Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F10032g5.434ON31031016330.0
TBLA0A02825singletonON31130811131e-153
TDEL0E019105.434ON31130911081e-152
Kpol_1062.295.434ON31131010671e-146
Suva_8.1735.434ON31230910671e-146
CAGL0I01100g5.434ON31031010571e-145
Skud_15.2835.434ON31230910551e-144
Smik_15.2985.434ON31231010521e-144
YOR120W (GCY1)5.434ON31230910441e-143
Suva_2.5405.434ON31230910351e-141
YDR368W (YPR1)5.434ON31230910291e-140
SAKL0G02530g5.434ON31231010251e-140
Smik_4.6345.434ON31230910221e-139
Skud_4.6375.434ON31230910161e-138
KNAG0C049105.434ON31330910131e-138
NDAI0C016005.434ON31330910121e-138
CAGL0A02816g5.434ON31031010021e-136
KLTH0E15532gsingletonON3093019981e-136
NCAS0H020605.434ON3223109971e-135
TBLA0A02835singletonON3113099751e-132
KLLA0B14707gsingletonON3103109721e-132
Kwal_47.18084na 1ON3093079711e-132
TBLA0A065105.434ON3123089701e-131
NDAI0B056705.434ON3183189651e-131
TPHA0G00210singletonON3113109611e-130
TPHA0E017605.434ON3103109321e-126
KAFR0E038405.434ON3103079301e-125
KAFR0E03850singletonON3113099271e-125
TDEL0D00230singletonON3123129121e-123
KLTH0A03476gna 1ON3083069051e-122
KLTH0E00220gsingletonON3063059021e-121
KLTH0A00528gsingletonON3063059021e-121
NCAS0F033805.434ON3133118971e-120
KLLA0D10109gsingletonON3093118751e-117
KLTH0F16060g5.434ON3092948741e-117
Kwal_55.214265.434ON3082958381e-111
AER401W5.434ON3133088271e-110
NDAI0A070003.108ON3202965532e-68
SAKL0C10626gsingletonON3222955159e-63
KAFR0G013503.108ON3243015123e-62
KNAG0K020703.108ON3233025011e-60
NCAS0I024203.108ON3202964862e-58
KLTH0C10010g3.108ON3212934802e-57
KLLA0F02728g3.108ON3302974761e-56
Ecym_55085.409ON3263084707e-56
Kwal_56.226113.108ON3212974671e-55
TDEL0D051603.108ON3252904602e-54
SAKL0C09922g3.108ON3222884567e-54
ZYRO0B06138g3.108ON3282984514e-53
YBR149W (ARA1)3.108ON3443024516e-53
KNAG0B03780singletonON3263274498e-53
Smik_2.289singletonON3443004473e-52
KLTH0F16610g5.409ON3293084453e-52
TBLA0A00630singletonON3283104444e-52
KLLA0F03256g7.468ON2852784406e-52
ACL107C5.409ON3543134448e-52
Suva_4.3983.108ON3443024438e-52
Smik_2.2883.108ON3442984402e-51
Skud_2.2763.108ON3443024394e-51
TDEL0E021505.409ON3293294351e-50
KLLA0E21627g5.409ON3293084315e-50
CAGL0I01122g5.409ON3263084289e-50
NCAS0A066605.409ON3263254262e-49
ZYRO0A06336g5.409ON3273274262e-49
Kwal_47.182197.468ON2932874214e-49
SAKL0F14278g7.468ON2862764205e-49
NDAI0D016005.409ON3273324236e-49
SAKL0G01914g5.409ON3293124211e-48
Kpol_1013.827.468ON2852774144e-48
Kwal_55.215365.409ON3293094174e-48
Skud_8.1655.409ON3273084132e-47
KAFR0C05320singletonON3273084132e-47
Suva_15.3005.409ON3273084113e-47
KLTH0G05786g7.468ON2862734083e-47
TBLA0F01720singletonON3263064097e-47
TPHA0E018605.409ON3263064088e-47
Ecym_7160na 2ON2712794031e-46
CAGL0C04543g7.468ON2872734032e-46
YJR096W7.468ON2822804022e-46
YHR104W (GRE3)5.409ON3273084053e-46
KLTH0F01892gna 3ON3022863963e-45
Smik_10.3847.468ON2822803919e-45
Smik_8.1825.409ON3273083941e-44
KNAG0D013707.468ON2822753874e-44
Kwal_47.18893na 4ON2892853874e-44
Skud_10.3187.468ON2822703841e-43
NCAS0H005607.468ON2842753823e-43
Suva_12.1847.468ON2822803781e-42
Kwal_33.13276na 3ON3022923781e-42
KLTH0G02420gna 4ON2892863772e-42
KAFR0G009207.468ON2862763744e-42
SAKL0F02574gna 4ON2892903736e-42
ZYRO0G17600g7.468ON2832883711e-41
KLLA0F05775g7.285ON3093033721e-41
TDEL0C033207.468ON2832823692e-41
ABL209Cna 2ON3102733545e-39
Smik_4.1137.285ON3123063521e-38
NCAS0A137407.285ON3093123502e-38
TDEL0D02790singletonON3293113442e-37
YDL124W7.285ON3123013372e-36
CAGL0J09394g7.285ON3113053363e-36
Skud_4.1317.285ON3123023338e-36
Kpol_1020.137.285ON3132963311e-35
NDAI0A023007.285ON3133083251e-34
SAKL0F09746g7.285ON3123213242e-34
Kpol_381.8singletonON3092753214e-34
KNAG0C041107.285ON3113103214e-34
KLTH0G00638gna 5ON3133053171e-33
ZYRO0C09196g7.285ON3123033127e-33
KAFR0B012007.285ON3153263101e-32
Kwal_47.19278na 5ON3143323093e-32
ZYRO0E09614gna 5ON3083082995e-31
TBLA0F019807.285ON3022892979e-31
SAKL0F00704gna 5ON3153232882e-29
Ecym_32647.285ON3112242847e-29
Kwal_33.13274singletonON1081021622e-13
Suva_4.1227.285ON2061791295e-08
Suva_12.272singletonON2652061281e-07
Suva_9.17singletonON3081951084e-05
TPHA0H00110singletonON3452921022e-04
Kpol_400.9singletonON341283988e-04
Ecym_22962.604ON340148970.001
TDEL0A08000singletonON319136960.001
TBLA0G01120singletonON343315960.002
Smik_3.208singletonON344288940.003
Kpol_449.4singletonON341233930.004
TBLA0E05040singletonON342308900.008
NCAS0C02450singletonON343286890.013
Skud_3.179singletonON344288870.018
Skud_16.1958.565ON342185870.022
KLTH0E01474gsingletonON313194850.035
NCAS0A129502.604ON323156850.037
Smik_16.1498.565ON342186840.051
Kwal_26.83772.604ON33881830.066
KAFR0F03890singletonON319307820.075
SAKL0H09438g8.565ON342267800.14
KAFR0D04230singletonON342165800.16
ZYRO0F00858g2.604ON34688800.16
SAKL0C14058gsingletonON315157770.31
KAFR0J00220singletonON343305760.40
TBLA0F00680singletonON212134730.74
SAKL0E00286gsingletonON338284740.81
KAFR0C03670singletonON343182740.87
TDEL0C06010singletonON344326740.91
TDEL0F00160singletonON504109731.2
SAKL0E00264gsingletonON31580721.3
Kwal_47.193133.578ON1071140721.7
Skud_13.2202.631ON50164703.1
NDAI0J01200singletonON42735694.0
CAGL0B01969g8.284ON42362684.2
KLLA0B09658g3.462ON34262675.3
KLTH0G00990g3.555ON53229668.1
Suva_16.2248.565ON342182668.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F10032g
         (310 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON} uniprot...   633   0.0  
TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}     433   e-153
TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON...   431   e-152
Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON...   415   e-146
Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W (...   415   e-146
CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}...   411   e-145
Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W...   410   e-144
Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W...   409   e-144
YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putati...   406   e-143
Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W (...   403   e-141
YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}  YPR1NADPH...   400   e-140
SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar...   399   e-140
Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W...   398   e-139
Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W...   395   e-138
KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON...   394   e-138
NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON...   394   e-138
CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly ...   390   e-136
KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa] ...   389   e-136
NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434     388   e-135
TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}     380   e-132
KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa] ...   379   e-132
Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {O...   378   e-132
TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {...   378   e-131
NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5....   376   e-131
TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON}                 374   e-130
TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON...   363   e-126
KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON...   362   e-125
KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON}     361   e-125
TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible ...   355   e-123
KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {O...   353   e-122
KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}...   352   e-121
KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}...   352   e-121
NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434     350   e-120
KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar...   341   e-117
KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa] ...   341   e-117
Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {O...   327   e-111
AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic h...   323   e-110
NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {...   217   2e-68
SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar...   202   9e-63
KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.10...   201   3e-62
KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {O...   197   1e-60
NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON...   191   2e-58
KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar...   189   2e-57
KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar...   187   1e-56
Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar ...   185   7e-56
Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {O...   184   1e-55
TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON...   181   2e-54
SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar...   180   7e-54
ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {O...   178   4e-53
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...   178   6e-53
KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON}               177   8e-53
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...   176   3e-52
KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa] ...   176   3e-52
TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON}     175   4e-52
KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly ...   174   6e-52
ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON} S...   175   8e-52
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...   175   8e-52
Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W ...   174   2e-51
Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W ...   173   4e-51
TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON...   172   1e-50
KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa] ...   170   5e-50
CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly si...   169   9e-50
NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON}             168   2e-49
ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {O...   168   2e-49
Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W...   166   4e-49
SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highl...   166   5e-49
NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON}               167   6e-49
SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly ...   166   1e-48
Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {...   164   4e-48
Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {O...   165   4e-48
Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W (...   163   2e-47
KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {...   163   2e-47
Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W...   162   3e-47
KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {O...   161   3e-47
TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON}     162   7e-47
TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON...   161   8e-47
Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to...   159   1e-46
CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly ...   159   2e-46
YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative xy...   159   2e-46
YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose ...   160   3e-46
KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar...   157   3e-45
Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W...   155   9e-45
Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W (...   156   1e-44
KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON...   153   4e-44
Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR09...   153   4e-44
Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W...   152   1e-43
NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON} ...   151   3e-43
Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W...   150   1e-42
Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W...   150   1e-42
KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {O...   149   2e-42
KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON...   148   4e-42
SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {O...   148   6e-42
ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highl...   147   1e-41
KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly ...   147   1e-41
TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.46...   146   2e-41
ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON} Synt...   140   5e-39
Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W (...   140   1e-38
NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {...   139   2e-38
TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON}     137   2e-37
YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-depend...   134   2e-36
CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} simila...   134   3e-36
Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W (...   132   8e-36
Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON} (27790.....   132   1e-35
NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285     129   1e-34
SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {O...   129   2e-34
Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..2178...   128   4e-34
KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.28...   128   4e-34
KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar t...   126   1e-33
ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {O...   124   7e-33
KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.28...   124   1e-32
Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa] ...   123   3e-32
ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {O...   119   5e-31
TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.28...   119   9e-31
SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar t...   115   2e-29
Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON} ...   114   7e-29
Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W...    67   2e-13
Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [...    54   5e-08
Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795...    54   1e-07
Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)     46   4e-05
TPHA0H00110 Chr8 (10204..11241) [1038 bp, 345 aa] {ON}                 44   2e-04
Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON} ...    42   8e-04
Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}...    42   0.001
TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON}              42   0.001
TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {O...    42   0.002
Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W ...    41   0.003
Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON} (14334..15...    40   0.004
TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON}             39   0.008
NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {O...    39   0.013
Skud_3.179 Chr3 (292171..293205) [1035 bp, 344 aa] {ON} YPL088W ...    38   0.018
Skud_16.195 Chr16 (353315..354343) [1029 bp, 342 aa] {ON} YPL088...    38   0.022
KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {O...    37   0.035
NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {...    37   0.037
Smik_16.149 Chr16 (265088..266116) [1029 bp, 342 aa] {ON} YPL088...    37   0.051
Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C...    37   0.066
KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON}      36   0.075
SAKL0H09438g Chr8 (803426..804454) [1029 bp, 342 aa] {ON} highly...    35   0.14 
KAFR0D04230 Chr4 complement(833614..834642) [1029 bp, 342 aa] {O...    35   0.16 
ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar ...    35   0.16 
SAKL0C14058g Chr3 (1248968..1249915) [948 bp, 315 aa] {ON} conse...    34   0.31 
KAFR0J00220 Chr10 complement(37107..38138) [1032 bp, 343 aa] {ON}      34   0.40 
TBLA0F00680 Chr6 (175497..176135) [639 bp, 212 aa] {ON}                33   0.74 
SAKL0E00286g Chr5 complement(13788..14804) [1017 bp, 338 aa] {ON...    33   0.81 
KAFR0C03670 Chr3 complement(747792..748823) [1032 bp, 343 aa] {O...    33   0.87 
TDEL0C06010 Chr3 complement(1082207..1083241) [1035 bp, 344 aa] ...    33   0.91 
TDEL0F00160 Chr6 (17872..19386) [1515 bp, 504 aa] {ON}                 33   1.2  
SAKL0E00264g Chr5 complement(12234..13181) [948 bp, 315 aa] {ON}...    32   1.3  
Kwal_47.19313 s47 complement(1186091..1189306) [3216 bp, 1071 aa...    32   1.7  
Skud_13.220 Chr13 (372489..373994) [1506 bp, 501 aa] {ON} YMR064...    32   3.1  
NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON}              31   4.0  
CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {...    31   4.2  
KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {...    30   5.3  
KLTH0G00990g Chr7 (71533..73131) [1599 bp, 532 aa] {ON} highly s...    30   8.1  
Suva_16.224 Chr16 (392092..393120) [1029 bp, 342 aa] {ON} YPL088...    30   8.2  

>ZYRO0F10032g Chr6 (813814..814746) [933 bp, 310 aa] {ON}
           uniprot|Q9HGX9 Zygosaccharomyces rouxii ZGCY2 Glycerol
           dehydrogenase
          Length = 310

 Score =  633 bits (1633), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/310 (100%), Positives = 310/310 (100%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGE 60
           MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGE
Sbjct: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGE 60

Query: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTEN 120
           VGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTEN
Sbjct: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTEN 120

Query: 121 IKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180
           IKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA
Sbjct: 121 IKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180

Query: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240
           PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN
Sbjct: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240

Query: 241 GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCY 300
           GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCY
Sbjct: 241 GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCY 300

Query: 301 QDFSPFPIFQ 310
           QDFSPFPIFQ
Sbjct: 301 QDFSPFPIFQ 310

>TBLA0A02825 Chr1 complement(681691..682626) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  433 bits (1113), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 207/308 (67%), Positives = 247/308 (80%), Gaps = 2/308 (0%)

Query: 4   LQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGK 63
           L+N T+T+KLNTG  IP +GLGTWRS+ N+GY +VI A K GYRHID AA+YGNE +VGK
Sbjct: 5   LKNCTATVKLNTGANIPAIGLGTWRSENNDGYDSVIAAAKVGYRHIDTAAIYGNEDQVGK 64

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKD 123
           AI + GV R+E+F+TTKLW TQQR+P+ AL+QSL+RLGLDYVDLYLIHWPV  +T+ IKD
Sbjct: 65  AINECGVTRSELFVTTKLWGTQQRDPETALNQSLKRLGLDYVDLYLIHWPVAFKTDTIKD 124

Query: 124 GNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPT 182
           GNL    +K DG  D+D  EWNFIKTWELMQ LL++GKTKAIG+SNFS+NN+K+LLAAPT
Sbjct: 125 GNLLTIPKK-DGEADIDYPEWNFIKTWELMQNLLKTGKTKAIGISNFSINNIKELLAAPT 183

Query: 183 TKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGV 242
           T VTPA NQVE+HPLLPQ++LI F KE GIVIEAYSPLGG NAP+L D T+ EIAK N V
Sbjct: 184 TTVTPACNQVEVHPLLPQDELIAFCKEKGIVIEAYSPLGGINAPVLKDETIIEIAKRNNV 243

Query: 243 EAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQD 302
           +AG VV SW VQ+G V LPKSV  SRI+ NLK  TLSD D+ K++ L+K KGE RTC   
Sbjct: 244 DAGQVVTSWHVQRGYVVLPKSVKESRIISNLKTFTLSDDDMTKINNLVKVKGENRTCDLG 303

Query: 303 FSPFPIFQ 310
              FP+FQ
Sbjct: 304 IKGFPMFQ 311

>TDEL0E01910 Chr5 complement(361621..362556) [936 bp, 311 aa] {ON}
           Anc_5.434 YOR120W
          Length = 311

 Score =  431 bits (1108), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 199/309 (64%), Positives = 250/309 (80%)

Query: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61
            TL N+TST+KLNTG TIPQVGLGTWRSKE +GYKAV  ALKAGYRHIDGAA+Y NE EV
Sbjct: 3   ATLSNNTSTVKLNTGYTIPQVGLGTWRSKEGDGYKAVTAALKAGYRHIDGAAIYLNEEEV 62

Query: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           GKAI+DSG+PR E+F+TTKLW TQQRNPQEAL+QSL+RLGL+YVDLYL+HWPVPL+T+ I
Sbjct: 63  GKAIRDSGIPREELFITTKLWNTQQRNPQEALEQSLERLGLEYVDLYLMHWPVPLKTKRI 122

Query: 122 KDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181
            DGNL     K DG  DVD EW+F+KTWELMQ+L ++ K +++GVSNFS+NNLK+LLA+P
Sbjct: 123 TDGNLLSSPAKEDGKPDVDTEWDFVKTWELMQELPKTKKARSVGVSNFSINNLKELLASP 182

Query: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241
             K+ PAV QVE+HPLLPQ  L  F KE+ I +EAYSPLGG  AP+L DP +++IA  + 
Sbjct: 183 GNKLVPAVLQVEIHPLLPQYALCDFCKEHNIQVEAYSPLGGHGAPVLDDPIIKQIADRHN 242

Query: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQ 301
            +AG+VV+SW VQ+G+VTLPKS TP R+V NL+   LSD ++  ++ L K++G++RT   
Sbjct: 243 ADAGNVVVSWGVQRGIVTLPKSTTPERVVSNLRTFKLSDEEMGSINNLSKSRGQKRTNAP 302

Query: 302 DFSPFPIFQ 310
           D SPFP+F+
Sbjct: 303 DMSPFPLFE 311

>Kpol_1062.29 s1062 complement(63895..64830) [936 bp, 311 aa] {ON}
           complement(63895..64830) [936 nt, 312 aa]
          Length = 311

