGK+T++++K++K+GE  +IS  K      +ELGT P++++ +W+D I
Sbjct: 61  LNPKGNKLSLVNQGKLTSINKKFMKVGETSTISVTKVSNHTEIELGTTPIRIKFEWIDEI 120

Query: 113 WMVPQGSRSDHSALEELGIEVLSS-ELSRANLIVIDEQQNYS---RWLYGLVKRIPLMNL 168
           W +P       + L + GI   +S +   A++++ D   N     R LY LV  IPL   
Sbjct: 121 WNIPSNLAQFQTILSQFGIATKTSIDDDSASILISDFPSNNDDGMRELYALVHTIPLKKS 180

Query: 169 EFLNVVSQKV---SGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDTS 225
           + L  +   +   S    +FD  W  ++N     +K ++    VL + +F+ +    D  
Sbjct: 181 QLLVDLCNSLLSSSVMNLKFDETWNNMVNKP--LFKVFDYDPSVLFS-KFMRL----DNV 233

Query: 226 LAIEAAGGKYSAVLSVEELREAVKRKGDLSNVVILKSHLTPAEELAPLG---------KT 276
           + +   G +      +  L   +     L+++      L P+E+   L          K 
Sbjct: 234 ITLTTIGNESGLPNILRRLNVRLFHFDCLNDLYKHVDLLKPSEKYLILTFTNKRENGQKL 293

Query: 277 FTVQDVVEAILKDEVNSLKN--GVIGEVAKRPEAEVPMEKPVTKKRRLNRPR-------- 326
            T+Q+++ +I+ D + S+ N   V  EV +    E   E      + ++ P         
Sbjct: 294 CTLQNLITSIIDDTLPSVINTKAVPFEVQENNTPEKVFEGHTAISKTVHTPETEATPAVL 353

Query: 327 ---------VKPLDILSFFAGG 339
                    V+PLD L+FFAGG
Sbjct: 354 KKRRLNRRRVQPLDSLNFFAGG 375

 Score = 52.8 bits (125), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 67/149 (44%), Gaps = 13/149 (8%)

Query: 441 HRKPTLSDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVL 500
           H  P      K +S + +  ++ IQ TKN EVKR+ STI+++ D+EL+E+AINQL NL +
Sbjct: 557 HNSPLRELSLKEQSNTPHSFVEAIQQTKNREVKRVKSTIVELEDDELSEEAINQLNNLAI 616

Query: 501 VXXXX-------XXXXXXXXSPTVDSHXXXXXXXXXXXXXXXXXPKYGGQDSTSREG--- 550
           V                   S    S                   K      T +EG   
Sbjct: 617 VEPSNELLRDPRSVGSNRTRSSARRSEKGAIRQEWPKRKNFKTFAKVWPNSKTPKEGDKG 676

Query: 551 ---SSDTIRNRAFLLTRQYVPTRTYTSGD 576
              +SD IR+ AFL+TR YVP + Y+  D
Sbjct: 677 NNQNSDFIRSAAFLITRNYVPLKKYSKKD 705

>TPHA0J02590 Chr10 complement(574619..576946) [2328 bp, 775 aa] {ON}
           Anc_5.435 YDR369C
          Length = 775

 Score =  154 bits (388), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 153/559 (27%), Positives = 262/559 (46%), Gaps = 90/559 (16%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICW----D 56
           M ILRY+  L DG +  VSCCL     Y IGRSSKN   IKNDKSISRQHVS+ W    D
Sbjct: 1   MIILRYKNVLADGPVNVVSCCLLCDVEYAIGRSSKNKFAIKNDKSISRQHVSLLWKYSSD 60

Query: 57  GKDRQLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVP 116
            K+  +++ N GK+T + +KYL   E++ F      + V +GT P+ +++   + +    
Sbjct: 61  DKNVIIQIKNFGKVTMIKDKYLSQDETLQFTLIDKKLEVNIGTSPITLEIFNQEVVCNSI 120

Query: 117 QGSRSDHSALEELGIEVLSSE---LSRANLIVIDEQQNYSRWLYGLVKR---IPLMNLEF 170
           +  ++  S L    + +L  +   L R    +I ++ +Y+  L  L      IP++ +E 
Sbjct: 121 EDIQNSDSKLILNNLNILQDDPLTLKREGPTIIIKENSYTDILLELFSNVFGIPIVTIEE 180

Query: 171 LNVVSQKVSGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLT-VGKDED-TSLAI 228
           L  +      +  +F S W KI +    + K+  +    L    +++ V K  D   +AI
Sbjct: 181 LRGI-----ANANDFYSYWDKIYSRKKNKGKACMLD---LSTCYYISEVDKYVDYVKVAI 232