 Score =  415 bits (1067), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 198/310 (63%), Positives = 246/310 (79%), Gaps = 2/310 (0%)

Query: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61
           ++L+N  + +KLNTG  +P VGLGTW+S EN+ YKAV+ ALK GYRHIDGAA+Y NEGEV
Sbjct: 1   MSLKNCETRVKLNTGAELPAVGLGTWQSLENDAYKAVLTALKTGYRHIDGAAIYCNEGEV 60

Query: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           GKAI+DSGVPRNEIF+TTKLW TQQR PQ AL+QSL+RLGLDYVDLYLIHWP+PL     
Sbjct: 61  GKAIRDSGVPRNEIFVTTKLWGTQQRTPQLALEQSLERLGLDYVDLYLIHWPIPLNPAQC 120

Query: 122 KD-GNLFQFAEKPDGSKDVDLE-WNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLA 179
           ++ GN   F   P+G +DVDL+ WNF+KTWELMQ+L  +GK KA+GVSNFS+NN+K+LL+
Sbjct: 121 EESGNYLTFPGLPNGKRDVDLDTWNFVKTWELMQELPATGKCKAVGVSNFSINNIKELLS 180

Query: 180 APTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKA 239
           +P  K+ PAVNQ+ELHPLLPQ +L+ F KE GIV+EAYSPLGG  A IL +P V+E+AK 
Sbjct: 181 SPGNKLVPAVNQIELHPLLPQVELVNFCKEKGIVVEAYSPLGGTGAAILKEPLVEELAKK 240

Query: 240 NGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTC 299
             + A ++V+SW VQ+G+V LPKSVT SRI+ NL+ LTL+  DV K+  L K KGE+RTC
Sbjct: 241 YNIPAANLVVSWDVQRGVVVLPKSVTESRIISNLQTLTLAPEDVEKITNLSKEKGEKRTC 300

Query: 300 YQDFSPFPIF 309
             DFSPF  F
Sbjct: 301 APDFSPFNTF 310

>Suva_8.173 Chr8 (308911..309849) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  415 bits (1067), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 199/309 (64%), Positives = 239/309 (77%), Gaps = 1/309 (0%)

Query: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG 62
           TLQ ST TL LNTG  IPQVGLGTW+SK+N+ YK+V+ ALK GYRHID AA+YGNE +VG
Sbjct: 4   TLQYSTKTLPLNTGAKIPQVGLGTWQSKDNDAYKSVVAALKDGYRHIDTAAIYGNEDQVG 63

Query: 63  KAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIK 122
           +AI+DSGVPR EIF+TTKLWCTQ   P +ALDQSL+RLGLDYVDLYL+HWPV L    IK
Sbjct: 64  QAIKDSGVPREEIFVTTKLWCTQHHEPAKALDQSLKRLGLDYVDLYLMHWPVRLDPNYIK 123

Query: 123 DGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181
           DG++     K DGS+ VD+  WNFIKTWELMQ+L ++ KT+A+GVSNFS+NNLKDLLA+P
Sbjct: 124 DGHILSIPTKEDGSRPVDITNWNFIKTWELMQELPKTNKTRAVGVSNFSINNLKDLLASP 183

Query: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241
             ++TPA NQVELHPLLPQ +LI F K  GI++EAYSPLG  +AP+L +P V EIAK N 
Sbjct: 184 GNQLTPAANQVELHPLLPQNELIDFCKSKGIMVEAYSPLGSTDAPLLKEPVVLEIAKKNN 243

Query: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQ 301
           V+ GHVVISW  Q+G V LPKSV P RI  N KV TLSD D   ++ + K KGE+R    
Sbjct: 244 VQPGHVVISWHAQRGYVVLPKSVNPDRIKTNRKVFTLSDEDFEAINNISKEKGEKRVVNP 303

Query: 302 DFSPFPIFQ 310
           D+SPF  F+
Sbjct: 304 DWSPFEAFK 312

>CAGL0I01100g Chr9 complement(91693..92625) [933 bp, 310 aa] {ON}
           highly similar to uniprot|P14065 Saccharomyces
           cerevisiae YOR120w GCY1 or uniprot|Q12458 Saccharomyces
           cerevisiae YDR368w YPR1
          Length = 310

 Score =  411 bits (1057), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 199/310 (64%), Positives = 237/310 (76%), Gaps = 2/310 (0%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGE 60
           M  L  +TSTLKLNTG  IP +GLGTW+S ENEGY A +EALKAGYRHID AA+Y NE E
Sbjct: 1   MAALHKNTSTLKLNTGAHIPVIGLGTWQSSENEGYNATLEALKAGYRHIDTAAIYKNEEE 60

Query: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTEN 120
           +G+AI+DS +PRNE+F+TTKLW TQ RNP EALDQSL+RLGLDYVDLYL+HWPV L+T+ 
Sbjct: 61  IGRAIRDSNIPRNELFVTTKLWGTQHRNPTEALDQSLKRLGLDYVDLYLMHWPVALKTDL 120

Query: 121 IKDGNLFQFAEKPDGSKDVDLE-WNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLA 179
           IKDGNL Q  E+ DGS+DVDLE WNF+KTWELMQ+L +  K +AIGVSNFS+NNLK+LL 
Sbjct: 121 IKDGNLLQIPEREDGSRDVDLEDWNFVKTWELMQELPKE-KARAIGVSNFSINNLKELLN 179

Query: 180 APTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKA 239
           +   KV PA NQ+E+HPLLPQ++LI F KE GIV+EAYSPLG  +APIL +  + EIAK 
Sbjct: 180 SKGNKVVPAANQIEIHPLLPQDELINFCKEKGIVLEAYSPLGSTDAPILKEEEITEIAKK 239

Query: 240 NGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTC 299
           NGV AG +VISW  Q+G V LPKSV P RI GN +   LSD D A +    K  GERR  
Sbjct: 240 NGVNAGQLVISWHAQRGYVVLPKSVKPERIHGNQETFKLSDEDFATLSNYAKKHGERRVV 299

Query: 300 YQDFSPFPIF 309
             ++ PF  F
Sbjct: 300 SPNWGPFKPF 309

>Skud_15.283 Chr15 (507542..508480) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  410 bits (1055), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 194/309 (62%), Positives = 240/309 (77%), Gaps = 1/309 (0%)

Query: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG 62
           TLQ+ST TL LNTG  IPQVGLGTW+SK+N+ YK+V+ ALK GYRHID AA+Y NE +VG
Sbjct: 4   TLQDSTRTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKDGYRHIDTAAIYRNEDQVG 63

Query: 63  KAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIK 122
           +AI+DSGVPR +IF+TTKLWCTQ   P +ALDQSL+RLGLDYVDLYL+HWPV L  + IK
Sbjct: 64  QAIRDSGVPREKIFVTTKLWCTQHHEPAKALDQSLRRLGLDYVDLYLMHWPVRLDPDYIK 123

Query: 123 DGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181
           DGN+     K DGS+ VD+  WNFIKTWELMQ+L ++GK KA+GVSNFS+NNLKDLLA+ 
Sbjct: 124 DGNILSVPTKQDGSRAVDITNWNFIKTWELMQELPKTGKAKAVGVSNFSINNLKDLLASK 183

Query: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241
             K+TPA NQVE+HPLLPQ +LI F +  GI+IE YSPLG  +AP+L +P + EIAK N 
Sbjct: 184 GNKLTPAANQVEIHPLLPQNELIDFCRGKGIMIEGYSPLGSTDAPLLKEPVILEIAKKNN 243

Query: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQ 301
           V+  HVVISW  Q+G V LPKSV P R+  N K+ TLSD D   ++G+ KAKGE+R  + 
Sbjct: 244 VQPAHVVISWHAQRGYVVLPKSVNPDRVKANRKIFTLSDEDFEAINGISKAKGEKRVVHP 303

Query: 302 DFSPFPIFQ 310
           ++SPF  F+
Sbjct: 304 NWSPFEAFK 312

>Smik_15.298 Chr15 (512239..513177) [939 bp, 312 aa] {ON} YOR120W
           (REAL)
          Length = 312

 Score =  409 bits (1052), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 196/310 (63%), Positives = 239/310 (77%), Gaps = 1/310 (0%)

Query: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61
            TL +ST TL LNTG  IPQVGLGTW+SK+N+ YK+V+ ALKAGY+HID AA+Y NE +V
Sbjct: 3   TTLHDSTKTLSLNTGAQIPQVGLGTWQSKDNDAYKSVLAALKAGYKHIDTAAIYRNEDQV 62

Query: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           G+AI+DSGVPR EIF+TTKLW TQ   P +ALD+SLQRLGLDYVDLYLIHWP  L T  I
Sbjct: 63  GQAIKDSGVPREEIFVTTKLWSTQHHEPAKALDESLQRLGLDYVDLYLIHWPARLDTNYI 122

Query: 122 KDGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180
           KDG++     K DGS+ VD+  WNFIKTWELMQ+L ++GKTKAIGVSNFS+NNLKDLLA+
Sbjct: 123 KDGDILSVPTKADGSRAVDVTNWNFIKTWELMQELPKTGKTKAIGVSNFSINNLKDLLAS 182

Query: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240
           P  K+TPA NQVE+HPLLPQ +LI F K   I+IEAYSPLG  +AP+L +PT+ +IAK N
Sbjct: 183 PGNKLTPAANQVEIHPLLPQNELINFCKSKKIMIEAYSPLGSTDAPLLKEPTILKIAKKN 242

Query: 241 GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCY 300
            V+ GHVVISW  Q+G V LPKSV P RI  N K+ TLS+ D   ++ + K KGE+R   
Sbjct: 243 NVQPGHVVISWHAQRGYVVLPKSVNPDRIETNRKIFTLSNEDFEAINNISKEKGEKRVVN 302

Query: 301 QDFSPFPIFQ 310
            ++SPF  F+
Sbjct: 303 PNWSPFEAFK 312

>YOR120W Chr15 (551114..552052) [939 bp, 312 aa] {ON}  GCY1Putative
           NADP(+) coupled glycerol dehydrogenase, proposed to be
           involved in an alternative pathway for glycerol
           catabolism; also has mRNA binding activity; member of
           the aldo-keto reductase (AKR) family
          Length = 312

 Score =  406 bits (1044), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 193/309 (62%), Positives = 238/309 (77%), Gaps = 1/309 (0%)

Query: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG 62
           TL +ST  L LNTG  IPQ+GLGTW+SKEN+ YKAV+ ALK GYRHID AA+Y NE +VG
Sbjct: 4   TLHDSTKILSLNTGAQIPQIGLGTWQSKENDAYKAVLTALKDGYRHIDTAAIYRNEDQVG 63

Query: 63  KAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIK 122
           +AI+DSGVPR EIF+TTKLWCTQ   P+ ALDQSL+RLGLDYVDLYL+HWP  L    IK
Sbjct: 64  QAIKDSGVPREEIFVTTKLWCTQHHEPEVALDQSLKRLGLDYVDLYLMHWPARLDPAYIK 123

Query: 123 DGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181
           + ++     K DGS+ VD+  WNFIKTWELMQ+L ++GKTKA+GVSNFS+NNLKDLLA+ 
Sbjct: 124 NEDILSVPTKKDGSRAVDITNWNFIKTWELMQELPKTGKTKAVGVSNFSINNLKDLLASQ 183

Query: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241
             K+TPA NQVE+HPLLPQ++LI F K  GIV+EAYSPLG  +AP+L +P + EIAK N 
Sbjct: 184 GNKLTPAANQVEIHPLLPQDELINFCKSKGIVVEAYSPLGSTDAPLLKEPVILEIAKKNN 243

Query: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQ 301
           V+ GHVVISW VQ+G V LPKSV P RI  N K+ TLS  D   ++ + K KGE+R  + 
Sbjct: 244 VQPGHVVISWHVQRGYVVLPKSVNPDRIKTNRKIFTLSTEDFEAINNISKEKGEKRVVHP 303

Query: 302 DFSPFPIFQ 310
           ++SPF +F+
Sbjct: 304 NWSPFEVFK 312

>Suva_2.540 Chr2 (964433..965371) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  403 bits (1035), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 185/309 (59%), Positives = 240/309 (77%), Gaps = 1/309 (0%)

Query: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG 62
           TL+NS++TLKLNTG +IP +G GTWRS +N GY +VI ALKAGYRHID AA+Y NE EVG
Sbjct: 4   TLKNSSATLKLNTGASIPVLGFGTWRSVDNSGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63

Query: 63  KAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIK 122
           KAI+DSGVPR EIF+TTKLW T+QR+P+ ALD+SL+RLGLDYVDLYL+HWPVPL+T+ I 
Sbjct: 64  KAIKDSGVPREEIFITTKLWGTEQRDPEAALDKSLKRLGLDYVDLYLMHWPVPLKTDTIT 123

Query: 123 DGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181
           DG+        DG+ DVD  EWNF+KTW+LMQKL ++GKTKA+GVSNFS+NN+K+LL +P
Sbjct: 124 DGDFLCIPTLEDGTIDVDTKEWNFVKTWDLMQKLPKTGKTKAVGVSNFSINNIKELLKSP 183

Query: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241
           + K+ PA NQ+E+HPLLPQ++LI F KE GIV+EAYSP G  NAP+L +  + ++AK +G
Sbjct: 184 SNKLVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243

Query: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQ 301
           VE   ++ISW++Q+G V L KSV P R+V N K+ TL + D   +  L K  GE+R    
Sbjct: 244 VEPAQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKTISNLSKVHGEKRVVNM 303

Query: 302 DFSPFPIFQ 310
            ++ FPIF+
Sbjct: 304 QWNSFPIFE 312

>YDR368W Chr4 (1213904..1214842) [939 bp, 312 aa] {ON}
           YPR1NADPH-dependent aldo-keto reductase, reduces
           multiple substrates including 2-methylbutyraldehyde and
           D,L-glyceraldehyde, expression is induced by osmotic and
           oxidative stress; functionally redundant with other
           aldo-keto reductases
          Length = 312

 Score =  400 bits (1029), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 185/309 (59%), Positives = 238/309 (77%), Gaps = 1/309 (0%)

Query: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG 62
           TL+NS++TLKLNTG +IP +G GTWRS +N GY +VI ALKAGYRHID AA+Y NE EVG
Sbjct: 4   TLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63

Query: 63  KAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIK 122
           +AI+DSGVPR EIF+TTKLW T+QR+P+ AL++SL+RLGLDYVDLYL+HWPVPL+T+ + 
Sbjct: 64  RAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTDRVT 123

Query: 123 DGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181
           DGN+       DG+ D+D  EWNFIKTWELMQ+L ++GKTKA+GVSNFS+NN+K+LL +P
Sbjct: 124 DGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELLESP 183

Query: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241
             KV PA NQ+E+HPLLPQ++LI F KE GIV+EAYSP G  NAP+L +  + ++AK +G
Sbjct: 184 NNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243

Query: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQ 301
           VE   ++ISW++Q+G V L KSV P RIV N K+ TL + D   +  L K  G +R    
Sbjct: 244 VEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRVVDM 303

Query: 302 DFSPFPIFQ 310
            +  FPIFQ
Sbjct: 304 KWGSFPIFQ 312

>SAKL0G02530g Chr7 (208952..209890) [939 bp, 312 aa] {ON} similar to
           uniprot|Q12458 Saccharomyces cerevisiae YDR368W YPR1
           2-methylbutyraldehyde reductase may be involved in
           isoleucine catabolism
          Length = 312

 Score =  399 bits (1025), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 186/310 (60%), Positives = 238/310 (76%), Gaps = 1/310 (0%)

Query: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61
           + L+NS++T+KLNTG  IPQ+GLGTWRS + E Y +V+ A+K GYRHID AA+YGNE  V
Sbjct: 3   IQLKNSSATVKLNTGAIIPQLGLGTWRSSDEEAYNSVLSAIKLGYRHIDSAAIYGNEEPV 62

Query: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           GKAI+DSGVPRNE+F+TTKLW TQQRNP++ALD SL+RLGLDYVDLYLIHWP+  +T+NI
Sbjct: 63  GKAIRDSGVPRNELFVTTKLWGTQQRNPEKALDASLKRLGLDYVDLYLIHWPIAFKTDNI 122

Query: 122 KDGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180
           KD +        DG  DVD+ +WNF+KTWEL+Q+L  +GK KA+GVSNFSVNNLK+LLA+
Sbjct: 123 KDDDYLTVPTGKDGKADVDVKDWNFVKTWELVQELPATGKAKAVGVSNFSVNNLKELLAS 182

Query: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240
           P  K+ PA NQVELHPLLPQ++LI+F K  GIVIEAYSPLG   +P+L +P + E+AK  
Sbjct: 183 PGNKLVPACNQVELHPLLPQDELIEFSKSKGIVIEAYSPLGSNGSPLLKEPVIIEVAKKY 242

Query: 241 GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCY 300
           GVE   V+I+W +Q+G V LPKSV P R+  N KV  LS  DV ++  + K +G +R  +
Sbjct: 243 GVEPAQVLINWGIQRGYVILPKSVNPKRVESNFKVFDLSKEDVDRIHKISKEQGVKRFVH 302

Query: 301 QDFSPFPIFQ 310
            D+  FPIF+
Sbjct: 303 PDWPSFPIFE 312

>Smik_4.634 Chr4 (1133924..1134862) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  398 bits (1022), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 185/309 (59%), Positives = 238/309 (77%), Gaps = 1/309 (0%)

Query: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG 62
           TL+NS+++LKLNTG +IP +G GTWRS EN GY +VI ALKAGYRHID AA+Y NE EVG
Sbjct: 4   TLKNSSASLKLNTGASIPVLGFGTWRSVENNGYHSVIAALKAGYRHIDAAAIYLNEEEVG 63

Query: 63  KAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIK 122
           +AI+DSGVPR +IF+TTKLW T+QR+P+ AL++SL+RLGLDYVDLYL+HWPVPL+TE I 
Sbjct: 64  RAIKDSGVPREDIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTETIT 123

Query: 123 DGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181
           DGN+       DG+ DVD  EWNFIKTW+LMQ+L ++GKTKA+GVSNFS+NN+K LL +P
Sbjct: 124 DGNVLCIPTLDDGTVDVDTREWNFIKTWDLMQELPKTGKTKAVGVSNFSINNIKALLESP 183

Query: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241
           + K+ PA NQ+E+HPLLPQ +LI F KE GIV+EAYSP G  NAP+L +  + ++AK +G
Sbjct: 184 SNKLVPAANQIEIHPLLPQNELIAFCKEKGIVVEAYSPFGSVNAPLLEEQAIIDMAKKHG 243