Query: 229 EAAGGKYSAVLSVEELREAVKR---KGDLSNVVILKSHLTPAEELAPLGKTFT-VQDVVE 284
            +   +   +   ++L + +++   KG++S   +L + +T  EE AP   + T +  ++E
Sbjct: 233 RSLNAEIKILKDKDDLVKDIRKNISKGNISKFFVLSNDITQGEE-APFNISVTSIAKLLE 291

Query: 285 AILKDEVNSLKNGVIGEVA----------KRPEAEVPMEK---PVTKKRRLNRPRVKPLD 331
           A+   + N++K+ V+ + +          K P+ +  +EK   P  K+RR+NR +VKPLD
Sbjct: 292 AV---KTNNMKDIVMHDYSSFKIEIPREVKSPKDDNIIEKQEPPAPKRRRMNRSKVKPLD 348

Query: 332 ILSFFAGGDS-----------------------MKESQGESTMKLNSQEEESKDPR--KL 366
            LSFFAGG S                       +  S+ ES   + S ++++K  +  +L
Sbjct: 349 TLSFFAGGMSHDTHSINTKPSNDVQSHQETEKDVNNSKIESIQDVESNQDQTKYDKSTEL 408

Query: 367 EDPXXXXXXXXXVLQ---PEVPKEFNEYSKEEPGQKSYEESKADENEKSLEETVEPTLQV 423
           +            LQ    E P  FN  +K      S  +   + +  +L+ T+E T +V
Sbjct: 409 QKSKAVSKNADDKLQDSTAEKPINFNPTTKTPSFSPSINDKAIENSNANLDPTMEKT-RV 467

Query: 424 TEPPPT-------------------SAAEKPNNA-RPHRKPTLSDYRKGESPSQNDMIQM 463
            + P +                   + + K N+A    R+ TL DY   +  S  D+++ 
Sbjct: 468 NKKPASLDTKNNLLDNKLIAEQINEALSAKTNDAPVVRRRRTLLDYGNTDKSSSTDLVRT 527

Query: 464 IQDTKNHEVKRLNSTIIQV 482
           IQ+ K+  V R+NS I+ V
Sbjct: 528 IQNVKSRGVDRVNSKIVTV 546

>KNAG0C04900 Chr3 (946975..949284) [2310 bp, 769 aa] {ON} Anc_5.435
           YDR369C
          Length = 769

 Score =  140 bits (353), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 113/381 (29%), Positives = 189/381 (49%), Gaps = 36/381 (9%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSK-NLLNIKNDKSISRQHVSICWDGKD 59
           MWILRY Y+ ED    +VSCCL+    Y+IGRSSK N L IKNDKSISRQH+S  W   D
Sbjct: 1   MWILRYSYESEDHGTVYVSCCLQRSRNYSIGRSSKTNALVIKNDKSISRQHISFQWVSHD 60

Query: 60  RQLKLINQGKMTAVSEKYLKMGES--ISFGKSMGTVLVELGTKPLKMQLQWMDS-IWMVP 116
             + ++N GK+T +++ +LK  E+  IS   S  T  +++G+ P+ + L W D  I M P
Sbjct: 61  -YVDIVNDGKLTYINDAFLKPKETTRISISASKETN-IKVGSAPVIVNLVWEDVFIDMTP 118

Query: 117 QGSRSDHSALEELGIEVLSS------ELSRANLIVIDEQQNYSRWLYGLVKRIP-LMNLE 169
                   +L+ +GI    S      E +   L +  ++  +   L  L++    L   +
Sbjct: 119 ISDTG--QSLKLIGIYPAGSTHGVNIEDAMKTLCIKIKEIKWPHQLIALIRGANRLYKAD 176

Query: 170 FLNVVSQK-VSGHE--TEFDSIWTKIMNDGSLR-YKSWEVQAQVLQNLEFLTV-GKDEDT 224
            +++++Q+ V  +E  + FD IW + ++ G  + Y +++V     ++   +     D D 
Sbjct: 177 LVDLMAQQLVDSNENISSFDEIWNRTVDSGQYKEYPNFKVDRNSFRDFTIIYFDNNDSDI 236

Query: 225 S---LAIEAAGGKYSAVLSVEELREAVKRKGDLSNVVILKSHL----TPAEELAPLGKTF 277
           S     +E  GG   + ++ E   +       L NV++L+S       P  E+       
Sbjct: 237 SGVRSCVEFCGGTLLSFVNNESFEKYASTNETLHNVLLLRSERFQVSHPVYEILNKIDIC 296