Query: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQ 301
           V    ++ISW++Q+G V L KSV P RIV N K+ TL + D   +  L K  GE+R    
Sbjct: 244 VAPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKIISNLSKVHGEKRVVDM 303

Query: 302 DFSPFPIFQ 310
            +S FPIF+
Sbjct: 304 KWSSFPIFK 312

>Skud_4.637 Chr4 (1136769..1137707) [939 bp, 312 aa] {ON} YDR368W
           (REAL)
          Length = 312

 Score =  395 bits (1016), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 180/309 (58%), Positives = 239/309 (77%), Gaps = 1/309 (0%)

Query: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG 62
           TL+NS++TLKLNTG +IP +G GTWRS +N GY +VI ALK GYRHID AA+Y NE EVG
Sbjct: 4   TLRNSSATLKLNTGASIPALGFGTWRSVDNNGYHSVIAALKTGYRHIDAAAIYLNEEEVG 63

Query: 63  KAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIK 122
           +AI+DSG+ R EIF+TTKLW T+QR+P+ AL++SL+RLGLDYVDLYL+HWPVPL+T+ + 
Sbjct: 64  RAIKDSGIAREEIFITTKLWGTEQRDPEAALNESLKRLGLDYVDLYLMHWPVPLKTDTVT 123

Query: 123 DGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181
           DGN+       DG+ DVD  EWNFIKTW+LMQ+L ++GKT+A+GVSNFS+NN+K+LL +P
Sbjct: 124 DGNVLCIPTLEDGTVDVDTKEWNFIKTWDLMQELPKTGKTRAVGVSNFSINNIKELLKSP 183

Query: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241
           + K+ PA NQVE+HPLLPQ++LI F KE GIV+EAYSP G  NAP+L +  + ++AK +G
Sbjct: 184 SNKLVPATNQVEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAKKHG 243

Query: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQ 301
           VE   ++ISW++Q+G V L KSV P R+V N K+ TL + D   +  L K  GE+R    
Sbjct: 244 VEPSQLIISWSIQRGYVVLAKSVNPERVVSNFKIFTLPEDDFKAIGDLSKVHGEKRVVNM 303

Query: 302 DFSPFPIFQ 310
            ++ FPIF+
Sbjct: 304 KWASFPIFE 312

>KNAG0C04910 Chr3 complement(949367..950308) [942 bp, 313 aa] {ON}
           Anc_5.434 YOR120W
          Length = 313

 Score =  394 bits (1013), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 189/309 (61%), Positives = 233/309 (75%), Gaps = 2/309 (0%)

Query: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRSKE-NEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61
           TL  +TS LKLNTG TI  +GLGTWRS    + Y +VI AL+AGYRHID AA+YGNE EV
Sbjct: 4   TLSKNTSLLKLNTGATIRAIGLGTWRSAAATDAYDSVIAALRAGYRHIDTAAIYGNEAEV 63

Query: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           G+AI++SGVPR EIF+TTKLWCTQ + P+ ALDQSL+RLGLDYVDLYL+HWPV +R EN+
Sbjct: 64  GRAIRESGVPRGEIFVTTKLWCTQHKEPELALDQSLKRLGLDYVDLYLMHWPVRMRGENM 123

Query: 122 KDGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180
            +G+   F   P+G +D+D+ +WNF+KTWELMQKL E+GKT+AIGVSNFS+NNLKDLLA+
Sbjct: 124 PEGDKIGFPTLPNGKRDIDITDWNFVKTWELMQKLPETGKTRAIGVSNFSINNLKDLLAS 183

Query: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240
           P  K+ PA NQVE+HPLLPQ++L+ F    GIVIEAYSPLG  +APIL +P + EIAK N
Sbjct: 184 PGNKIVPAANQVEMHPLLPQQELVDFCHGKGIVIEAYSPLGSADAPILKEPVIIEIAKKN 243

Query: 241 GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCY 300
           GV A  VVISW VQ+G + LPKSV   RI  NL   TL+  D   V+ + K +G +R   
Sbjct: 244 GVSAAQVVISWNVQRGYIVLPKSVNKERIEANLLTFTLTSEDFEAVNNISKVQGTKRIID 303

Query: 301 QDFSPFPIF 309
            D+ PF  F
Sbjct: 304 PDWEPFKPF 312

>NDAI0C01600 Chr3 complement(342011..342952) [942 bp, 313 aa] {ON}
           Anc_5.434
          Length = 313

 Score =  394 bits (1012), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 191/309 (61%), Positives = 238/309 (77%), Gaps = 2/309 (0%)

Query: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRS-KENEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61
           TL+NST+T KLNTG TIP VGLGTW+S  ENEGY+AV+ ALKAGYRHID AA+Y NE +V
Sbjct: 4   TLKNSTATYKLNTGATIPAVGLGTWQSTNENEGYEAVMNALKAGYRHIDTAAIYKNEDQV 63

Query: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           GKAI DSG+PR EIF+TTKLW TQ R+P+ AL+QSL+RLGLDYVDLYL+HWPV  + ++I
Sbjct: 64  GKAINDSGIPREEIFVTTKLWGTQHRDPETALNQSLERLGLDYVDLYLMHWPVAFKPDSI 123

Query: 122 KDGNLFQFAEKPDGSKDVDLE-WNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180
           KDGN       P+G +D+DL  WNF+KTWELMQ+L ++GKT+A+GVSNFS+NNLK LL++
Sbjct: 124 KDGNYSTMPMLPNGQRDLDLTTWNFVKTWELMQELPKTGKTRAVGVSNFSINNLKALLSS 183

Query: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240
           P  K+ PA NQVE HPLLPQ++L KF KE GI++EAYSPLG  NAPIL++P + EIAK +
Sbjct: 184 PGNKLVPAANQVEAHPLLPQDELQKFCKEKGIILEAYSPLGSTNAPILTEPKIIEIAKKH 243

Query: 241 GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCY 300
            V+   VVISW VQKG V LPKSV   RI  N +   LS  ++  ++ L K KGERR   
Sbjct: 244 NVQPAQVVISWHVQKGHVVLPKSVHEERIKANFQTFELSKDEMDSLNNLSKEKGERRIVQ 303

Query: 301 QDFSPFPIF 309
            +++PF  F
Sbjct: 304 PNWAPFVPF 312

>CAGL0A02816g Chr1 (296851..297783) [933 bp, 310 aa] {ON} highly
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368w YPR1
          Length = 310

 Score =  390 bits (1002), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 182/310 (58%), Positives = 233/310 (75%), Gaps = 1/310 (0%)

Query: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61
           ++L+NST+TLKLNTG  IP VGLGTWRS  N+GY +V+ ALK GYRHID AA+YGNE +V
Sbjct: 1   MSLKNSTATLKLNTGAEIPVVGLGTWRSAANDGYDSVLAALKLGYRHIDAAAIYGNEDQV 60

Query: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           G+AI+DSGVPR EIF+TTKLW T+ RNP +ALD SL+RLGLDYVDLYL+HWPV L+    
Sbjct: 61  GRAIKDSGVPRQEIFITTKLWGTEHRNPAKALDSSLKRLGLDYVDLYLMHWPVALKAHGS 120

Query: 122 KDGNLFQFAEKPDGSKDVDLE-WNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180
           ++ +L    +KPDG  D+D+E W+FIKTWELMQ+L ++GKTKAIGVSNFS+NNLK L  +
Sbjct: 121 EEKDLLNIPKKPDGKTDIDIEDWDFIKTWELMQELPKTGKTKAIGVSNFSINNLKALKNS 180

Query: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240
           P     PA NQVE+HPL PQ +LI++ K   I+IEAYSP G  +AP+L +P + ++A+  
Sbjct: 181 PKFNTVPAANQVEIHPLFPQTELIEYCKSENILIEAYSPFGSADAPVLKEPELHKLAEKY 240

Query: 241 GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCY 300
            +    ++ISW+VQ+G V LPKSV   RI  NLKVLTL D D+  +  L K KGE+R   
Sbjct: 241 NISTAQLIISWSVQRGYVVLPKSVHAERIEANLKVLTLKDEDMETITNLSKVKGEKRLVQ 300

Query: 301 QDFSPFPIFQ 310
            D+SPFP F+
Sbjct: 301 LDWSPFPTFE 310

>KLTH0E15532g Chr5 complement(1380466..1381395) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  389 bits (998), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 182/301 (60%), Positives = 231/301 (76%)

Query: 6   NSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAI 65
           NS++  KL TG TIP +G GTWRS E +GY AV+ ALK GYRHID AAVYGNE  VG+AI
Sbjct: 6   NSSAVGKLRTGATIPLLGFGTWRSTEEDGYNAVLTALKVGYRHIDTAAVYGNEAAVGRAI 65

Query: 66  QDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKDGN 125
           +DSGVPR+++F+TTKLW TQ R+P+ ALDQSLQRLGLDYVDLYLIHWP+PLRT+ I DGN
Sbjct: 66  RDSGVPRDQLFVTTKLWNTQHRDPRLALDQSLQRLGLDYVDLYLIHWPLPLRTQRITDGN 125

Query: 126 LFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPTTKV 185
           LF    K DG  DVD +W+++KTWE+MQ L ++ KT+A+GVSNFSV  L++LLAA  TKV
Sbjct: 126 LFTVPTKEDGKPDVDEQWSYVKTWEMMQDLPDTSKTRAVGVSNFSVTQLQNLLAASGTKV 185

Query: 186 TPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGVEAG 245
            PAVNQVE HPLLPQ+ L KF  EN I++EAYSPLG + +P++ +P V+EIA  +  +  
Sbjct: 186 IPAVNQVETHPLLPQDKLYKFCSENNILLEAYSPLGSQGSPLVEEPAVKEIASKHNADPA 245

Query: 246 HVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQDFSP 305
            V+ISW +++G V LPKSVTPSRI  N K++ L+D D AK++ + K KGE+R    D+  
Sbjct: 246 QVLISWGIKRGYVILPKSVTPSRIESNFKIVDLTDDDFAKINNIHKEKGEKRINDPDWFH 305

Query: 306 F 306
           F
Sbjct: 306 F 306

>NCAS0H02060 Chr8 (400615..401583) [969 bp, 322 aa] {ON} Anc_5.434
          Length = 322

 Score =  388 bits (997), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 184/310 (59%), Positives = 236/310 (76%), Gaps = 2/310 (0%)

Query: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRS-KENEGYKAVIEALKAGYRHIDGAAVYGNEGE 60
           ++  NST+T KLNTG TI  VGLGTW+S  ENEGY+AVI ALKAGYRHID AA+YGNEG+
Sbjct: 12  MSASNSTTTFKLNTGATISAVGLGTWQSTNENEGYEAVIAALKAGYRHIDTAAIYGNEGQ 71

Query: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTEN 120
           VGKAI DSGVPR EIF+TTKLW TQ  +P   L+ SL+RLGLDYVDLYL+HWPV L   +
Sbjct: 72  VGKAINDSGVPREEIFVTTKLWSTQHHDPAAGLNDSLKRLGLDYVDLYLMHWPVTLNPRS 131

Query: 121 IKDGNLFQFAEKPDGSKDVDLE-WNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLA 179
           IKDGN       PDG +DV+++ W+++KTWELMQ+L ++GKT+A+GVSNFS+NNLK +L+
Sbjct: 132 IKDGNFLSIPLLPDGKRDVEIDTWDYVKTWELMQELPKTGKTRAVGVSNFSINNLKKVLS 191

Query: 180 APTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKA 239
           +P  KV PAVNQVE+HPLLPQE+L+++    GI++EAYSPLG  NAPIL++P +  +AK 
Sbjct: 192 SPGNKVVPAVNQVEIHPLLPQEELLEWCHSKGILLEAYSPLGSTNAPILTEPVLINLAKK 251

Query: 240 NGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTC 299
           +GV+   +VISW VQ+G + LPKSV   RI  N K L LSD ++ +++ + K KGERR  
Sbjct: 252 HGVQTAQIVISWHVQRGYIVLPKSVHAERIQANFKTLKLSDEEMREINNISKEKGERRIV 311

Query: 300 YQDFSPFPIF 309
              + PF  F
Sbjct: 312 QPHWEPFVPF 321

>TBLA0A02835 Chr1 complement(683118..684053) [936 bp, 311 aa] {ON}
          Length = 311

 Score =  380 bits (975), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 182/309 (58%), Positives = 239/309 (77%)

Query: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61
           VTL+N T T+ LN G  IP +GLGT+ SK+NE Y+AV+ A KAGYRH+D AA Y NE +V
Sbjct: 3   VTLKNCTETITLNNGTKIPVIGLGTYLSKQNEVYEAVVTAAKAGYRHVDTAAFYKNEEQV 62

Query: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           GKA++D GVPR+E+++TTK+W T+ R+P+ ALD+SL+RLGL+Y+DLYL+HWPV L+T+ I
Sbjct: 63  GKAVKDCGVPRSEMYVTTKVWPTELRDPEAALDKSLKRLGLEYIDLYLMHWPVTLKTDTI 122

Query: 122 KDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181
           KDG L      PDG+ DVD +W F++ WE MQKLL+SGK K+IGVSNFS+NN+K+LLAAP
Sbjct: 123 KDGELMCIPRLPDGNADVDKDWTFVQAWEAMQKLLKSGKVKSIGVSNFSINNIKELLAAP 182

Query: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241
           TT V P VNQVE+ PLLP ++LI+F +   I+ +AY P GG  AP++ D TV EIAK NG
Sbjct: 183 TTTVVPVVNQVEVQPLLPNDELIEFCRSKDIITQAYCPFGGSEAPLIKDATVVEIAKGNG 242

Query: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQ 301
           V+AG V+ SW VQ+G V LPKSV  SRI+ NLK  TLSD+D+ K++ + K +GE+R    
Sbjct: 243 VDAGQVITSWHVQRGYVVLPKSVKESRIISNLKTFTLSDADMTKMNNISKTQGEKRLNNV 302

Query: 302 DFSPFPIFQ 310
           +FSPFPIF+
Sbjct: 303 NFSPFPIFE 311

>KLLA0B14707g Chr2 complement(1291951..1292883) [933 bp, 310 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 310

 Score =  379 bits (972), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 182/310 (58%), Positives = 226/310 (72%), Gaps = 1/310 (0%)

Query: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61
           ++  N + +LKLNTG +IP VGLGTW+S E + Y AV+ AL+ GYRHID AA+YGNE  V
Sbjct: 1   MSTSNESPSLKLNTGASIPVVGLGTWKSPEEDAYNAVVSALQNGYRHIDTAAIYGNEEAV 60

Query: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           GK I+DSGVPR EIF+TTKLW TQQR+P+ ALD SLQRLGLDYVDLYLIHWPVPL   +I
Sbjct: 61  GKGIRDSGVPREEIFVTTKLWGTQQRDPEAALDLSLQRLGLDYVDLYLIHWPVPLNASSI 120

Query: 122 KDGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180
            DGN   F    DG  D+D+ EWNFIKTWE MQ L +SGKTKAIGVSNFS+ N++ LLAA
Sbjct: 121 TDGNYLTFPRTADGKIDIDIEEWNFIKTWEKMQHLPKSGKTKAIGVSNFSIKNIEALLAA 180

Query: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240
               + PA NQ+E+HP LPQ +LI + K  GI+IEAYSPLG  ++ IL+DPT++ IA   
Sbjct: 181 NPDFIVPAANQIEIHPQLPQTELIDYCKSKGILIEAYSPLGSSSSTILTDPTIEGIASKY 240

Query: 241 GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCY 300
             E  +++ISW   +G V LPKSV P RI  NLK+L LS  D+ K++ L ++ G +R   
Sbjct: 241 NAEPANILISWGASRGYVVLPKSVNPQRIKTNLKLLDLSTEDLEKINKLTESVGAKRYVA 300

Query: 301 QDFSPFPIFQ 310
            DFSPF IF+
Sbjct: 301 PDFSPFAIFE 310

>Kwal_47.18084 s47 complement(677816..678745) [930 bp, 309 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 198] FULL
          Length = 309

 Score =  378 bits (971), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 180/307 (58%), Positives = 227/307 (73%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGE 60
           M  L+N+T   KLNTG TIP +G GTWRS E EGY AV+ A+K GYRHID AAVYGNE  
Sbjct: 1   MPALKNNTDIGKLNTGATIPLLGFGTWRSTEEEGYNAVLSAIKDGYRHIDSAAVYGNEAA 60

Query: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTEN 120
           VG+AI+DSGVPR E+F+TTKLW TQQR P +ALDQSLQRLGLDYVDLYLIHWP+P++T+ 
Sbjct: 61  VGRAIRDSGVPREELFVTTKLWNTQQREPAKALDQSLQRLGLDYVDLYLIHWPLPIKTDR 120

Query: 121 IKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180
           I DGNLF    K DG  DVD EW++IKTW+LMQ+L  +GKT+A+GVSN SV+ L+ LLA 
Sbjct: 121 ITDGNLFSIPTKEDGKPDVDTEWDYIKTWQLMQELPSTGKTRAVGVSNVSVSQLEKLLAD 180

Query: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240
              KV PAV QVE HPLLPQ  L+ F  ++ I++EAYSPLG + +P++ +P ++EIAK  
Sbjct: 181 KGNKVVPAVCQVETHPLLPQNKLLDFCTKHDILLEAYSPLGSQGSPLIDEPVIKEIAKKY 240

Query: 241 GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCY 300
             +   ++ISW +++G V LPKSVTPSRI  NL+ L L D D  K++ L   KGE+R   
Sbjct: 241 NADPAQIIISWDIKRGYVVLPKSVTPSRIKSNLQTLDLEDEDFEKINKLHVEKGEKRVND 300

Query: 301 QDFSPFP 307
            ++  FP
Sbjct: 301 PEWFTFP 307

>TBLA0A06510 Chr1 complement(1597737..1598675) [939 bp, 312 aa] {ON}
           Anc_5.434 YOR120W
          Length = 312

 Score =  378 bits (970), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 176/308 (57%), Positives = 232/308 (75%), Gaps = 1/308 (0%)

Query: 4   LQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGK 63
           L+NS + + LN G+ IP VGLGTW+S+EN+GY +VI ALKAGYRHID AA+Y NEGEVG+
Sbjct: 5   LKNSDTYVTLNNGEKIPSVGLGTWKSQENDGYNSVIYALKAGYRHIDTAAIYRNEGEVGR 64

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKD 123
           AI+DSGVPR++IF+TTKLWCT+ +NP+ AL+ SL+RLGLDYVDLYL+HWPV L    IKD
Sbjct: 65  AIKDSGVPRDQIFITTKLWCTEFQNPKRALESSLKRLGLDYVDLYLMHWPVVLNPRYIKD 124

Query: 124 GNLFQFAEKPDGSKDVDLE-WNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPT 182
            +       PDG++DVD+E W++IKTWEL+Q+L  +G T+++GVSNFS+NNL+ +L++P 
Sbjct: 125 DDYLVVPRLPDGTRDVDMETWDYIKTWELVQELPATGLTRSVGVSNFSINNLEKVLSSPG 184

Query: 183 TKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGV 242
            K+TPAVNQVELHPLLPQ +L K+     I +EAYSP G +NAP L   T+ +IA  NGV
Sbjct: 185 NKLTPAVNQVELHPLLPQFELQKYCDSKKIKLEAYSPFGSDNAPNLKQKTIVDIAAKNGV 244

Query: 243 EAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQD 302
               V+ SW VQ+ +V LPKSV   R++ N KV  LS  D+A++D L K  GE+R    D
Sbjct: 245 SPAQVITSWIVQRDIVVLPKSVHEERVISNFKVFDLSKEDIAEIDALAKVNGEKRINKPD 304

Query: 303 FSPFPIFQ 310
           + PFP+F+
Sbjct: 305 WDPFPVFE 312

>NDAI0B05670 Chr2 (1383187..1384143) [957 bp, 318 aa] {ON} Anc_5.434
          Length = 318

 Score =  376 bits (965), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 189/318 (59%), Positives = 236/318 (74%), Gaps = 8/318 (2%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRS-KENEGYKAVIEALKAGYRHIDGAAVYGNEG 59
           M + Q S + LKL+TG +IPQ+GLGTWRS   N+ Y +VI ALK GYRHID AA+YGNE 
Sbjct: 1   MPSPQVSENILKLSTGASIPQIGLGTWRSVGTNDAYHSVIAALKNGYRHIDTAAIYGNEA 60

Query: 60  EVGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTE 119
           +VGKAI+DSGVPRNEIF+T+KLWC Q  +P+ AL+Q+L+RLGLDY+DLYL+HWPV     
Sbjct: 61  QVGKAIRDSGVPRNEIFVTSKLWCAQTHDPKLALNQTLKRLGLDYIDLYLMHWPVTFNPR 120

Query: 120 NIKD--GNLFQFAEKP-DGSKDVDLE---WNFIKTWELMQKLLESGKTKAIGVSNFSVNN 173
           +IKD  G+   F   P D + +VD+E   WNFIKTWELMQ L ESGKTKA+GVSNFS+NN
Sbjct: 121 SIKDEDGSGDAFMTIPTDSNGNVDVEMDTWNFIKTWELMQHLPESGKTKAVGVSNFSINN 180

Query: 174 LKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTV 233
           L DLLAA TTKV PA NQ+ELHPLL Q +L+++ KE  I++EAYSP G  NAPIL D T+
Sbjct: 181 LNDLLAASTTKVVPAANQIELHPLLAQNELLQYCKEKNILVEAYSPFGSINAPILKDETI 240

Query: 234 QEIAKANGVEAGHVVISWAVQK-GLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKA 292
             IAK   ++ G VV+SW +Q+ G V LPKSV   RI+ N KV+TL D D   ++ L+K 
Sbjct: 241 NAIAKKLDIQVGQVVMSWHIQRGGYVVLPKSVHEERIIANRKVVTLPDEDFQAINNLVKE 300

Query: 293 KGERRTCYQDFSPFPIFQ 310
           KGE R    D+SPFP+F+
Sbjct: 301 KGELRVVDPDWSPFPLFK 318

>TPHA0G00210 Chr7 (31978..32913) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  374 bits (961), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 227/310 (73%), Gaps = 2/310 (0%)

Query: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61
           VT +N   T  +     IP V LGTW++  NE Y AV+EALKAGYRHIDGAA+Y NE EV
Sbjct: 3   VTAKNCDITYAIGKDTKIPAVALGTWKAAPNEVYTAVLEALKAGYRHIDGAAIYCNEEEV 62

Query: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           GKAI+DSG+PR +IF+TTKLW T+QRNP  ALD SL+RLGLDYVDLYL+HWPV L+ ++I
Sbjct: 63  GKAIRDSGIPRKDIFVTTKLWGTEQRNPLRALDSSLKRLGLDYVDLYLMHWPVALKADSI 122

Query: 122 KDGNLFQFAEKPDGSKDVDLE-WNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180
            D +L    + P G  D+D+E WNFIKTWELMQ+ L + K KAIGVSNFS+NNL +LLAA
Sbjct: 123 TDNDLLTIPKLPSGKTDIDIENWNFIKTWELMQE-LPTSKAKAIGVSNFSINNLNELLAA 181

Query: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240
           PTTK  PA NQ E+HPLLPQ +LIK+ ++  I++EAY PLGG N P++++P + EIA   
Sbjct: 182 PTTKTIPAANQFEIHPLLPQNELIKYCQDKKIIVEAYCPLGGSNVPLVTNPVITEIATKL 241

Query: 241 GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCY 300
           GV AG ++ISW +Q+G V LPKSV   RIV N + +T+   +  K++ L K  G +R+  
Sbjct: 242 GVNAGQLLISWGIQRGYVVLPKSVRKERIVTNFQTITIPAEEFEKMNNLTKEFGVQRSVN 301

Query: 301 QDFSPFPIFQ 310
            DFSPFP +Q
Sbjct: 302 IDFSPFPTYQ 311

>TPHA0E01760 Chr5 complement(354862..355794) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  363 bits (932), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 230/310 (74%), Gaps = 3/310 (0%)

Query: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61
           +TL NST+ + LN G  +P VGLGTW+SKEN+ YKAV+ ALKAGYRHID AA+YGNE EV
Sbjct: 1   MTLSNSTAKVTLNDGNQLPYVGLGTWQSKENDAYKAVVAALKAGYRHIDTAAIYGNEEEV 60

Query: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           G+AI+DSGV R+EIF+TTKLW TQ R+P +AL+QSL+RLGLDYVDLYL+HWPVP+     
Sbjct: 61  GRAIKDSGVRRSEIFVTTKLWGTQHRHPDDALNQSLERLGLDYVDLYLMHWPVPINDAQC 120

Query: 122 -KDGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLA 179
            KD N  Q     DG++D+DL  W+FIKTWELMQ L +S K K+IGVSNFS+NN+KDLLA
Sbjct: 121 KKDNNYLQIPMNEDGTRDLDLASWDFIKTWELMQALPKS-KVKSIGVSNFSINNIKDLLA 179

Query: 180 APTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKA 239
           +P  K  P VNQVELHPLLPQ +L++F K   IV+EAYSPLG   APIL   T+ E++K 
Sbjct: 180 SPGNKEVPVVNQVELHPLLPQFELVEFCKSKNIVVEAYSPLGSTGAPILELGTINEVSKK 239

Query: 240 NGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTC 299
             +   +VV SW +Q+ +V LPKSVT SRI+ NL+ + L   + +K++ +    GE+R+ 
Sbjct: 240 LAIPPANVVFSWLIQRKIVVLPKSVTESRIISNLQTMELPAEEFSKLNNISSEVGEKRSV 299

Query: 300 YQDFSPFPIF 309
             +++PF  F
Sbjct: 300 KPNWTPFIPF 309

>KAFR0E03840 Chr5 complement(763027..763959) [933 bp, 310 aa] {ON}
           Anc_5.434 YOR120W
          Length = 310

 Score =  362 bits (930), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 176/307 (57%), Positives = 223/307 (72%), Gaps = 3/307 (0%)

Query: 4   LQNSTSTLKLNTGQTIPQVGLGTWR-SKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG 62
           L+NST TLKLN G  IP VGLGTW+ + E + Y AV  AL AGYRHID AA+Y NE +VG
Sbjct: 5   LKNSTKTLKLNDGSQIPIVGLGTWQATDERDAYNAVRAALDAGYRHIDTAAIYKNEVQVG 64

Query: 63  KAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIK 122
           +AI+DSGVPR EIF+TTKLW  Q   P+ ALD+SLQRLGLDYVDLYL+HWPV L    +K
Sbjct: 65  EAIRDSGVPREEIFVTTKLWNAQHHEPEVALDESLQRLGLDYVDLYLMHWPVSLDKSYMK 124

Query: 123 DGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPT 182
           +  L +  ++PDG++ V+ +W FI TWELMQKL    K ++IGVSNFSVNNLKDLL APT
Sbjct: 125 ESPL-ELMKRPDGTRPVETDWTFINTWELMQKL-PKNKVRSIGVSNFSVNNLKDLLKAPT 182

Query: 183 TKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGV 242
           T V P +NQVELHPLLPQ +L+ + ++N I +EAYSPLG  +AP+LS+P V ++AK NGV
Sbjct: 183 TNVVPTINQVELHPLLPQYELVDYCQQNKIEVEAYSPLGSTSAPLLSEPIVIDVAKKNGV 242

Query: 243 EAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQD 302
           +  HVV+SW VQ+ ++ LPKSV   R+  NLK  TL + D   +  + + +GERR    +
Sbjct: 243 QPAHVVLSWIVQRNIIVLPKSVHAERVAANLKTFTLPEEDFDAIGKISQQRGERRINNPN 302

Query: 303 FSPFPIF 309
           F PF  F
Sbjct: 303 FEPFKTF 309

>KAFR0E03850 Chr5 complement(764595..765530) [936 bp, 311 aa] {ON} 
          Length = 311

 Score =  361 bits (927), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 177/309 (57%), Positives = 237/309 (76%), Gaps = 2/309 (0%)

Query: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRSKEN-EGYKAVIEALKAGYRHIDGAAVYGNEGEV 61
           TLQN+T+TLKLNTG ++P +GLGTWR+ ++ EGY AV  AL+AGYRHID AA+Y NE  V
Sbjct: 4   TLQNTTTTLKLNTGASLPILGLGTWRATDDQEGYNAVKSALEAGYRHIDTAAIYQNEEVV 63

Query: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           G+AI++SG+PR+EIF+TTKLW TQ R+P  ALDQSL+RLGLDYVDLYL+HWPVP+  +  
Sbjct: 64  GRAIRESGIPRDEIFVTTKLWGTQHRDPAAALDQSLERLGLDYVDLYLMHWPVPMEAKYS 123

Query: 122 KDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181
           K  +L +F  +PDGS  V+ +W+FIKTWELMQ+L ++ KT+AIGVSNFS+NN+ DLL +P
Sbjct: 124 KSSSLLEFPYRPDGSLAVESDWDFIKTWELMQELPKT-KTRAIGVSNFSINNINDLLKSP 182

Query: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241
             K+ PA NQVELHPLLPQ +L+ F +E GIV+EAYSP G  +AP+LS+  + E+AK + 
Sbjct: 183 GNKIVPAANQVELHPLLPQAELVTFCQEKGIVVEAYSPFGSVSAPLLSEQAIIEVAKKHD 242

Query: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQ 301
           V A  V++SW +++G+  LPKSV   R+V N K  +L + D A ++ + K KGE+R    
Sbjct: 243 VSAAQVILSWHIKRGIAVLPKSVHKERVVSNFKTFSLPEDDFATINNVSKEKGEKRVVNF 302

Query: 302 DFSPFPIFQ 310
           D+SPF IF+
Sbjct: 303 DWSPFKIFE 311

>TDEL0D00230 Chr4 (37458..38396) [939 bp, 312 aa] {ON}  possible
           pseudogene; NNN added to avoid internal stop codon
          Length = 312

 Score =  355 bits (912), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 169/312 (54%), Positives = 222/312 (71%), Gaps = 2/312 (0%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGE 60
           M      T + KLNTG  +P +GLGTW+S E + Y AV+ ALKAGY+HID AA+Y NE  
Sbjct: 1   MTVTSTKTPSFKLNTGALLPAIGLGTWKSSEEDAYTAVLSALKAGYKHIDTAAIYRNERA 60

Query: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTEN 120
           VGKAI+DSG+PR+E+F+TTKLW TQ R+P+ ALD SL+RLGLDYVDLYLIH+PV  +T+ 
Sbjct: 61  VGKAIRDSGIPRDELFITTKLWSTQHRDPKAALDGSLERLGLDYVDLYLIHYPVAFKTDR 120

Query: 121 IKDGNLFQFAEKPDGSKDVDL-EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLA 179
           I+DGN F F   P+G +DVD+ +W+F+KTW L+Q L ESGK KA+GVSNFS+NNLK LL 
Sbjct: 121 IEDGNPFCFPLLPNGKRDVDIVDWDFVKTWRLVQHLPESGKCKAVGVSNFSINNLKTLLE 180

Query: 180 APTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIA-K 238
           +      PAVNQVE+HP LPQ +LI F K   IV+EAYSPLG   + +L+D T+Q+IA K
Sbjct: 181 SDEKFAVPAVNQVEIHPQLPQTELIDFCKSKDIVVEAYSPLGSTGSQMLTDDTLQKIAEK 240

Query: 239 ANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRT 298
               +   ++I+W + +G   LPKSVTP RI  N +++ +   D+ KV  L+   G +R 
Sbjct: 241 XXDAQPAQILINWGISRGYCVLPKSVTPKRIEANARIIDIKKEDLLKVTNLIDILGPKRY 300

Query: 299 CYQDFSPFPIFQ 310
              D+SPFPIF+
Sbjct: 301 LEPDWSPFPIFE 312

>KLTH0A03476g Chr1 complement(298735..299661) [927 bp, 308 aa] {ON}
           similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 308

 Score =  353 bits (905), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 172/306 (56%), Positives = 222/306 (72%), Gaps = 1/306 (0%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGE 60
           M   + STS  KLNTG +IP VGLGT+ S++  GYKAV+ A+K GYRHID AA+Y NE  
Sbjct: 1   MSAPKPSTSVGKLNTGASIPLVGLGTYLSEDETGYKAVLHAIKVGYRHIDCAALYKNEDF 60

Query: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTEN 120
           VG+AI+DSGVPR E+F+TTK+W TQ R P +AL++SL RLGLDYVDL+L+HWP  LRTE 
Sbjct: 61  VGRAIRDSGVPREELFVTTKVWNTQHREPAKALEESLSRLGLDYVDLFLMHWPQALRTER 120

Query: 121 IKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180
           I DGN+    ++ D   DVD EWN+IKTW LMQ L  SGKTKA+GVSNFSV  L+ LLA 
Sbjct: 121 ITDGNMITVPKREDEKPDVDTEWNYIKTWHLMQDLPASGKTKAVGVSNFSVKQLEKLLAD 180

Query: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240
           P +KV PA NQVE+HPLLPQ  L  F K+  I++ AYSPLG + AP+L DP + EIA  +
Sbjct: 181 PGSKVVPACNQVEVHPLLPQIPLYDFCKKKNIMLAAYSPLGSQKAPLLDDPVILEIAAKH 240

Query: 241 GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCY 300
             +   ++I W V++G V LPKSVTPSRI  NL+++ L+DS++ K++ + K KGE+R   
Sbjct: 241 KADPAQIIIGWDVKRGYVALPKSVTPSRIESNLQIVNLTDSELEKINEIHK-KGEKRVVD 299

Query: 301 QDFSPF 306
            ++  F
Sbjct: 300 PEWFDF 305

>KLTH0E00220g Chr5 complement(12415..13335) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  352 bits (902), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 158/305 (51%), Positives = 231/305 (75%), Gaps = 1/305 (0%)

Query: 7   STSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAIQ 66
           +T  L++NTG+ IP +GLGTW++ + + Y+AV+ AL++GYRHID AA+Y NE  VG+AI+
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIR 61

Query: 67  DSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKDGNL 126
           DSGVPR +IF+TTKLWCTQQR+PQ AL+ SL+RLGLDYVDLYL+H+PV L+T+ IKDGN+
Sbjct: 62  DSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNV 121

Query: 127 FQFAEKPDGSKDVDLE-WNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPTTKV 185
                + DG++DVD++ W+F+KTW+LMQ L +SGKTKAIGVSNFS+ N++++L       
Sbjct: 122 LSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLS 181

Query: 186 TPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGVEAG 245
            PA NQ+E+HP LPQ++LI++ K  GI++EAYSPLG   + +L+DP + ++A+ + VE  
Sbjct: 182 VPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPA 241

Query: 246 HVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQDFSP 305
            ++ISW V +G   LPKSV   R+  NLK++ LS +DV ++  +L+  G +R     ++P
Sbjct: 242 QILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAP 301

Query: 306 FPIFQ 310
           FP+++
Sbjct: 302 FPMYE 306

>KLTH0A00528g Chr1 complement(46253..47173) [921 bp, 306 aa] {ON}
           similar to uniprot|P14065 Saccharomyces cerevisiae
           YOR120W GCY1 Putative NADP( ) coupled glycerol
           dehydrogenase proposed to be involved in an alternative
           pathway for glycerol catabolism
          Length = 306

 Score =  352 bits (902), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 158/305 (51%), Positives = 231/305 (75%), Gaps = 1/305 (0%)

Query: 7   STSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAIQ 66
           +T  L++NTG+ IP +GLGTW++ + + Y+AV+ AL++GYRHID AA+Y NE  VG+AI+
Sbjct: 2   ATLELQMNTGKPIPVLGLGTWKAADGDTYRAVLAALESGYRHIDTAAIYRNEAAVGRAIR 61

Query: 67  DSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKDGNL 126
           DSGVPR +IF+TTKLWCTQQR+PQ AL+ SL+RLGLDYVDLYL+H+PV L+T+ IKDGN+
Sbjct: 62  DSGVPREKIFVTTKLWCTQQRDPQSALNASLERLGLDYVDLYLMHFPVALKTDLIKDGNV 121

Query: 127 FQFAEKPDGSKDVDLE-WNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPTTKV 185
                + DG++DVD++ W+F+KTW+LMQ L +SGKTKAIGVSNFS+ N++++L       
Sbjct: 122 LSIPVRADGARDVDIDGWSFVKTWQLMQDLPKSGKTKAIGVSNFSIKNIEEILKPELGLS 181

Query: 186 TPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGVEAG 245
            PA NQ+E+HP LPQ++LI++ K  GI++EAYSPLG   + +L+DP + ++A+ + VE  
Sbjct: 182 VPAANQIEIHPQLPQDELIEYCKSKGIIVEAYSPLGSSESSMLTDPDLIKLAEKHQVEPA 241

Query: 246 HVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQDFSP 305
            ++ISW V +G   LPKSV   R+  NLK++ LS +DV ++  +L+  G +R     ++P
Sbjct: 242 QILISWGVTRGYCILPKSVNSKRVQSNLKIVKLSSNDVQQISKILEKLGSKRYVSPSWAP 301