Query: 278 TVQDVVEAILKDEVNSLKN---------GVIGEVAKRPEAEVPMEKPVTKKRRLNRPRVK 328
           +     +A+ ++ V++L +          +  +  +RP+  V       KKRRLNR +V+
Sbjct: 297 STGSFFKAVTENNVSTLVHRELFLRRYTDITQKEMRRPKEPVEDTAVPLKKRRLNRRKVQ 356

Query: 329 PLDILSFFAGGDSMKESQGES 349
           PL+ L FFAGGD+   ++  S
Sbjct: 357 PLNPLEFFAGGDTATTTKQSS 377

 Score = 48.5 bits (114), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 35/138 (25%), Positives = 61/138 (44%), Gaps = 11/138 (7%)

Query: 435 PNNARPHRKPTLSDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQ 494
           P +  P R   +   R  +  + + +++ IQ  K++E +RL  T+  V   ELT++AI  
Sbjct: 522 PESLAPSRDTEVLRPRPAKPRNSSSLVETIQSVKDNETRRLQCTLTPVDPSELTDEAIAD 581

Query: 495 LGNLVLVXXXXXXXXXXXXSPTVDSHXXXXXXXXXXXXXXXXXPKYGGQDSTSREGSSDT 554
             N+ +V             P + +                  PK       +R+G +D+
Sbjct: 582 FSNMAIVEPTVNIVRKK---PAMVTESSIRSDRPNFKKFMKVWPK-------ARKG-NDS 630

Query: 555 IRNRAFLLTRQYVPTRTY 572
           +RN A+L+TR YVP + Y
Sbjct: 631 LRNNAYLITRDYVPMKAY 648

>Smik_4.635 Chr4 complement(1135040..1137631) [2592 bp, 863 aa] {ON}
           YDR369C (REAL)
          Length = 863

 Score =  140 bits (353), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 126/398 (31%), Positives = 196/398 (49%), Gaps = 70/398 (17%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICW----- 55
           MW++RYQ  LEDG +  +SCCL+  ++Y+IGRSSKN L IK+DKSISRQH+++ W     
Sbjct: 1   MWVVRYQNILEDGTISVISCCLQASKSYSIGRSSKNPLIIKHDKSISRQHITLKWQSNSG 60

Query: 56  -DGKDRQLKLINQGKMTAVSEKYLKMGESI---SFGKSMGTVLVELGTKPLKMQLQWMDS 111
            D     L LINQGK+T+++ K++K+GE+    + G S  T  +ELG  P++++++W + 
Sbjct: 61  SDSNHNSLCLINQGKLTSINNKFMKVGETFIIEALGVSNST-FIELGATPIRIEVEWKNQ 119

Query: 112 IWMVPQGSRSDHSALEELGIEVLSSELSR----ANLIVID---EQQNYSRWLYGLVKRIP 164
           +W +P       +AL + GI   S+E S      N+++ D      N  R L  L + IP
Sbjct: 120 VWNIPSHLAQFRTALSQFGI---STETSINEVPTNIMISDYPSSDDNVIRELCALAENIP 176

Query: 165 LMNLEFL-NVVSQKVSGHETE--FDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKD 221
           L   + L  + +  +S   T+  FD  W  I+   S  Y  ++    +L    F    K 
Sbjct: 177 LKKSQLLVKLCNTLLSASITDLTFDERWNDIVK--SPEYDVFDANPDLL----FSKFMKL 230

Query: 222 EDTSLAIEAAGGKYSAVLSVEELREAVKRKGDLSNVVILKSH---LTPAEE---LAPLGK 275
            D ++    +   Y   +    LR    +  D  ++  L  H   L P+ +   L  + K
Sbjct: 231 SDITILTTISNEPYLPSI----LRRFNIKLFDFVDINSLYKHVDSLKPSTKYLILTSMNK 286

Query: 276 T------FTVQDVVEAILKDEVNSLKN--GVIGEVAKRPEAEVPMEKP------------ 315
                   T + ++ +++KD + S+ N   V  E    P  E P+  P            
Sbjct: 287 KENGQILCTTKCLLTSLIKDTLASVINTKSVSFEA---PNNETPVRDPEKLSSASKIHHT 343

Query: 316 --------VTKKRRLNRPRVKPLDILSFFAGGDSMKES 345
                   + KKRRLNR RV PLD L+FFAGG ++K S
Sbjct: 344 IETEASPVILKKRRLNRRRVLPLDSLNFFAGGLNVKAS 381

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 106/248 (42%), Gaps = 32/248 (12%)

Query: 394 EEPGQKSYEESKADENEKSLEETVEPTLQVTEPPPTSAAEKPNNARPHRKPTLSDYR--- 450
           E     S EE KA    K+   T  PT  VT+    S  E  N ++    P  +D     
Sbjct: 485 ETAATSSMEEDKA---TKAYSITGHPTHSVTQTSEGSH-ELFNYSQKLSFPLKADLESPV 540

Query: 451 -----KGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVXXXX 505
                + +S + +  +Q IQ TK  EVKR+ STI+++ D+EL+E+AINQL  L +V    
Sbjct: 541 KEVSFREKSSAPHSFVQAIQQTKKREVKRVKSTIVELEDDELSEEAINQLERLAIVEANN 600

Query: 506 XXXXX--XXXSPTVDSHXXXX---------XXXXXXXXXXXXXPKYGGQDSTSREGS--S 552
                       TV S                           PK+  Q   S+  +  S
Sbjct: 601 DLLRKLPDYRLNTVSSSTEKGGNGVIRQEWQRRKNFKTFVKAWPKFKAQKEGSKNDTQKS 660

Query: 553 DTIRNRAFLLTRQYVPTRTYTSGDSSKQAQEDLYDFPEPQPEAQSVPQVEAPGPNNLFVM 612
           D IR  AFL+TR YVP + Y     SK+ +   +D  E   +  ++ ++E  G +N ++ 
Sbjct: 661 DFIRGAAFLITRNYVPLKKY-----SKKNKVTKWD-KEESDDMHALTEMEKIG-SNAYIS 713

Query: 613 DEDDSQDV 620
           D  +S  +
Sbjct: 714 DTTNSTTI 721

>CAGL0A02838g Chr1 complement(297872..300358) [2487 bp, 828 aa] {ON}
           similar to uniprot|P33301 Saccharomyces cerevisiae
           YDR369c XRS2
          Length = 828

 Score =  127 bits (319), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 72/191 (37%), Positives = 103/191 (53%), Gaps = 4/191 (2%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60
           MW+LRY Y  E G +K VSCC+R    Y IGRSSKN L IKNDKSISRQHVS+ W     
Sbjct: 1   MWVLRYSYVEETGEVKKVSCCIRQNVQYTIGRSSKNNLVIKNDKSISRQHVSLKWSSSKN 60

Query: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQGSR 120
            ++L N GK+T  SEKYL   E I++      + + LG  P+K+ L  +D ++ +P    
Sbjct: 61  CIELTNTGKLTKSSEKYLGSNELITYSADETQIEMLLGVAPVKIILSRIDELFDIPNSLS 120

Query: 121 SDHSALEELGIE--VLSSELSRANLIVIDEQQNYSRWLYGLVKRIPLMNLEFLNVVSQKV 178
                LE LGI+  V ++ ++  +LI + +     R L+     I + +   L  +  K+
Sbjct: 121 QFRETLETLGIQISVDNANVNSTSLITVGDFG--YRELFAACNDINIYSSGLLTEICNKL 178

Query: 179 SGHETEFDSIW 189
                 FD+ W
Sbjct: 179 VNDHDNFDAEW 189

 Score = 60.8 bits (146), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 57/199 (28%), Positives = 85/199 (42%), Gaps = 37/199 (18%)

Query: 459 DMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVXXXXXXXXXXXXSPTVD 518
           D+++++Q TK  EVKRL+STI+++ D ELTE+AIN+L +LVLV                +
Sbjct: 552 DIVKLVQTTKESEVKRLSSTIVKIEDSELTEEAINKLNDLVLVEPVADLIRTKSDISANN 611

Query: 519 SHXXXXXXXXXXXXXXXXXPKYGGQDSTSREGSSDTIRNRAFLLTRQYVPTRTY-TSGDS 577
           +                  PKY  + S S E  S  IR    +LTR+++ T+       +
Sbjct: 612 TTQQQWKNRKNFKKFVKICPKYKSEQS-SIESMSRHIRGSGEILTREFLQTKNVPVDYYN 670

Query: 578 SKQAQEDLYDFPEPQPEA--------QSVPQVEAPGPNN--------------------- 608
           S   Q D  D     P+A        Q +P++     N+                     
Sbjct: 671 SHHDQNDFVDEINTAPQANKSNSFVHQILPEIGDENENSFSFTRTAIGNGNNNSANEINN 730

Query: 609 ----LFVMDED--DSQDVA 621
               LFV+D+D  DSQDV 
Sbjct: 731 SNQQLFVVDDDFEDSQDVG 749

 Score = 37.4 bits (85), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 21/25 (84%)