Query: 306 FPIFQ 310
           FP+++
Sbjct: 302 FPMYE 306

>NCAS0F03380 Chr6 (682072..683013) [942 bp, 313 aa] {ON} Anc_5.434
          Length = 313

 Score =  350 bits (897), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 180/311 (57%), Positives = 227/311 (72%), Gaps = 2/311 (0%)

Query: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRS-KENEGYKAVIEALKAGYRHIDGAAVYGNEGE 60
           VTL+ ST+TLKLNTG  IP++ LGTWRS    +GY +VI ALKAGYRHID AA+YGNE +
Sbjct: 3   VTLKASTATLKLNTGANIPEISLGTWRSLGATDGYDSVIAALKAGYRHIDTAAIYGNEDQ 62

Query: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTEN 120
           VGKAI+DSG+PR EIF+T+KLW TQQ NP  AL  +L RLGLDY+DLYL+HWPV   T N
Sbjct: 63  VGKAIRDSGIPREEIFVTSKLWNTQQHNPAGALKDTLSRLGLDYLDLYLMHWPVTFNTRN 122

Query: 121 IKDGNLFQFAEKPDGSKDVDLE-WNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLA 179
           +K  +     +  +G  D++++ WNF+KTWELMQ+L  +G TKA+GVSNFS+NNLK+LL 
Sbjct: 123 VKGTDFMVIPKNENGKPDIEMDTWNFVKTWELMQELPATGMTKAVGVSNFSINNLKELLT 182

Query: 180 APTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKA 239
           +P  K+TPA NQ+E+HPLLP+ DLIKF +E GI+IEAYSPLG  NAPIL +P + EI+K 
Sbjct: 183 SPGNKLTPAANQIEIHPLLPEHDLIKFCREKGIMIEAYSPLGSINAPILKEPKIIEISKK 242

Query: 240 NGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTC 299
             V    ++ISW VQ+G V L KS    RI+ N KV TLS  D   +  L K KG  R  
Sbjct: 243 LDVPPAQLIISWHVQRGYVVLVKSTHEERIIANRKVFTLSKEDFEAIKNLAKEKGTLRVV 302

Query: 300 YQDFSPFPIFQ 310
             D+SPFP+F+
Sbjct: 303 DPDWSPFPLFK 313

>KLLA0D10109g Chr4 (854495..855424) [930 bp, 309 aa] {ON} similar to
           uniprot|P14065 Saccharomyces cerevisiae YOR120W GCY1
           Putative NADP( ) coupled glycerol dehydrogenase proposed
           to be involved in an alternative pathway for glycerol
           catabolism
          Length = 309

 Score =  341 bits (875), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 216/311 (69%), Gaps = 3/311 (0%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGE 60
           M +      +LKLNTG +IPQ+G GTW S   + Y AVI ALK GYRHID AA+YGNE  
Sbjct: 1   MTSPSGEFPSLKLNTGASIPQLGFGTWPSSHADAYTAVITALKTGYRHIDAAAMYGNEAA 60

Query: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTEN 120
           VGK I+DSG+PR EIF+TTKLW TQQR+P  ALD+SL+RLGLDYVDL+LIHWPVPL+   
Sbjct: 61  VGKGIRDSGIPREEIFVTTKLWNTQQRDPASALDESLERLGLDYVDLFLIHWPVPLKPVG 120

Query: 121 IKDGNLFQFAEKPDGSKDVDLE-WNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLA 179
             + NL ++   P     +D E W+FIKTWELMQ L ++GKT+A+GVSNFS+ NL+DLL 
Sbjct: 121 GPE-NLLKYP-TPGIKPQIDTEDWSFIKTWELMQTLPKTGKTRAVGVSNFSIKNLEDLLN 178

Query: 180 APTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKA 239
           +    + PAVNQ E+HP LPQ +LI + K  GIV+EAY PLG  ++ +LSDPT+ EIA  
Sbjct: 179 SSPDVLVPAVNQFEIHPQLPQTELINYCKSKGIVVEAYCPLGSSSSAMLSDPTIAEIADK 238

Query: 240 NGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTC 299
             V+  +V+I+W + +G   LPKS TP+RI  N   + LS  D  ++  L +  G +R  
Sbjct: 239 YHVKPANVLINWGISRGYCVLPKSFTPARIASNKTPVHLSREDTERITKLSETLGVKRYV 298

Query: 300 YQDFSPFPIFQ 310
           + DF P+P+F+
Sbjct: 299 HPDFEPYPLFE 309

>KLTH0F16060g Chr6 complement(1304479..1305408) [930 bp, 309 aa]
           {ON} similar to uniprot|Q12458 Saccharomyces cerevisiae
           YDR368W YPR1 2-methylbutyraldehyde reductase may be
           involved in isoleucine catabolism
          Length = 309

 Score =  341 bits (874), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 157/294 (53%), Positives = 212/294 (72%)

Query: 4   LQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGK 63
           L+  T+T KLNTG  IP +GLGTWRS +  GY A + A+KAGYRHID AAV  NE  VG+
Sbjct: 5   LKKCTATAKLNTGAQIPLLGLGTWRSTKENGYNATLAAIKAGYRHIDIAAVCMNEQVVGR 64

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKD 123
           AI+DSGVPR E+F+TTKLWCTQ R+P+ AL QSL+RLGLDYVDLY++HWPV  R+E +K 
Sbjct: 65  AIRDSGVPREELFVTTKLWCTQHRDPKTALSQSLKRLGLDYVDLYMMHWPVAFRSEQVKH 124

Query: 124 GNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPTT 183
            N     ++ DG  DVD  W+++KTWELMQ+L  +GKT A+GV+NFSV+ LK L+ +P  
Sbjct: 125 TNYMLIPKRKDGQPDVDEGWDYVKTWELMQELPATGKTNALGVANFSVSQLKKLIDSPGN 184

Query: 184 KVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGVE 243
           K+ PA +Q+E HP LPQ  ++ F K+N I++EAYSPLG E AP+L +P V+EI+K   VE
Sbjct: 185 KIVPAASQLETHPFLPQNKMLSFCKKNNILMEAYSPLGSEGAPLLDEPVVREISKKLHVE 244

Query: 244 AGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERR 297
              +++SW +Q+G   L KS TPSRI  NL    + + D+ +++ L + +G +R
Sbjct: 245 PAQLLVSWGLQRGHAVLVKSKTPSRIEANLHTFDIPEGDLRRINELAQERGTKR 298

>Kwal_55.21426 s55 complement(832981..833907) [927 bp, 308 aa] {ON}
           YOR120W (GCY1) - Similar to mammalian aldo/keto
           reductases [contig 130] FULL
          Length = 308

 Score =  327 bits (838), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 152/295 (51%), Positives = 209/295 (70%), Gaps = 1/295 (0%)

Query: 4   LQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGK 63
           L+  T+T  LNTG  IP +GLGTWR  +  GYKA++ ALKAGYRHID AAV  NE  +GK
Sbjct: 5   LKKCTATATLNTGAKIPLLGLGTWRLTKEGGYKAILAALKAGYRHIDSAAVCMNEQVIGK 64

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKD 123
           AI+DSGV R+E+F+TTKLW TQ R+P  ALDQSL+RLGL+YVDLY++HWP+  R + IK 
Sbjct: 65  AIRDSGVRRDELFVTTKLWSTQHRDPSAALDQSLKRLGLEYVDLYMMHWPLAFRVDQIKA 124

Query: 124 GNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPTT 183
            N        +G   VD +W+++KTWELMQK L + KT+AIGV+NFSV  L  LL +P  
Sbjct: 125 KNFMLIPRNSEGKPYVDTDWDYVKTWELMQK-LPTEKTRAIGVANFSVPQLTSLLKSPNN 183

Query: 184 KVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGVE 243
           K+ PA +Q+E HP LP ++++ F +E GI++EAYSPLGG+  P++ +P ++EI+K   VE
Sbjct: 184 KIIPAASQLETHPFLPHDEMLAFCREKGILMEAYSPLGGDGGPLIDEPVIREISKKLHVE 243

Query: 244 AGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRT 298
              ++ISW +++G   LPKS T +RI  NL+V  LSD D  ++  + + +G +RT
Sbjct: 244 PAQLLISWGLKRGCAVLPKSKTQTRIESNLEVFDLSDEDYERIHEIAQERGPKRT 298

>AER401W Chr5 (1406905..1407846) [942 bp, 313 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR368W (YPR1) and
           YOR120W (GCY1)
          Length = 313

 Score =  323 bits (827), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 158/308 (51%), Positives = 217/308 (70%)

Query: 3   TLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG 62
           TL+ ST T+ LNTG  IP  GLGTW+S +++   AV  ALK GY+HID A+ Y NE  VG
Sbjct: 6   TLKASTDTVTLNTGAKIPLFGLGTWQSTDDDASSAVAAALKHGYKHIDTASFYKNEELVG 65

Query: 63  KAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIK 122
           KA+++SG+PR E+F+TTK+W  QQR+P  ALD SL++LG +YVDL L+HWPVP +     
Sbjct: 66  KAVKESGIPREELFITTKVWNDQQRDPAGALDLSLKKLGTEYVDLLLMHWPVPFKEPENS 125

Query: 123 DGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPT 182
             + ++    PDG    D EW+F+KTW LMQKLL +GK KAIGVSNFS+NNL++LL A  
Sbjct: 126 TLDAYKVPRGPDGKVTRDEEWDFVKTWHLMQKLLGTGKVKAIGVSNFSINNLEELLNAEG 185

Query: 183 TKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGV 242
           T V PAVNQVELH  LPQ +L+++ ++ GIV+EAYSPLG  +AP+L D TV ++A+  GV
Sbjct: 186 TTVVPAVNQVELHIRLPQLELVEYCQKKGIVVEAYSPLGSSSAPLLKDATVNKVAEKYGV 245

Query: 243 EAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGERRTCYQD 302
              HV++++   +G+V LPKSV  SRI+ N +   + + D+  ++ + K +G +R    D
Sbjct: 246 TPAHVLLNYVANRGIVVLPKSVKESRIISNFEYFKMDEEDIKLLNDIHKKEGVQRFVDPD 305

Query: 303 FSPFPIFQ 310
           FSPFP+FQ
Sbjct: 306 FSPFPLFQ 313

>NDAI0A07000 Chr1 complement(1596632..1597594) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  217 bits (553), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 118/296 (39%), Positives = 181/296 (61%), Gaps = 14/296 (4%)

Query: 4   LQNSTST---LKLNTGQTIPQVGLGTWRSKEN--EGYKAVIEALKAGYRHIDGAAVYGNE 58
           + + TST     LN G  IP +GLGT   K+   E  +AV  A++AGYRHID A  Y  E
Sbjct: 1   MTHPTSTEIYFNLNNGTRIPAIGLGTASPKDRYPETKEAVKAAIRAGYRHIDTAYFYKTE 60

Query: 59  GEVGKAIQD----SGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPV 114
             +G+A+++    + + R E+F+TTK+W T   NP +++DQSL+ LG+DYVDL L HWPV
Sbjct: 61  PYIGQALKELFESAEIKREELFITTKVWPTFWNNPSDSIDQSLKDLGIDYVDLVLQHWPV 120

Query: 115 PLRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLL---ESGKTKAIGVSNFSV 171
             +      GN+       DG+   + + +++ T++ ++K+    +  + +AIGVSN+ +
Sbjct: 121 CFQKVENSQGNIIGLPRDKDGNALFEKDADWLFTYKALEKIYLDPKDNRVRAIGVSNYPI 180

Query: 172 NNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDP 231
             L+ L      KVTPA+NQVE+HP LPQ +L KF  ++ I++ AYSPLG + AP L   
Sbjct: 181 EYLERLFKE--CKVTPAINQVEVHPHLPQLELNKFCHDHAILLTAYSPLGSDGAPNLKIK 238

Query: 232 TVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVD 287
           +VQ++AK   VE   ++ S+ + KG V LP+S+ P RI  N+    L+D D++K+D
Sbjct: 239 SVQDLAKKYKVEPADILTSYHISKGNVVLPRSLNPKRIAANVSFAKLTDDDLSKLD 294

>SAKL0C10626g Chr3 (962421..963389) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  202 bits (515), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 116/295 (39%), Positives = 179/295 (60%), Gaps = 11/295 (3%)

Query: 11  LKLNTGQTIPQVGLGTWRSKEN--EGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAIQD- 67
             LNTG  IP +GLGT    E   +   AV  A+K GYR ID A +YG+E  +G+A+Q+ 
Sbjct: 11  FNLNTGAKIPSLGLGTVNPPEKMPQTKDAVKHAVKNGYRLIDTAWMYGSEPYIGEALQEL 70

Query: 68  ---SGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKDG 124
                V R ++F+TTK+W       +++L +SL++L LDYVDL L HWP+    +  + G
Sbjct: 71  FEEGVVKREDLFITTKVWPCHYNTVEQSLQESLKQLKLDYVDLLLQHWPLCFVKQYDEHG 130

Query: 125 NLFQFAEKP-DGSKDVDLEWNFIKTWELMQKLLE--SGKTKAIGVSNFSVNNLKDLLAAP 181
            L      P  G   +D + +++ TW+ ++K+ +  SG+ + IGVSN+ V  L+ LL   
Sbjct: 131 KLKSHPVDPKSGDIVLDEKGDYLTTWKQLEKVYKDGSGRVRNIGVSNYPVEYLERLLKE- 189

Query: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241
            T+V P +NQVELHPLLPQE+L ++   +GI++E++SPLG    P L  P V+E++K   
Sbjct: 190 -TEVVPVLNQVELHPLLPQEELSEYCNSHGILMESFSPLGSSGTPHLEHPLVKELSKKYD 248

Query: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGER 296
            E G V++++ V+KG V +P+S+   RI+ N   + LS+ D+ K+ GL + K  R
Sbjct: 249 CEPGSVLLNYHVRKGNVVVPRSLNHGRIIKNADFVALSEEDLDKLSGLGREKPVR 303

>KAFR0G01350 Chr7 (304389..305363) [975 bp, 324 aa] {ON} Anc_3.108
           YBR149W
          Length = 324

 Score =  201 bits (512), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 113/301 (37%), Positives = 185/301 (61%), Gaps = 14/301 (4%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKEN--EGYKAVIEALKAGYRHIDGAAVYGNE 58
           M+  +++    KLN G TIP +G GT+  +E   E  +AV  A+KAGYRHID A VY +E
Sbjct: 1   MLHPKSTEIYFKLNNGTTIPALGFGTYAPRERIPETKQAVKAAIKAGYRHIDTAWVYESE 60

Query: 59  GEVGKAI----QDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPV 114
             VG+AI    ++  V R+++F+TTK+W     N +++L++SL+ LGLDYVDL L HWP+
Sbjct: 61  PYVGEAIKEMIEEGEVSRSDLFVTTKVWPVYWDNVEKSLNESLEALGLDYVDLLLQHWPL 120

Query: 115 PL-RTENIKDG--NLFQFAEKPDGSKDVDLEWNFIKTWELMQKLL---ESGKTKAIGVSN 168
              R E+ K+G   L  + E  +G   ++ + +F++T+  ++K+    +  + +AIGVSN
Sbjct: 121 CFPRVEDEKNGVNGLVAYPEDDEGKPLLNEKGDFLETYRQIEKIYLNPDDHRVRAIGVSN 180

Query: 169 FSVNNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPIL 228
           +++  L+ L      KV P VNQVE+HP LPQ +L KF   +GI++ AYSPLG + AP L
Sbjct: 181 YAIEYLEALFK--ECKVKPVVNQVEIHPHLPQLELNKFCHNHGILLTAYSPLGSDGAPNL 238

Query: 229 SDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDG 288
             P V ++A+   +    ++IS+ ++KG   +P+S+ P RI   ++    +  ++ ++D 
Sbjct: 239 KIPLVHQLAEKYDMSLNDILISYHIRKGNTVIPRSLNPVRIASTIEFAPFTQEELKQLDN 298

Query: 289 L 289
           +
Sbjct: 299 V 299

>KNAG0K02070 Chr11 complement(419556..420527) [972 bp, 323 aa] {ON}
           Anc_3.108 YBR149W
          Length = 323

 Score =  197 bits (501), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 116/302 (38%), Positives = 186/302 (61%), Gaps = 16/302 (5%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKEN--EGYKAVIEALKAGYRHIDGAAVYGNE 58
           M+  +++    KLN G  +P +GLGT   +E+  E  +AV  A+KAGYRHID A  YG E
Sbjct: 1   MLHPKSTEIYFKLNNGVNMPALGLGTASPREHMAETKQAVKAAIKAGYRHIDTAWFYGTE 60

Query: 59  GEVGKAI----QDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPV 114
           G +G A+    ++  V R+++F+T+K+W     +   +L++SL+ LGLDYVDLYL HWP+
Sbjct: 61  GYIGDALKELLENGDVKRSDLFITSKVWPVYWDDVDLSLNESLKSLGLDYVDLYLQHWPL 120

Query: 115 PL-RTENIKDGNLFQFAEKP---DGSKDVDLEWNFIKTWELMQKLL---ESGKTKAIGVS 167
              + E+ KDG +     KP   DG+  +    +++ T++ M+K+    +  + +AIGVS
Sbjct: 121 CFQKIEDSKDG-VNGLKGKPIDKDGNALIVEGADYLSTYKQMEKIYLDPKDNRVRAIGVS 179

Query: 168 NFSVNNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPI 227
           N+ V  L  LL   T K  PAVNQVE+HP LPQ +L +F + + I + AYSPLG   AP+
Sbjct: 180 NYPVEYLDRLLKVCTVK--PAVNQVEMHPHLPQFELREFCELHDIKLTAYSPLGSSGAPL 237

Query: 228 LSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVD 287
           L  P V+E+++   V    V+IS+ ++KG   +P+S+ P R+ G +  +TL++ ++ ++D
Sbjct: 238 LKLPLVKELSEKYQVTLNDVLISYHIRKGSFVIPRSLNPVRLAGCVNFVTLTEGELDQLD 297

Query: 288 GL 289
            +
Sbjct: 298 DI 299

>NCAS0I02420 Chr9 complement(454156..455118) [963 bp, 320 aa] {ON}
           Anc_3.108
          Length = 320

 Score =  191 bits (486), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 108/296 (36%), Positives = 171/296 (57%), Gaps = 11/296 (3%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTW--RSKENEGYKAVIEALKAGYRHIDGAAVYGNE 58
           M   +N+     LN G  IP +GLGT   + +  E  KAV  A++AGYR ID A  Y  E
Sbjct: 1   MSHPRNTEIYFNLNNGGRIPAIGLGTASPKGRYPETKKAVKAAIRAGYRQIDTAWYYKTE 60