Query: 317 TKKRRLNRPRVKPLDILSFFAGGDS 341
           TKK+R+ R +V+PL+ LSFFAGG S
Sbjct: 344 TKKKRVRRHKVEPLNSLSFFAGGIS 368

>Ecym_4761 Chr4 (1479649..1482045) [2397 bp, 798 aa] {ON} similar to
           Ashbya gossypii AER402C
          Length = 798

 Score =  114 bits (285), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 145/584 (24%), Positives = 258/584 (44%), Gaps = 100/584 (17%)

Query: 1   MWILRYQYDLEDG--NLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGK 58
           MWI + QY  +     L  +S  ++  + Y +GR+SK+ L I +++ +SR H+ +  +  
Sbjct: 1   MWIFKCQYQNQKDPDTLNAISSVIKPDKNYIVGRASKSSLVI-DERGVSRTHLQLKANRN 59

Query: 59  DRQLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQG 118
             ++ L+  G    +  K ++ G S  F      + +E+G+  ++ +L W    + VP  
Sbjct: 60  IIEITLL--GAQLKIGHKTIEKGISCEFHPKQSPLRLEVGSHSIECKLLWTQWEFKVPSD 117

Query: 119 SRSDHSALE----ELGIEV---LSSELSRANLIVIDEQQNYSRWLYGLVKRIPLMNLEFL 171
              ++ AL     +LGI++   LS E S   +     Q++Y ++L+ LVK +PL+ + FL
Sbjct: 118 LEINYIALTKMFVQLGIKIVFSLSKETSHQIVRSRQGQKDYDKYLFALVKGLPLVEVGFL 177

Query: 172 NVVSQKVSGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDTSL--AIE 229
             +S  ++    +F+S   ++  + S+ +  +      L+ L F+   KDE   L   IE
Sbjct: 178 KGISSLLNSDTLKFESKVKELEREFSI-FPEFNPIPNPLKGLYFIVPEKDEFDILKYTIE 236

Query: 230 AAGGKYSAVLSVEELREA-----------VKRKGDLS-----------NVVI-------L 260
             GG     ++ E+  +            +K   ++S           N+++        
Sbjct: 237 VGGGTVYNCITFEDFVKVTSTIPSSKVILIKCSNNISPAIDTQKPTDHNILLEKAHSIGF 296

Query: 261 KSHLTPAEELAPLGKTFTVQDVVEAI-------------LKDEVNSLKNGVIGEVAKRPE 307
           K H T    +A L   F    +  +I             LK    SL++G+   V+    
Sbjct: 297 KQHDTRELTIAVLNNNFEETLIDSSISDKRLISCNSNDKLKTTSTSLEDGLKVNVSATSG 356

Query: 308 AEVPMEKPVTKKRRLNRPRVKPLDILSFFAGGDSMKESQGESTMKLNSQEEESKDPRKLE 367
             +  E P  KKRR+N   VKPLD LSFFAGG   + ++ E     NS E+++  P +  
Sbjct: 357 LNLNTEGPPAKKRRIN--SVKPLDSLSFFAGGSIERSTRVER----NSSEKQTVQPAEHN 410

Query: 368 DPXXXXXXXXXVLQPE---------VPKEFNE------YSKEEPGQ-KSYEESKADENEK 411
                      +L  +         VP+  NE        K  P + +S  + +A +N  
Sbjct: 411 KIAETSIASIELLPTKSGIKEITDVVPETENEPEPMVSPKKRSPAKNESLADMRAGDNHV 470

Query: 412 SL------EETVEPT---LQVTEPPPTSAAEKPNNARPH-----RKPTLSDYRKGESPSQ 457
           S+      E++ EP+   L+V E       E  N  + H     +  TLS      + S 
Sbjct: 471 SIKTTLEVEKSAEPSHKKLKV-EGIFDEKVEMSNEQKYHLNAESKDSTLS------TQSH 523

Query: 458 NDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLV 501
           + ++  I++ K  EV R+ +TI+++G +ELTE+AI +L  L +V
Sbjct: 524 SSIVNAIKEIKEREVSRIKTTIVEIGPDELTEEAICKLSTLAVV 567

>KLLA0E02201g Chr5 complement(205466..207973) [2508 bp, 835 aa] {ON}
           weakly similar to uniprot|P33301 Saccharomyces
           cerevisiae YDR369C XRS2 classified as an early
           recombination function required for DNA repair but
           dispensable for mitotic recombination (xrs2 is hyper-Rec
           during vegatative growth) required for double strand
           breaks meiotic recombination and spore viability DNA
           repair protein
          Length = 835