Query: 59  GEVGKAI----QDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPV 114
             +G+A+    +D  + R ++F+TTK+W     +P  ++++SL+ LG+DYVD+ L HWP+
Sbjct: 61  PYIGEALKELFRDGEIKREDLFITTKVWPCYWDDPSTSINESLKSLGIDYVDMVLQHWPL 120

Query: 115 PLRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLL---ESGKTKAIGVSNFSV 171
             +    ++G +       DG        ++I T++LM+K+    +  + +AIGVSN+ +
Sbjct: 121 CYKKTYDENGTIIGKPLDKDGKVIFAEGADWITTYQLMEKIYLDPKDTRVRAIGVSNYPI 180

Query: 172 NNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDP 231
             L+ ++     KVTP +NQVELHP LPQ +L  F  +NGI++ AYSPLG   AP    P
Sbjct: 181 EYLERVIKE--CKVTPVINQVELHPHLPQLELNDFCHKNGILLTAYSPLGSGGAPNTKIP 238

Query: 232 TVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVD 287
            VQE AK + V    ++ S+ V+KG V +P+S+ P R+  N+    L+ +++  +D
Sbjct: 239 LVQEYAKKHEVAPADILTSYHVRKGNVVIPRSLNPERVASNIYFAPLTKNEMKSLD 294

>KLTH0C10010g Chr3 (829145..830110) [966 bp, 321 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 321

 Score =  189 bits (480), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 109/293 (37%), Positives = 174/293 (59%), Gaps = 12/293 (4%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKEN--EGYKAVIEALKAGYRHIDGAAVYGNE 58
           M+  +N+     LN G  +P +GLGT    E   +  +AV  A+K+GYRHID A  Y  E
Sbjct: 1   MLHPKNTEVYFTLNNGVRMPAIGLGTANVVEQIPQTKQAVKAAIKSGYRHIDTAWAYQCE 60

Query: 59  GEVGKAI----QDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPV 114
             VG+A+    ++  V R +IF+TTK+W T      E++ +SL+ LGLD+VDL L HWP+
Sbjct: 61  DRVGEALKELFEEGVVKREDIFVTTKVWPTNWDRVDESISRSLENLGLDHVDLVLQHWPL 120

Query: 115 PLRTENIKDG--NLFQFAEKPDGSKDVDLEWNFIKTWELMQKLL--ESGKTKAIGVSNFS 170
                   DG   + +     DGS   + + ++++T++ ++KL   +  + +AIGVSN+ 
Sbjct: 121 CFNRLEDPDGIDGVRRNPYHEDGSPHYNEKGDYLETFKTLEKLYLAKDPRFRAIGVSNYP 180

Query: 171 VNNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSD 230
           V  L+ LL     +V PA+NQVE HP LPQ +L  F  ++ I +EAYSPLG  NAP++ +
Sbjct: 181 VEYLERLLKE--CQVVPAINQVECHPHLPQMELRDFCTKHNIRLEAYSPLGATNAPLIDN 238

Query: 231 PTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDV 283
             V++IA        +V+I++ +++G+V++P+SV P  I  N++ + LS  D+
Sbjct: 239 ELVKKIAGKYACSTQNVLIAYHMRQGVVSVPRSVNPKHIASNVQFVALSKEDI 291

>KLLA0F02728g Chr6 (249240..250232) [993 bp, 330 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 330

 Score =  187 bits (476), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 109/297 (36%), Positives = 177/297 (59%), Gaps = 17/297 (5%)

Query: 13  LNTGQTIPQVGLGTWRSKEN--EGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAIQD--- 67
            N G  +P  GLGT    E   E  +AV  A+KAGYRHID A  YG E  VG+A+Q+   
Sbjct: 13  FNNGNKVPAFGLGTAAQHERVAETKQAVKAAIKAGYRHIDTAWAYGVEEYVGEALQELFE 72

Query: 68  -SGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKDGN- 125
              V R ++ +T+K+W T   +  ++L++SL RL +DYVDL+L HWP  L T+ + D + 
Sbjct: 73  ERVVKREDLHITSKVWHTMWNDVDKSLNESLARLKVDYVDLFLQHWP--LCTQKVPDPHG 130

Query: 126 LFQFAEKP---DGSKDVDLEWNFIKTWELMQKLL---ESGKTKAIGVSNFSVNNLKDLLA 179
           + + A++P    G+   D + ++I+T++ ++K+       + +AIGVSNF +  LK +L 
Sbjct: 131 VDKIAKEPVDDQGNPLYDEKGDWIETYKQIEKIYLDKNDKRVRAIGVSNFPIEYLKRVLK 190

Query: 180 APTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKA 239
               +  PA NQVELHP LPQ +L +F  E+ I++ AYSPLGG  AP+L  P ++ + + 
Sbjct: 191 E--CRTVPACNQVELHPHLPQRELCEFCSEHKILVTAYSPLGGNGAPLLELPILKGLCEK 248

Query: 240 NGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGER 296
                  ++ S+ +++G + +P+S+  +RI  NL+ + LS+ DV K++   +   +R
Sbjct: 249 YNASPNDILTSYHLRQGTIVIPRSLNSTRIASNLEFVPLSEEDVNKLNEFGQKNKKR 305

>Ecym_5508 Chr5 (1035144..1036124) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ACL107C
          Length = 326

 Score =  185 bits (470), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 111/308 (36%), Positives = 168/308 (54%), Gaps = 26/308 (8%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----K 63
           T T  LN G  +P VGLG W+   +     V EA+K GYR  DGA  YGNE E+G    +
Sbjct: 4   TRTYTLNNGMKMPVVGLGCWKLSADVAATQVYEAIKLGYRLFDGALCYGNEKEIGVGIKQ 63

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQR--NPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           AI +  V R ++F+ +KLWC      + + AL ++L  LGLDYVDLY IH+P+P++   +
Sbjct: 64  AINEGLVKREDLFIVSKLWCNFHHPDHVKLALQRTLNDLGLDYVDLYYIHFPLPIKYVPL 123

Query: 122 KDG---NLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLL 178
           ++     ++   E    +   + +   + T+  M+KL++ G  K++G+SNF    ++DLL
Sbjct: 124 EEKYPPEMYTGEEDRRNNIVSEQQVPILDTYRAMEKLVDEGLVKSLGLSNFQACLIQDLL 183

Query: 179 AAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLG-------GENA-----P 226
                ++ P   QVELHP L QE L+ + +   I + AYS  G       G +A     P
Sbjct: 184 RG--ARIKPVALQVELHPYLSQERLVTYAQSKDIQVVAYSTFGPLSFLELGNSAAKDVTP 241

Query: 227 ILSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNL---KVLTLSDSDV 283
           +L    V  IAK + V    V++ WA Q+G+  +PKS    R++ NL   K LTLSDS++
Sbjct: 242 LLEHEIVLNIAKKHDVTPSQVILRWATQRGIAVIPKSSKKERLLNNLNSDKALTLSDSEM 301

Query: 284 AKVDGLLK 291
           + +  L K
Sbjct: 302 SDIFSLNK 309

>Kwal_56.22611 s56 complement(202750..203715) [966 bp, 321 aa] {ON}
           YBR149W (ARA1) - D-arabinose dehydrogenase [contig 184]
           FULL
          Length = 321

 Score =  184 bits (467), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 104/297 (35%), Positives = 176/297 (59%), Gaps = 12/297 (4%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKEN--EGYKAVIEALKAGYRHIDGAAVYGNE 58
           M+  +N+     LN G  +P +GLGT    E   +  +AV  A+K+GYRHID A  Y  E
Sbjct: 1   MLHPKNTEIYFTLNNGVKMPALGLGTANVIEQIPQTKQAVKAAIKSGYRHIDTAWAYRCE 60

Query: 59  GEVGKAI----QDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPV 114
             +G+A+    ++  + R +IF+TTK+W T      E++ +SL+ LG+DYVDL L HWP+
Sbjct: 61  DRIGEALKELFEEGVIKREDIFITTKVWPTNWDRADESISRSLENLGVDYVDLVLQHWPL 120

Query: 115 PLRTENIKDG--NLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESG--KTKAIGVSNFS 170
                   +G   + +     DGS   + + ++++T++ ++K+  S   + ++IGVSN+ 
Sbjct: 121 CFNRLQDPEGIDGICRNPTHEDGSPHYNEKGDYLQTFKSLEKMYLSKDPRFRSIGVSNYP 180

Query: 171 VNNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSD 230
           V  L+ LL     KV PAVNQVE+HP LPQ +L  F  ++ I +EA+SP G   +P++ +
Sbjct: 181 VEYLERLLKE--CKVVPAVNQVEMHPHLPQMELRDFCTKHNIRLEAFSPFGATGSPMVKN 238

Query: 231 PTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVD 287
             VQ++A+        V+I++ +++G+VT+P+SV P  I  N++ + LS  D+ +++
Sbjct: 239 ELVQKVAQKYSCTPNDVLIAYHLRQGVVTVPRSVNPKNIASNVQFVPLSKEDIDELN 295

>TDEL0D05160 Chr4 complement(935981..936958) [978 bp, 325 aa] {ON}
           Anc_3.108 YBR149W
          Length = 325

 Score =  181 bits (460), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 103/290 (35%), Positives = 171/290 (58%), Gaps = 13/290 (4%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKEN--EGYKAVIEALKAGYRHIDGAAVYGNE 58
           M+  +++  +  LN G  +P +GLGT    E   E  +AV  A+KAGYR+ID A  YG+E
Sbjct: 1   MLHPKSTEISFLLNNGVRMPAIGLGTANPPEKLAETKQAVKAAVKAGYRNIDTAWAYGSE 60

Query: 59  GEVGKAI----QDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPV 114
             VG+AI    ++  + R ++F+T+K+W     + + +L +SL+ LG+DY+DL+L HWP+
Sbjct: 61  PFVGEAIKELIEEGAIKREDLFITSKVWPVLWDDAERSLQESLKSLGVDYIDLWLQHWPL 120

Query: 115 PLRTENIKDG--NLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGK---TKAIGVSNF 169
                    G   L +  EK DGS D + + +++ T++ M+++  + K    +AIGVSNF
Sbjct: 121 CYNRREDPHGINGLARNPEKADGSPDFNEKADWLDTYKQMERIYSNPKDNRVRAIGVSNF 180

Query: 170 SVNNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILS 229
            V  LK +L      V P +NQVE+HP LPQ +L +F  +N I + AYSPLG   AP++ 
Sbjct: 181 PVEYLKRVLK--ECPVKPVLNQVEMHPRLPQFELNEFCHDNDIKLTAYSPLGSHGAPMVK 238

Query: 230 DPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLS 279
            P ++E+++        ++ S+ +++G   +P+S+   RI  N++ + LS
Sbjct: 239 HPLIKEMSQKYKASENDILTSFHIRQGNTVVPRSINSVRIASNIEFVPLS 288

>SAKL0C09922g Chr3 (897779..898747) [969 bp, 322 aa] {ON} similar to
           uniprot|P38115 Saccharomyces cerevisiae YBR149W ARA1
           Large subunit of NADP dependent arabinose dehydrogenase
           involved in carbohydrate metabolism small subunit is
           unidentified
          Length = 322

 Score =  180 bits (456), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 103/288 (35%), Positives = 164/288 (56%), Gaps = 13/288 (4%)

Query: 11  LKLNTGQTIPQVGLGTWRSKEN--EGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAIQD- 67
             LN G  IP VGLGT   K+   +  +AV  A+KAG+R ID A  YG E  +G+A+Q+ 
Sbjct: 11  FNLNNGTRIPAVGLGTANPKDKWPQTKEAVKAAVKAGFRQIDTAWAYGTEEYIGEALQEL 70

Query: 68  ---SGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPL--RTENIK 122
                V R ++F+TTK+W       +++L++SL+RL LDYVDL L HWP     + +   
Sbjct: 71  FAEGVVKREDLFITTKVWPNYWDQAEKSLNESLKRLQLDYVDLLLQHWPFCFVKKQDPEG 130

Query: 123 DGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLL---ESGKTKAIGVSNFSVNNLKDLLA 179
            G L    +  DGS   D   ++++T++ ++ +       + +AIGVSN+ +  L+ L  
Sbjct: 131 SGQLVNHPQHEDGSPFYDTAGDWLETYKQIEAIYLAENDTRVRAIGVSNYPIEYLERLFK 190

Query: 180 APTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKA 239
               K  PA+NQVELHP LPQ +L  +  ++GI++ +YSPLG   AP L  P VQE+A  
Sbjct: 191 E--CKTVPAINQVELHPRLPQRELCDYCNKHGILMTSYSPLGSNGAPNLRIPLVQELASK 248

Query: 240 NGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVD 287
                  V++S+ +++G + +P+S+   RI   L  + L+  ++ K++
Sbjct: 249 YNANGNDVLVSYHIRQGTIVIPRSLNLERISKGLGFVPLTKEELDKLN 296

>ZYRO0B06138g Chr2 complement(491830..492816) [987 bp, 328 aa] {ON}
           similar to uniprot|P38115 Saccharomyces cerevisiae
           YBR149W ARA1 Large subunit of NADP dependent arabinose
           dehydrogenase involved in carbohydrate metabolism small
           subunit is unidentified
          Length = 328

 Score =  178 bits (451), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 109/298 (36%), Positives = 175/298 (58%), Gaps = 13/298 (4%)

Query: 10  TLKLNTGQTIPQVGLGTWRSKENEGY--KAVIEALKAGYRHIDGAAVYGNEGEVGKAIQD 67
           +  LN G  +P +GLGT       G   +AV  A+KAGYRHID A  YG+E  VG+AI++
Sbjct: 13  SFTLNNGVRMPALGLGTANPHPEIGRTKQAVKAAVKAGYRHIDTAWAYGSEPFVGEAIKE 72

Query: 68  ---SGVPRNE-IFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKD 123
               GV R E IF+T+K+W     + + +L++SL+ LG+DY+DL+L HWP+    +    
Sbjct: 73  LMEEGVIRREDIFITSKVWPVLWDDVERSLNESLESLGVDYIDLWLQHWPLCYVKQEDTH 132

Query: 124 G--NLFQFAEKPDGSKDVDLEWNFIKTWELMQKLL---ESGKTKAIGVSNFSVNNLKDLL 178
           G   L +  E P+G    +++ ++++T+  M+K+       + ++IGVSNF V  L+  L
Sbjct: 133 GINGLARNPETPNGEPYYEVDGDWLETYVQMEKIYLDPSDNRVRSIGVSNFPVQYLERTL 192

Query: 179 AAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAK 238
                 V PAVNQVE+HP LPQ +L KF + + I++EAYSPLG  NAP +    VQ++A+
Sbjct: 193 F--ECAVKPAVNQVEMHPRLPQFELNKFCRAHNILLEAYSPLGSHNAPNVHLQLVQDLAE 250

Query: 239 ANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLKAKGER 296
              +    ++ S+ +++G   + +SV   RI  N++   L++ ++  +D L   K +R
Sbjct: 251 KYSMSPSGILNSYHIRQGNAVVSRSVNTMRIASNVEFAALTEEELDNLDQLGITKPKR 308

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score =  178 bits (451), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 108/302 (35%), Positives = 171/302 (56%), Gaps = 17/302 (5%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKEN--EGYKAVIEALKAGYRHIDGAAVYGNE 58
           M+  + +     LN G  IP +GLGT    E   E  +AV  A+KAGYRHID A  Y  E
Sbjct: 15  MLHPKTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETE 74

Query: 59  GEVGKAI----QDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPV 114
             VG+AI    +D  + R ++F+TTK+W         +L++SL+ LGL+YVDL L HWP 
Sbjct: 75  PFVGEAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLEYVDLLLQHWP- 133

Query: 115 PLRTENIKD----GNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLL---ESGKTKAIGVS 167
            L  E IKD      L +      G      + ++++T++ ++K+       + +AIGVS
Sbjct: 134 -LCFEKIKDPKGISGLVKTPVDDSGKTMYAADGDYLETYKQLEKIYLDPNDHRVRAIGVS 192

Query: 168 NFSVNNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPI 227
           NFS+  L+ L+     +V P VNQVE HP LPQ +L KF   + I++ AYSPLG   AP 
Sbjct: 193 NFSIEYLERLIKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSHGAPN 250

Query: 228 LSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVD 287
           L  P V+++A+   V    ++IS+ +++G + +P+S+ P RI  +++  +L+  ++ +++
Sbjct: 251 LKIPLVKKLAEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSSIEFASLTKDELQELN 310

Query: 288 GL 289
             
Sbjct: 311 DF 312

>KNAG0B03780 Chr2 (725307..726287) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  177 bits (449), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 107/327 (32%), Positives = 175/327 (53%), Gaps = 26/327 (7%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----K 63
           + T+ LN G T+P VGLG W+   +   + V EA+K GYR  DGA  YGNE +VG    +
Sbjct: 2   SETVTLNNGLTMPLVGLGCWKISPDICAEQVYEAIKLGYRLFDGACDYGNEKQVGDGIRR 61

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLGLDYVDLYLIHWPVPLR---T 118
           AI +  V R ++F+ +KLW T    ++ + AL ++L  + L+Y+DLY IH+P+  +    
Sbjct: 62  AIDEGIVKREDLFVVSKLWNTYHDPKHVKLALQRTLDDMKLEYLDLYYIHFPLAFKFVPF 121

Query: 119 ENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLL 178
           E       +  AE        + +   I T+  M++L++ G TK+IG+SN++   ++D L
Sbjct: 122 EERYPPGFYTGAEDAKKGILTEEKVALIDTYRAMEELVDEGLTKSIGISNYAGALVQDTL 181

Query: 179 AAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGEN------------AP 226
                ++ P   Q+E HP L QE L+++ K NGI + AYS  G ++             P
Sbjct: 182 RG--CRIKPVCLQIEHHPYLTQEKLVEYCKLNGIQVVAYSSFGPQSFVDIDQKLAKHTPP 239

Query: 227 ILSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLSDSDV 283
           +   P +++IA+ + V    V++ WA Q+G+  +PKS    R++GNL++   +TL+  D+
Sbjct: 240 LFDHPVIKKIAQEHKVTTSQVILRWATQRGIAVIPKSAHKGRLLGNLQIDQAVTLTPKDL 299

Query: 284 AKVDGLLKAKGERRTCYQDFSPFPIFQ 310
            ++  L K      T     S FP F 
Sbjct: 300 EEISSLNKNLRFNDTWDWTISKFPSFH 326