 Score =  113 bits (283), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 91/367 (24%), Positives = 176/367 (47%), Gaps = 34/367 (9%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDR 60
           MWI+ + +D E      V   L+ G  Y+IGRS+K    I+ DKSISR H+ I +DG D 
Sbjct: 1   MWIVSFIFDDEAEKSHKVCKALQYGVEYSIGRSAKCTFRIQTDKSISRVHLLIKFDGSD- 59

Query: 61  QLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQGSR 120
            L + N+GK+T  +E+ + + E+I         ++ +G  P+ + +++    W +P    
Sbjct: 60  -LIITNKGKLTKFNEEIIPLDETIVVHNQ--NTVINIGGMPIDVNVRYFYEEWKIPHRLE 116

Query: 121 SDH--SALEELGIEVLSSELSRANLIVIDEQQNYSRWLYGLVKRIPLMNLEFLNVVSQKV 178
            +   S + + G+++  S   +    +  +  +YS  L+ L+K +P++++EFLN + + +
Sbjct: 117 LNETKSLVSDFGVKLSESFSKKTTTQICSDSSSYSGCLFALLKGVPVVSIEFLNQMGKLL 176

Query: 179 -SGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDTSL--AIEAAGGKY 235
             G+  +F S++  ++N   L + S+     VL N+  +   +    +L   IE  GG  
Sbjct: 177 QQGNYLDFQSMYQGLLNRHKL-FPSYRYVPNVLSNMTLIVFEQKMYDTLRYTIEVGGGDA 235

Query: 236 SAVLSVEELREAVKRKGDLSNVVILKSHLTP-----------------AEELAPLG-KTF 277
             + +  EL + +    + +  V+L S ++                  AE     G K  
Sbjct: 236 KLLANSSELDKFLSTNHEPA--VVLGSSISQKMNSESTKLLEEFDKSIAETSLRHGVKLL 293

Query: 278 TVQDVVEAILKDEVNSLKN-GVIGEVAKRPEAEVPMEKP---VTKKRRLNRPRVKPLDIL 333
            +   V  +L++++N LK   V+   +  P  +  ++     V  K+  ++P ++ LD L
Sbjct: 294 NINQFVNILLENKINGLKKRDVVDLTSPSPVQQKKIQSAKASVNGKKTKSKPNIQSLDSL 353

Query: 334 SFFAGGD 340
           +FF GG+
Sbjct: 354 NFFGGGN 360

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 32/57 (56%), Gaps = 4/57 (7%)

Query: 437 NARPHRKPTL-SDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAI 492
           ++RPH    L +D    +  S  ++I  I +TK  EVKRL   II+V   ELTE A+
Sbjct: 573 DSRPHSVARLETDL---QVRSSTNIITAIAETKQKEVKRLQEGIIEVDQSELTESAL 626

>AER402C Chr5 complement(1407938..1410547) [2610 bp, 869 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR369C
           (XRS2)
          Length = 869

 Score =  108 bits (269), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 108/418 (25%), Positives = 186/418 (44%), Gaps = 74/418 (17%)

Query: 1   MWILR--YQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGK 58
           MW+ +  YQ   + G L+++SC L     + +GR+SK+ L I+ +K +SR H+ +  +  
Sbjct: 1   MWVFKCNYQKSGQLGALQNISCALCPEREFIVGRASKSTLVIE-EKGVSRTHLRL--EVI 57

Query: 59  DRQLKLINQGKMTAVSEKYLKMGESISFGKSMGTVLVELGTKPLKMQLQWMDSIWMVPQG 118
           D  + ++  G    V  +    G  + FG S   V++E+G+  ++  L+W    + VP  
Sbjct: 58  DDHVNILLLGSQLKVGGEDASKGSVLPFGPSQSPVILEVGSHSVQCILEWAQWEFKVPNT 117

Query: 119 SRSDHSALEE----LGIEVLSSELSRANLIVI----DEQQNYSRWLYGLVKRIPLMNLEF 170
              +  AL E    LGI V++S  S+A    I    ++ Q+Y ++L+ LVK IP+++LEF
Sbjct: 118 LLQEDPALLEVIKGLGIRVVTS-FSKATTHHIIRPHEDDQDYEKYLFALVKGIPILHLEF 176

Query: 171 LNVVSQKVSGHETEFDSIWTKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDTSL---A 227
           L   +  +    T+FD     I  +    ++ +  +A  L  L F+ V +  D  +    
Sbjct: 177 LKQFTALLRQPVTDFDPQLRSI-QEQHYAFRGFTKKAADLNGLHFI-VNRKHDFEMLKYT 234