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  176 bits (447), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 110/300 (36%), Positives = 174/300 (58%), Gaps = 17/300 (5%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKEN--EGYKAVIEALKAGYRHIDGAAVYGNE 58
           M+  + +     LN G  IP +GLGT   +E   E  +AV  A+KAGYRHID A  Y  E
Sbjct: 15  MLHPKTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYRTE 74

Query: 59  GEVGKAI----QDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPV 114
             VG+AI    ++  + R ++F+TTK+W         +L++SL+ LGLDYVDL L HWP 
Sbjct: 75  PFVGEAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWP- 133

Query: 115 PLRTENIKD----GNLFQFAEKPDGSKDVDLEWNFIKTWELMQKL-LESG--KTKAIGVS 167
            L  E +KD      L +      G        ++++T++ ++K+ L+S   + +AIGVS
Sbjct: 134 -LCFEKVKDPKGISGLVKTPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVS 192

Query: 168 NFSVNNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPI 227
           NFS+  L+ L+     KV P VNQVE HP LPQ +L KF   + I++ AYSPLG + AP 
Sbjct: 193 NFSIEYLERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPN 250

Query: 228 LSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVD 287
           L  P V+++ +   V    ++IS+ +++G + +P+S+ P RI  N++ + L+  ++ +++
Sbjct: 251 LKIPLVKKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELN 310

>KLTH0F16610g Chr6 complement(1346319..1347308) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  176 bits (445), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 111/308 (36%), Positives = 171/308 (55%), Gaps = 26/308 (8%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----K 63
           + T+KLN G  +P VGLG W+         V EA+K GYR  DGA  YGNE EVG    K
Sbjct: 5   SETVKLNNGLEMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIRK 64

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           AI +  V R ++F+ +KLW +    +N ++AL ++LQ LGL+Y+DL+ IH+P+  +    
Sbjct: 65  AIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLQDLGLEYLDLFYIHFPLAFKFVPF 124

Query: 122 KDGNLFQFAEKPDGSKD--VDLE-WNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLL 178
           ++     F    +  K   + LE    + T+  +++ ++ G  KAIGVSNF    L DLL
Sbjct: 125 EERYPPGFYTGAEDEKKGVISLEKVTVLDTYRALEQCVDEGLIKAIGVSNFRGILLHDLL 184

Query: 179 AAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLG-----------GENAPI 227
           A    K+ PA  Q+E HP L QE L+++ K+ GI + AYS  G            ++ P 
Sbjct: 185 AG--AKIPPACLQIEHHPYLTQEKLVEYCKQQGIQVVAYSSFGPQSFLEMDSQLAKSTPT 242

Query: 228 LSD-PTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLSDSDV 283
           L +   V+++A  +GV    V++ WA Q+ +  +PKS    R++ NL++   LTLSD ++
Sbjct: 243 LFEHDVVKKVANNHGVSTSEVLLRWATQRRVAIIPKSSKKERLLNNLQINEKLTLSDEEL 302

Query: 284 AKVDGLLK 291
            ++  L K
Sbjct: 303 QEISSLNK 310

>TBLA0A00630 Chr1 complement(126399..127385) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  175 bits (444), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 111/310 (35%), Positives = 171/310 (55%), Gaps = 28/310 (9%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----K 63
           T+ + LN G  +P VGLG W+   +     V EA+K GYR  DGAA YGNE EVG    K
Sbjct: 2   TAMITLNNGLKMPLVGLGCWKIPNDVCASQVYEAIKLGYRLFDGAADYGNEKEVGQGINK 61

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQR--NPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           A+ +  V R+++F+ +KLW T     + + AL ++L  LGLDY+DLY IH+P+  +    
Sbjct: 62  ALSEGIVKRSDLFIISKLWNTFHHPDHVKLALQRTLSDLGLDYLDLYYIHFPLAFKYVPF 121

Query: 122 KDG---NLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLL 178
           ++      +  AE     K       ++ T+  M+KL++ G TK+IGVSN   + L+D+L
Sbjct: 122 EEKYPPCFYTGAEDAKIGKISLQNVPYLDTYRAMEKLVDEGLTKSIGVSNLQGSILQDVL 181

Query: 179 AAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLG-----------GENAPI 227
                ++ PA  Q+E HP L QE L++F K   I + +YS  G            E+ P 
Sbjct: 182 MG--CRIRPAALQIEHHPYLTQEHLVQFCKNENIAVVSYSSFGPQSFLELGSKRAEDTPA 239

Query: 228 LSD-PTVQEIAKANG--VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLSDS 281
           L D P +++IA A+G  V    V++ WA Q+ +  +PKS    R++ NL V   LTL+++
Sbjct: 240 LFDHPVIKKIAAAHGKDVTTSEVLLRWATQRDIAIIPKSSRKERLLLNLNVNEKLTLTEA 299

Query: 282 DVAKVDGLLK 291
           ++ ++  L K
Sbjct: 300 ELLEISALNK 309

>KLLA0F03256g Chr6 (306731..307588) [858 bp, 285 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 285

 Score =  174 bits (440), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 102/278 (36%), Positives = 157/278 (56%), Gaps = 36/278 (12%)

Query: 10  TLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAIQD-- 67
           + KL++G TIP VGLGT+    N+    V +AL+ GYRH D A +YGNE EVG+ I+   
Sbjct: 8   SYKLSSGYTIPSVGLGTYELPPNKTAYLVHQALEVGYRHFDTAVLYGNEYEVGQGIKKWL 67

Query: 68  ----SGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRL-GLDYVDLYLIHWPVPLRTEN 120
               +   R ++F TTKLW +Q      ++A+D  LQ +  L Y+DL LIH P+      
Sbjct: 68  NENPAENKRGDVFYTTKLWDSQHGYEKAKKAIDHCLQEVEDLGYIDLLLIHSPL------ 121

Query: 121 IKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180
                         G K + LE     T+E MQ+ +++GK ++IGVSN+   ++++LL  
Sbjct: 122 --------------GGKKLRLE-----TYEAMQEAVDAGKVRSIGVSNYGFQHIEELLNW 162

Query: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240
              K  P VNQ+E+ P   +++L  F K+ GI++EAY+PL   +   L DP + ++A   
Sbjct: 163 EKLKYKPVVNQIEISPWCMRQELADFCKKKGILVEAYAPL--THGTKLKDPDLVKVANEV 220

Query: 241 GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTL 278
           G + G  +I W++QKG + LPK+ + SR+  NL V + 
Sbjct: 221 GCDVGQALIRWSLQKGYIPLPKTQSVSRLASNLDVFSF 258

>ACL107C Chr3 complement(152564..153628) [1065 bp, 354 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR104W
           (GRE3)
          Length = 354

 Score =  175 bits (444), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 105/313 (33%), Positives = 167/313 (53%), Gaps = 28/313 (8%)

Query: 2   VTLQNSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEV 61
           + +  +  T+KLN G  +P VGLG W+       + V EA+K GYR +DGA  Y NE EV
Sbjct: 24  IAMVMNVRTIKLNNGADMPLVGLGCWKIPNEVAAEQVYEAIKLGYRLLDGAEDYANEREV 83

Query: 62  G----KAIQDSGVPRNEIFLTTKLWCTQQRNPQE---ALDQSLQRLGLDYVDLYLIHWPV 114
           G    +AI +  V R E+F+ +KLW    R P++   AL ++L  LGLDY+DL+ IH+P+
Sbjct: 84  GQGIRRAIDEGLVRREELFVVSKLWNNYHR-PEDVGKALQRTLSDLGLDYLDLFYIHFPL 142

Query: 115 PLR---TENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSV 171
             +    E      L+  A      +        I+T+  +++L++ G+ +AIG+SNF  
Sbjct: 143 AFKFVPLEERYPAGLYTGAADEQAGRLAQEPVPLIETYRALEQLVDEGRIRAIGLSNFQG 202

Query: 172 NNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGEN------- 224
             ++DLL     ++ PA  Q+E HP L QE L+++ K  G+ +  YS LG ++       
Sbjct: 203 CLVQDLLRG--CRIRPAALQIEHHPYLTQERLVQYAKSEGLAVVGYSSLGPQSFLELGNT 260

Query: 225 -----APILSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---L 276
                AP+L    V  IA+ +      V++ WA Q+ +  +PKS    R+  NL+V   L
Sbjct: 261 AAQNAAPLLQHEVVCRIAERHTATPAEVLLRWATQRDIAVIPKSSRKERLATNLRVDEAL 320

Query: 277 TLSDSDVAKVDGL 289
           TL+D ++ ++  L
Sbjct: 321 TLADDELRELSSL 333

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  175 bits (443), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 105/302 (34%), Positives = 170/302 (56%), Gaps = 17/302 (5%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKEN--EGYKAVIEALKAGYRHIDGAAVYGNE 58
           M+  + +     LN G  +P +GLGT    E   E  +AV  A+KAGYRHID A  Y  E
Sbjct: 15  MLHPKTTEIYFTLNNGVRVPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETE 74

Query: 59  GEVGKAI----QDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPV 114
             VG+AI    ++  + R ++F+TTK+W       + +L +SL+ +GLDYVDL+L HWP 
Sbjct: 75  PFVGEAIKELLEEGSIKREDLFITTKVWPVLWDEVERSLSESLKAMGLDYVDLFLQHWP- 133

Query: 115 PLRTENIKD----GNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLL---ESGKTKAIGVS 167
            L  E +KD      L +      G   +    ++++T++ ++K+       + +AIGVS
Sbjct: 134 -LCFEKVKDPKGISGLVKTPVHKSGEAMLASNGDWMETYKQLEKIYLDPNDHRVRAIGVS 192

Query: 168 NFSVNNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPI 227
           NFS+  L+ L+     +V P VNQVE HP LPQ +L KF   + I++ AYSPLG   AP 
Sbjct: 193 NFSIEYLERLVKE--CRVKPTVNQVETHPHLPQMELRKFCFMHDILLTAYSPLGSNGAPN 250

Query: 228 LSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVD 287
           L  P V+++ +   V    V+IS+ +++G + +P+S+ P RI  +++   L+  ++ +++
Sbjct: 251 LKIPLVKKLVEKYNVTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFACLTKDELQELN 310

Query: 288 GL 289
             
Sbjct: 311 DF 312

>Smik_2.288 Chr2 (524564..525598) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  174 bits (440), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 106/298 (35%), Positives = 171/298 (57%), Gaps = 13/298 (4%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKEN--EGYKAVIEALKAGYRHIDGAAVYGNE 58
           M+  + +     LN G  IP +GLGT   +E   E  +AV  A+KAGYRHID A  Y  E
Sbjct: 15  MLHPKTTEIYFSLNNGVRIPALGLGTANPQEKLAETKQAVKAAIKAGYRHIDTAWAYETE 74

Query: 59  GEVGKAI----QDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPV 114
             VG+AI    ++  + R ++F+TTK+W         +L++SL+ LGLDYVDL L HWP+
Sbjct: 75  PFVGEAIKELLEEGTIQREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLLLQHWPI 134

Query: 115 PLRTENIKDG--NLFQFAEKPDGSKDVDLEWNFIKTWELMQKL-LESG--KTKAIGVSNF 169
                   +G     +      G        ++++T++ ++K+ L+S   + +AIGVSNF
Sbjct: 135 CFGKVKDPEGISGYMKLPVDDSGKTVYASNGDWLETYKQLEKIYLDSNDHRVRAIGVSNF 194

Query: 170 SVNNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILS 229
           S+  L+ L+     KV P VNQVE HP LPQ +L KF   + I++ AYSPLG + AP L 
Sbjct: 195 SIEYLERLIKE--CKVKPTVNQVESHPHLPQVELRKFCFMHDILLTAYSPLGSQGAPNLK 252

Query: 230 DPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVD 287
            P V+++ +   V    ++IS+ +++G + +P+S+ P RI  N++ + L+  ++ +++
Sbjct: 253 IPLVKKLCEKYNVTGNDLLISYHIRQGTIVIPRSLNPVRISSNIEFVCLTKDELQELN 310

>Skud_2.276 Chr2 (507436..508470) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score =  173 bits (439), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 106/302 (35%), Positives = 168/302 (55%), Gaps = 17/302 (5%)

Query: 1   MVTLQNSTSTLKLNTGQTIPQVGLGTWRSKEN--EGYKAVIEALKAGYRHIDGAAVYGNE 58
           M+  + +     LN G  IP +GLGT    E   E  +AV  A+KAGYRHID A  Y  E
Sbjct: 15  MLHPKTTEIYFSLNNGVRIPALGLGTANPHEKLAETKQAVKAAIKAGYRHIDTAWAYETE 74

Query: 59  GEVGKAI----QDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPV 114
             VG+AI    +D  + R ++F+TTK+W         +L++SL+ LGLDYVDL+L HWP 
Sbjct: 75  PFVGEAIKELLEDGSIKREDLFITTKVWPVLWDEVDRSLNESLKALGLDYVDLFLQHWP- 133

Query: 115 PLRTENIKD----GNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLL---ESGKTKAIGVS 167
            L  E +KD      L +      G        ++++T++ ++K+       + +AIGVS
Sbjct: 134 -LCFEKVKDPKGLSGLVKTPVDDSGKTMYASNGDWLETYKQLEKIYLDPNDHRIRAIGVS 192

Query: 168 NFSVNNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPI 227
           NFS+  L+ L+     +V P VNQVE HP LPQ  + KF   + I++ AYSPLG   AP 
Sbjct: 193 NFSIEYLERLIKE--CRVKPTVNQVETHPHLPQMAMRKFCFMHDILLTAYSPLGSNGAPN 250

Query: 228 LSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVD 287
           L  P V+++ +   +    V+IS+ +++G + +P+S+ P RI  +++   L+  ++ +++
Sbjct: 251 LKIPLVKKLTEKYNLTGNDVLISYHIRQGTIVIPRSLNPVRISSSIEFSCLTKDELQELN 310

Query: 288 GL 289
             
Sbjct: 311 DF 312

>TDEL0E02150 Chr5 complement(403001..403990) [990 bp, 329 aa] {ON}
           Anc_5.409 YHR104W
          Length = 329

 Score =  172 bits (435), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 109/329 (33%), Positives = 172/329 (52%), Gaps = 29/329 (8%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----K 63
           +  + LN G  +P VGLG W+         V EA+K GYR  DGA  YGNE EVG    K
Sbjct: 2   SRVVTLNNGMKMPLVGLGCWKIPNEVCASQVYEAIKIGYRLFDGAQDYGNEKEVGQGIRK 61

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           AI +  V R E+F+ +KLW +    +N + AL ++L  + LDY+DL+ IH+P+ L+    
Sbjct: 62  AIDEGIVKREELFVVSKLWNSFHDPKNVKAALQRTLDDMKLDYLDLFYIHFPIALKFVPF 121

Query: 122 KDG---NLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLL 178
           K+     L+  ++        +     I T+  +++L++ G  K+IG+SNFS + + DLL
Sbjct: 122 KEKYPPGLYTGSQDEKQGTMSEENVPIIDTYRALEQLVDEGLIKSIGISNFSGSIIMDLL 181

Query: 179 AAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGEN------------AP 226
                ++ P   Q+E HP L QE L+ + K  G+ + AYS  G ++             P
Sbjct: 182 RG--CRIKPVALQIEHHPYLTQERLVHYVKLQGLQVVAYSSFGPQSFIEMGSDLAKTTPP 239

Query: 227 ILSDPTVQEIAKANG--VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLSDS 281
           +  +P + EIAK +G  +    V++ WA Q  +  +PKS    R+  NL +   LTL+D 
Sbjct: 240 LFENPKIIEIAKNHGKEISPSQVLLRWATQNNVAVIPKSSKKERLHDNLHIDDKLTLTDQ 299

Query: 282 DVAKVDGLLK-AKGERRTCYQDFSPFPIF 309
           ++ ++  L K  +      + D +PFPIF
Sbjct: 300 ELKEISALNKNIRFNDPYTWNDKNPFPIF 328

>KLLA0E21627g Chr5 complement(1929294..1930283) [990 bp, 329 aa]
           {ON} highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 329

 Score =  170 bits (431), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 107/308 (34%), Positives = 167/308 (54%), Gaps = 30/308 (9%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----K 63
             T+ LN G+ +P VGLG W+   +     + EA+K GYR  DGA  Y NE EVG    +
Sbjct: 5   AETVTLNNGEKMPLVGLGCWKMPNDVCADQIYEAIKIGYRLFDGAQDYANEKEVGQGVNR 64

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQR--NPQEALDQSLQRLGLDYVDLYLIHWPVPLR---- 117
           AI++  V R ++ + +KLW +     N   AL+++L  L LDYVD++ IH+P+  +    
Sbjct: 65  AIKEGLVKREDLVVVSKLWNSFHHPDNVPRALERTLSDLQLDYVDIFYIHFPLAFKPVPF 124

Query: 118 TENIKDGNLFQFAEKPDGSKDVDLEW-NFIKTWELMQKLLESGKTKAIGVSNFSVNNLKD 176
            E    G  F   ++ +    ++ E    + TW  ++KL++ GK K++G+SNFS   ++D
Sbjct: 125 DEKYPPG--FYTGKEDEAKGHIEEEQVPLLDTWRALEKLVDQGKIKSLGISNFSGALIQD 182

Query: 177 LLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGG------ENAPILSD 230
           LL     ++ P   Q+E HP L QE LIK+ K  GI + AYS  G       EN   L+ 
Sbjct: 183 LLRG--ARIKPVALQIEHHPYLTQERLIKYVKNAGIQVVAYSSFGPVSFLELENKKALNT 240

Query: 231 P------TVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLSDS 281
           P      T++ IA  + V    V++ WA Q G+  +PKS    R++ NL++   LTL+D 
Sbjct: 241 PTLFEHDTIKSIASKHKVTPQQVLLRWATQNGIAIIPKSSKKERLLDNLRINDALTLTDD 300

Query: 282 DVAKVDGL 289
           ++ ++ GL
Sbjct: 301 ELKQISGL 308

>CAGL0I01122g Chr9 (93934..94914) [981 bp, 326 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104w GRE3 aldose reductase
          Length = 326

 Score =  169 bits (428), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 103/308 (33%), Positives = 165/308 (53%), Gaps = 26/308 (8%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----K 63
           +S + LN G  +P VGLG W+   +   + V +A+K GYR  DGA  YGNE EVG    K
Sbjct: 2   SSVVTLNNGLKMPLVGLGCWKIPNDVCAQQVYDAIKIGYRLFDGAEDYGNEKEVGQGIRK 61

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQR--NPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           AI +  V R ++F+ +KLW +     + + AL ++L  +GLDY+DL+ IH+P+  +    
Sbjct: 62  AIDEGVVKREDVFVVSKLWNSFHHPDHVKMALKRTLSDMGLDYLDLFYIHFPIAFKYVPF 121