Query: 228 IEAAGGKYSAVLSVEELREAVKRKGDLSNVVILKSHLTPAEELAPLGKT----------- 276
           +E  GG       + +L   +K    ++  + LK     + E+  +  T           
Sbjct: 235 LEIGGGTVHFCHDINDLSACLKTI-PINGALALKYDHGISAEVKKVDDTRYCEVLHSHGI 293

Query: 277 --FTVQDVVEAILKDEVNSLKNGVIGEVAKRPEAEVPMEKPV------------------ 316
             FTV ++ +AIL D++  L       ++KRP   + + +PV                  
Sbjct: 294 QLFTVHELTKAILYDKLAQL-------LSKRPPTMMKLVEPVPSTISQTQEMKQESLSPI 346

Query: 317 --------------TKKRRLNRPRVKPLDILSFFAGGDSMKESQGESTMKLNSQEEES 360
                           ++RL +P  +PLD LSFFAGG S + S    T  L  QE  S
Sbjct: 347 SLGNTTIKDLPRKDKTRKRLKKP--QPLDSLSFFAGGLSRQNSSIGGTADLVKQESMS 402

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/73 (39%), Positives = 45/73 (61%), Gaps = 10/73 (13%)

Query: 430 SAAEKPNNARPHRK-PTLSDYRKGESPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELT 488
           +++EKP N+   R+ P +        P QN ++  I+  K  EV R+ +TI+++G EELT
Sbjct: 577 TSSEKPVNSCKRRQAPAV--------PEQN-IVDAIKQIKEREVNRIRTTIVELGPEELT 627

Query: 489 EDAINQLGNLVLV 501
           EDAI QL +L +V
Sbjct: 628 EDAIRQLKSLAIV 640

>TBLA0A02820 Chr1 (678796..681573) [2778 bp, 925 aa] {ON} Anc_5.435
           YDR369C
          Length = 925

 Score =  100 bits (249), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 79/248 (31%), Positives = 127/248 (51%), Gaps = 20/248 (8%)

Query: 1   MWILRYQYDLEDGNLKHVSCCLRLGETYNIGRSSKNLLNIKNDKSISRQHVSICWDG-KD 59
           MWI+ Y Y   D  L +VSCCL+  ETY+IGRS K+ L +KNDKSISRQHV+  W G  +
Sbjct: 1   MWIISYSYKSADDTLTNVSCCLKQNETYSIGRSKKSPLFVKNDKSISRQHVTFHWTGNLN 60

Query: 60  RQLKLINQGKMTAVSEKYLKMGESISFGKSM-GTVLVELGTKPLKMQLQWMDSIWMVPQG 118
            QL L+NQGK+T V+ + L   E++ F   +     VELG  P+ +   W + ++ +P  
Sbjct: 61  NQLSLLNQGKLTRVNSRILNPAETLLFNADIEHPAEVELGATPVVVCGAWTNHVYNIPIE 120

Query: 119 SRSDHSALEELGIEV-LSSELSRANLIVIDEQ-----QNY--SRWLYGLVKRIPLMNLEF 170
            +   S L++ G  +    + + A   VID +      N+      Y LV +  ++   F
Sbjct: 121 FQQFESQLKDYGFNINFGPQKNEAITYVIDIEPRPMNNNFISGTLYYSLVNKSIILKSSF 180

Query: 171 ----LNVVSQKVSGHETEFDSIW--TKIMNDGSLRYKSWEVQAQVLQNLEFLTVGKDEDT 224
               LN+++  V+    +F ++   +KI +  ++  +S +V+   ++    L V  D  T
Sbjct: 181 LTSLLNLLNPNVTTFNIDFQNLLDASKIEDFRNINLESLKVELTGIK----LIVLNDNTT 236

Query: 225 SLAIEAAG 232
            L    A 
Sbjct: 237 DLIYFIAA 244

 Score = 64.3 bits (155), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 65/140 (46%), Gaps = 7/140 (5%)

Query: 454 SPSQNDMIQMIQDTKNHEVKRLNSTIIQVGDEELTEDAINQLGNLVLVXXXXXXXXX--X 511
           SP+ N+ I  +QD KN E  RL S  +++ DEELTE+AIN+  NL +V            
Sbjct: 603 SPTPNNFISALQDAKNRETDRLGSKFVKIYDEELTEEAINKFSNLAVVETNVDIVISEGK 662

Query: 512 XXSPTVDSHXXXXXXXXXXXXXXXXXPKYGGQDSTSRE-GSSDTIRNRAFLLTRQYVPTR 570
             + ++                    PKY  +   S + G +  IRN AFLL R+YVP +
Sbjct: 663 KNNESITDIDPKWKGRKNFKNFVKQLPKYRMKTMPSGDNGVASFIRNSAFLLAREYVPMQ 722

Query: 571 TYTSGDSSKQAQEDLYDFPE 590
            +   +   + QE    FPE
Sbjct: 723 EFKMNNQGNRIQE----FPE 738

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 24/44 (54%), Positives = 29/44 (65%), Gaps = 4/44 (9%)

Query: 313 EKPVTKKRRLNRPRVKPLDILSFFAGGDSMKE----SQGESTMK 352
           EKP  K+RRLNR RV+PLD L FF GG++       SQ ES +K
Sbjct: 376 EKPPVKRRRLNRKRVQPLDSLHFFVGGNTNPTQNNLSQTESDLK 419

>Skud_5.121 Chr5 complement(186243..188531) [2289 bp, 762 aa] {ON}
           YER017C (REAL)
          Length = 762

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 24  LGETYNIGRSSKNLLNIKNDKSISRQHVSICWDGKDRQLKLINQGKMTAVSEKYLKMGES 83
           LG  +N+G+S   L N + D  IS ++V+ C + K   ++ ++  K  A   KY K+G  
Sbjct: 265 LGGMFNVGKSKAKLFNKETDIKISFKNVAGCDEAKQEIMEFVHFLKNPA---KYTKLGAK 321

Query: 84  ISFG 87
           I  G
Sbjct: 322 IPRG 325

>Ecym_6486 Chr6 complement(941694..944039) [2346 bp, 781 aa] {ON}
           similar to Ashbya gossypii ABL203W
          Length = 781

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 7/70 (10%)

Query: 414 EETVEPTLQVTEPPPTSAAEKPNNARPHRKPTLSDYRKGESPSQNDMIQMIQDTKNHEVK 473
           E+  + + Q+TEP PTS ++ P +  P+   T          SQN  I  +     HEV+
Sbjct: 604 EDNADQSSQLTEPVPTSYSQVPASTTPNVMTT-------TEASQNGYIPGVNKISTHEVR 656

Query: 474 RLNSTIIQVG 483
               TI   G
Sbjct: 657 HYYLTIFGTG 666

>KAFR0D04080 Chr4 complement(804693..806534) [1842 bp, 613 aa] {ON}
           Anc_1.54 YDR506C
          Length = 613

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 30/67 (44%), Gaps = 1/67 (1%)

Query: 562 LTRQYVPTRTYTSGDSSKQAQEDLYDFPE-PQPEAQSVPQVEAPGPNNLFVMDEDDSQDV 620
           +T+ Y  TR Y  G SS    +D+ +  E P      +     P  N +F +DE   +  
Sbjct: 341 ITKNYYFTRKYHRGKSSNVGDKDIINIKELPNFSRNELLHEFIPLHNEMFKLDEKTIKSS 400

Query: 621 ALEEPEK 627
            L+EP K
Sbjct: 401 LLKEPSK 407

>Suva_5.109 Chr5 complement(165063..167348) [2286 bp, 761 aa] {ON}
           YER017C (REAL)
          Length = 761

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 28  YNIGRSSKNLLNIKNDKSISRQHVSICWDGKDRQLKLINQGKMTAVSEKYLKMGESISFG 87
           +N+G+S   L N + D  IS ++V+ C + K   ++ ++  K  A   KY K+G  I  G
Sbjct: 268 FNVGKSKAKLFNKETDIKISFKNVAGCDEAKQEIMEFVHFLKNPA---KYTKLGAKIPRG 324

>Smik_5.138 Chr5 complement(194172..196454) [2283 bp, 760 aa] {ON}
           YER017C (REAL)
          Length = 760

 Score = 32.3 bits (72), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 19/60 (31%), Positives = 32/60 (53%), Gaps = 3/60 (5%)

Query: 28  YNIGRSSKNLLNIKNDKSISRQHVSICWDGKDRQLKLINQGKMTAVSEKYLKMGESISFG 87
           +N+G+S   L N + D  IS ++V+ C + K   ++ ++  K  A   KY K+G  I  G
Sbjct: 266 FNVGKSRAKLFNKETDIKISFRNVAGCDEAKQEIMEFVHFLKNPA---KYTKLGAKIPRG 322

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.129    0.361 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 67,138,839
Number of extensions: 2943797
Number of successful extensions: 11681
Number of sequences better than 10.0: 185
Number of HSP's gapped: 11714
Number of HSP's successfully gapped: 257
Length of query: 660
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 544
Effective length of database: 40,180,143
Effective search space: 21857997792
Effective search space used: 21857997792
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)