Query: 122 KDG---NLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLL 178
           ++      +   E        +     I T+  +++ +E G  K+IG+SNFS + ++DLL
Sbjct: 122 EEKYPPGFYTGKEDEKNGHITEAHVPIIDTYRALEQCVEEGLIKSIGISNFSGSLVQDLL 181

Query: 179 AAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDP------- 231
                K+ P   QVE HP L QE L+++ K+NGI + AYS  G ++   L+ P       
Sbjct: 182 R--QCKIKPVALQVEHHPYLTQEHLVEYCKDNGIQVVAYSSFGPQSYIELNHPLAKNTPN 239

Query: 232 -----TVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLSDSDV 283
                T+++IA  + V    V++ WA Q+G+  +PKS    R+  NL +   LTL+  ++
Sbjct: 240 LFHHDTIKQIANNHNVATSQVLLRWATQRGIAIIPKSSKKERLQDNLMIDEKLTLTHKEL 299

Query: 284 AKVDGLLK 291
             +  L K
Sbjct: 300 EAISKLNK 307

>NCAS0A06660 Chr1 (1316398..1317378) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  168 bits (426), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 110/325 (33%), Positives = 172/325 (52%), Gaps = 28/325 (8%)

Query: 11  LKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGK----AIQ 66
           L LN G  +PQVGLG W+   +     V EA+KAGYR  DGA  Y NE EVGK    A+ 
Sbjct: 5   LTLNNGMKMPQVGLGCWKIPNDICADQVYEAIKAGYRLFDGATDYANEVEVGKGLKRAMD 64

Query: 67  DSGVPRNEIFLTTKLWCTQQRNPQEA---LDQSLQRLGLDYVDLYLIHWPVPLRTENIKD 123
           D  V R ++F+ +KLW     +P      L ++L+ LGLDY+DLY IH+P+  +   +++
Sbjct: 65  DGIVKRQDLFVVSKLW-NNFHHPDHVKLNLKRNLKDLGLDYLDLYYIHFPIAFKFVPMEE 123

Query: 124 GNLFQ-FAEKPDGSKDVDLEWN--FIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180
               Q +  K D +K +  E N   + T+  +++    G  K+IG+SNF+   + D+L  
Sbjct: 124 RYPPQMYTGKADEAKGILTEENVPLLDTYRALEECQREGLIKSIGISNFNGGLVADILRG 183

Query: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLG-----------GENAPILS 229
            + K  P   Q+E HP L QE L+++ K + + +  YS  G            +N P L 
Sbjct: 184 CSIK--PVALQIEHHPYLTQEKLLEYCKIHDVQVVGYSSFGPQSFADCGMDLAKNTPPLF 241

Query: 230 D-PTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLSDSDVAK 285
           D P +++IA+ + V    V++ WA Q+G+  +PKS    R++ NL +   +TL++ D+  
Sbjct: 242 DHPVIKKIAEKHNVSTAEVLLRWATQRGVAIIPKSSHKKRLLSNLNIDDNVTLTEEDLKS 301

Query: 286 VDGLLKAKGERRTCYQDFSPFPIFQ 310
           + GL +          + S FPIF 
Sbjct: 302 ISGLNQNLRFNDPWDWNNSKFPIFH 326

>ZYRO0A06336g Chr1 complement(505818..506801) [984 bp, 327 aa] {ON}
           highly similar to uniprot|P38715 Saccharomyces
           cerevisiae YHR104W GRE3 Aldose reductase involved in
           methylglyoxal d-xylose and arabinose metabolism stress
           induced (osmotic ionic oxidative heat shock starvation
           and heavy metals) regulated by the HOG pathway
          Length = 327

 Score =  168 bits (426), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 106/327 (32%), Positives = 172/327 (52%), Gaps = 27/327 (8%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----K 63
            S + LN G  +P VGLG W+       + + +A+  GYR  DGA  YGNE EVG    +
Sbjct: 2   ASVVALNNGNKMPLVGLGCWKIPNETCSQQIYDAISVGYRVFDGAQDYGNEKEVGEGVRR 61

Query: 64  AIQDSGVPRNEIFLTTKLWCT--QQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           AI+D  V R E+F+ +KLW +    +N + AL ++L  +GLDY+DL+ IH+P+ L+  + 
Sbjct: 62  AIKDGLVKREELFVVSKLWNSFHHPKNVKLALKRTLSDMGLDYLDLFYIHFPIALKPVSF 121

Query: 122 KDG---NLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLL 178
           ++     L+            +     + T+  +++ +E G  K+IGVSNFS + + DLL
Sbjct: 122 EEKYPPGLYTGEADAKAGVLSEEPVPILDTYRALEECVEEGLIKSIGVSNFSGSIMLDLL 181

Query: 179 AAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGEN------------AP 226
                ++ PA  Q+ELHP L QE  +K+ +  GI + AYS  G ++             P
Sbjct: 182 RG--ARIPPAALQIELHPYLTQERYVKWVQSKGIQVVAYSSFGPQSFVDIGSEVAKATPP 239

Query: 227 ILSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLSDSDV 283
           +     V++IA  + V    V++ WA Q+ +  +PKS    R+  NL V   +TL+  ++
Sbjct: 240 LFEHDVVKKIAAKHNVSTSQVLLRWATQQKVAVIPKSSKKERLRQNLLVDQEVTLTGDEI 299

Query: 284 AKVDGLLK-AKGERRTCYQDFSPFPIF 309
            ++ GL K  +      + + +PFPIF
Sbjct: 300 KEISGLNKNLRFNDPFTWSEKTPFPIF 326

>Kwal_47.18219 s47 (737925..738806) [882 bp, 293 aa] {ON} YJR096W -
           Hypothetical ORF [contig 197] FULL
          Length = 293

 Score =  166 bits (421), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 101/287 (35%), Positives = 160/287 (55%), Gaps = 38/287 (13%)

Query: 12  KLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAIQD---- 67
           KL++G  +P +GLGT+     E  + V +ALK+GYRH+D A +YGNE EVG+ IQ     
Sbjct: 18  KLSSGYILPSIGLGTYDIPRAETSEVVYQALKSGYRHLDTAVLYGNEHEVGQGIQKWLEE 77

Query: 68  --SGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLG-LDYVDLYLIHWPVPLRTENIK 122
                 R ++F TTKLW +Q    N + A+ + ++++  L Y+DL LIH P+        
Sbjct: 78  DPEHNKRQDVFYTTKLWNSQNGYSNAKRAIKECMEKVSPLGYIDLLLIHSPL-------- 129

Query: 123 DGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPT 182
                       G++        ++T++ MQ+ ++ G  ++IGVSN+  +++ +LL    
Sbjct: 130 -----------SGTR------RRLETYKAMQEAVDEGIVRSIGVSNYGKHHIDELLTWKE 172

Query: 183 TKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGV 242
            K  P VNQ+E+ P + ++DL  + K  G+V+EA+SPL   +   L  P V  +AK  G 
Sbjct: 173 LKHKPVVNQIEISPWIMRQDLADYCKSKGLVVEAFSPL--THGYKLKHPDVLLVAKETGT 230

Query: 243 EAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV--LTLSDSDVAKVD 287
           +AG V+I W++Q G V LPKS +  R+ GN+K     LS   V+ +D
Sbjct: 231 DAGRVLIRWSLQHGYVPLPKSRSVERLKGNVKAYDFELSPEQVSFLD 277

>SAKL0F14278g Chr6 (1143922..1144782) [861 bp, 286 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 286

 Score =  166 bits (420), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 97/276 (35%), Positives = 154/276 (55%), Gaps = 36/276 (13%)

Query: 12  KLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAI------ 65
           KL++G T+P +GLGT+    N   + V EALK GYRH+D A +YGNE EVG+ I      
Sbjct: 11  KLSSGYTLPSIGLGTYDLPSNATSEIVYEALKCGYRHLDTAVLYGNEREVGEGILKWLKE 70

Query: 66  QDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRL-GLDYVDLYLIHWPVPLRTENIK 122
             S   R ++F  TKLW +Q    N + A+ +  +++ GL Y+DL LIH P+        
Sbjct: 71  NPSSNKREDVFYATKLWNSQNGYNNAKRAIQECFEKVEGLGYIDLLLIHSPL-------- 122

Query: 123 DGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPT 182
                       GS+        ++T++ MQ+ ++ G  ++IGVSN+ V+++ +LL    
Sbjct: 123 -----------SGSR------KRLETYKAMQEAVDKGIVRSIGVSNYGVHHIDELLNWNE 165

Query: 183 TKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGV 242
            K  P VNQ+E+ P L +++L  + K  G+++EAY+PL   +   ++ P V  +AK  G 
Sbjct: 166 LKYKPFVNQIEISPWLMRQELADYCKSRGLIVEAYAPL--THGYKINHPNVLRVAKEAGC 223

Query: 243 EAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTL 278
            +G V+I W++Q G V LPK+ +  R+  NL V  +
Sbjct: 224 NSGQVLIRWSLQHGYVPLPKTKSVKRLPSNLDVYNI 259

>NDAI0D01600 Chr4 (382637..383620) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  167 bits (423), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 112/332 (33%), Positives = 176/332 (53%), Gaps = 35/332 (10%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----K 63
           ++ + LN G  +P VGLG W+   +   + + +A+K GYR  DGA  YGNE EVG    +
Sbjct: 2   SALVTLNNGLKMPLVGLGCWKIPTSTCAQQIYDAIKVGYRLFDGATDYGNEKEVGQGIKR 61

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQRNPQEA---LDQSLQRLGLDYVDLYLIHWPVPLR--- 117
           AI +  V R ++F+ +KLW     +P      L ++L+ LGLDYVDLY IH+P+  +   
Sbjct: 62  AIDEGLVKREDLFIVSKLW-NNFHHPDHVKLNLQRNLKDLGLDYVDLYYIHFPIAFKFVS 120

Query: 118 -TENIKDGNLFQFAEKPDGSKDVDLEWN--FIKTWELMQKLLESGKTKAIGVSNFSVNNL 174
             E    G    +  K D +K +  E N   I T+  M+KL++ G  K+IG+SN++   +
Sbjct: 121 PDERYPPG---MYTGKEDEAKGILTEENVPLIDTYRAMEKLVDEGLIKSIGISNYNGGLV 177

Query: 175 KDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLG-----------GE 223
            D L     ++ P   Q+E HP L QE L+++ K + + + AYS  G            +
Sbjct: 178 ADTLRG--CRIKPVALQIEHHPYLTQEKLLEYCKIHDVQVVAYSSFGPQSFVDCGQEMAK 235

Query: 224 NAPILSD-PTVQEIA-KANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTL 278
           N P L D PT+++IA K   V    V++ WA Q+G+  +PKS    R++ NL +   +TL
Sbjct: 236 NTPPLFDHPTIKKIADKYEAVTTSQVLLRWATQRGVAIIPKSSKKERLLENLTIDQKVTL 295

Query: 279 SDSDVAKVDGLLKAKGERRTCYQDFSPFPIFQ 310
           ++ D+ ++  L +          + S FPIFQ
Sbjct: 296 AEEDLREISALNQNLRFNDPWDWNNSKFPIFQ 327

>SAKL0G01914g Chr7 (162612..163601) [990 bp, 329 aa] {ON} highly
           similar to uniprot|P38715 Saccharomyces cerevisiae
           YHR104W GRE3 Aldose reductase involved in methylglyoxal
           d-xylose and arabinose metabolism stress induced
           (osmotic ionic oxidative heat shock starvation and heavy
           metals) regulated by the HOG pathway
          Length = 329

 Score =  166 bits (421), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 109/312 (34%), Positives = 168/312 (53%), Gaps = 34/312 (10%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----K 63
           + T+ LN G  +P +GLG W+   +     V EA+K GYR  DGA  YGNE EVG    K
Sbjct: 5   SKTVTLNNGLEMPLIGLGCWKIPNDVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIKK 64

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQR--NPQEALDQSLQRLGLDYVDLYLIHWPVPLR---- 117
           AI +  V R ++F+ +KLW +     N + AL ++L  +GLDY+DL+ IH+P+  +    
Sbjct: 65  AIAEGIVKREDLFVVSKLWNSFHHPDNVKLALKKTLDDIGLDYLDLFYIHFPLAFKFVPF 124

Query: 118 TENIKDGNLFQFAEKPDG---SKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNL 174
            E    G      ++ +G    +DV L    I T+  ++K ++ G  K+IG+SNF+ + +
Sbjct: 125 EEKYPPGFYTGAEDEKNGVISQEDVPL----IDTYRALEKCVDEGLIKSIGISNFNGSLV 180

Query: 175 KDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLG-----------GE 223
           +DLL     ++ P   Q+E HP L QE+L+K+ K  GI + AYS  G            +
Sbjct: 181 QDLLRG--ARIKPVALQIEHHPYLTQENLVKYCKNVGIQVVAYSSFGPQSFIELDSELAK 238

Query: 224 NAPIL-SDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLS 279
             P L  + TV+ IA  + V    V++ WA Q+G+  +PKS    R++ NL +   LTLS
Sbjct: 239 TTPTLFRNDTVKLIANNHKVSTSQVLLRWATQRGVAVIPKSSKKERLLENLTINDSLTLS 298

Query: 280 DSDVAKVDGLLK 291
           D ++  +  L K
Sbjct: 299 DKELKAISALNK 310

>Kpol_1013.82 s1013 complement(200564..201421) [858 bp, 285 aa] {ON}
           complement(200564..201421) [858 nt, 286 aa]
          Length = 285

 Score =  164 bits (414), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 102/277 (36%), Positives = 150/277 (54%), Gaps = 36/277 (12%)

Query: 12  KLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAI-----Q 66
           KL+ G +IP VGLGT+    N     V EALKAGYRH D A +YGNE EVG+ I     +
Sbjct: 10  KLSNGYSIPSVGLGTYDIPNNVTANVVYEALKAGYRHFDTAVLYGNEEEVGQGIHRWLLE 69

Query: 67  DSGVPRNE-IFLTTKLWCTQQ--RNPQEALDQSLQRL-GLDYVDLYLIHWPVPLRTENIK 122
           D    R E +F TTKLW +Q       +A+   L ++  L+Y+DL LIH P+        
Sbjct: 70  DPENNRREAVFYTTKLWNSQNGYEKATKAIKNCLDKVKALEYIDLLLIHSPL-------- 121

Query: 123 DGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPT 182
                       G   + LE     TW+ MQ+ ++ G  K+IGVSN+ ++++ +LL    
Sbjct: 122 ------------GGTKLRLE-----TWKAMQEAVDHGMVKSIGVSNYGMHHIDELLTWQY 164

Query: 183 TKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGV 242
            K  P VNQ+E+ P L +++L  + K N I +E YSPL   +   L+D  ++++A   G 
Sbjct: 165 LKYKPVVNQIEISPWLMRQELADYCKSNSIFVECYSPL--THGYKLNDQDLKKVANETGK 222

Query: 243 EAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLS 279
             G V+I W++Q G + LPK+ T +R+  NL V   +
Sbjct: 223 NVGQVLIRWSLQHGYIPLPKTRTINRLKTNLDVYDFN 259

>Kwal_55.21536 s55 complement(877191..878180) [990 bp, 329 aa] {ON}
           YHR104W (GRE3) - a keto-aldose reductase [contig 128]
           FULL
          Length = 329

 Score =  165 bits (417), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 106/309 (34%), Positives = 172/309 (55%), Gaps = 26/309 (8%)

Query: 7   STSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG---- 62
           ++ T+KLN G  +P VGLG W+         V EA+K GYR  DGA  YGNE EVG    
Sbjct: 4   TSETVKLNNGLQMPLVGLGCWKIPNEVCASQVYEAIKLGYRLFDGAQDYGNEKEVGQGIH 63

Query: 63  KAIQDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTEN 120
           KAI +  V R ++F+ +KLW +    +N ++AL ++L+ + L+Y+DL+ IH+P+  +   
Sbjct: 64  KAIDEGIVKREDLFVVSKLWNSYHDPKNVKKALKRTLEDMELEYLDLFYIHFPLAFKYVP 123

Query: 121 IKDGNLFQFAEKPDGSKD--VDLEW-NFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL 177
            ++     F    + +K   + LE    I T+  +++ ++ G  K+IG+SNF    + DL
Sbjct: 124 FEEKYPPGFYTGAEDAKKGVISLEQVPIIDTYRALEECVKEGLIKSIGISNFRGILIHDL 183

Query: 178 LAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPIL------SDP 231
           LA  T K  P   Q+E HP L QE LI++  +  I + AYS  G ++   L      S P
Sbjct: 184 LAGATIK--PVCLQIEHHPYLTQEKLIEYCAQEQIQVVAYSSFGPQSFLELDSELAKSTP 241

Query: 232 T------VQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLSDSD 282
           T      +Q+IA  +GV +  V++ WA Q+ +  +PKS    R++ NL++   LTL++++
Sbjct: 242 TLFEHEGIQKIATNHGVSSSQVLLRWATQRRIAIIPKSSKKERLLDNLQINEKLTLTEAE 301

Query: 283 VAKVDGLLK 291
           + ++  L K
Sbjct: 302 LQEISALNK 310

>Skud_8.165 Chr8 (297201..298184) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  163 bits (413), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 97/308 (31%), Positives = 163/308 (52%), Gaps = 29/308 (9%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----K 63
           +S + LN G  +P VGLG W+  +N     + EA+K GYR  DGA  YGNE EVG    K
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKNACANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQRNPQE---ALDQSLQRLGLDYVDLYLIHWPVPLRT-- 118
           AI +  V R ++F+ +KLW     +P     AL ++L  +GLDY+DLY IH+P+  +   
Sbjct: 62  AIYEGLVTRKDVFVVSKLW-NNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYIP 120

Query: 119 -ENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL 177
            E       +   E  +     +     I T+  ++K ++ G  K+IG+SNF  + ++DL
Sbjct: 121 FEEKYPPGFYTGTEDEEKGHITEAHVPIIDTYRALEKCVDEGLIKSIGISNFQGSLVQDL 180

Query: 178 LAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGEN------------A 225
           L     ++ P   Q+E HP L QE L++F K + I + AYS  G ++             
Sbjct: 181 LRG--CRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKATQ 238

Query: 226 PILSDPTVQEIAKAN-GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLSDS 281
            +  +  ++++++ + G     V++ WA Q+G+  +PKS    R++GNL++    +L++ 
Sbjct: 239 TLFENDVIKKVSENHTGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFSLTEQ 298

Query: 282 DVAKVDGL 289
           ++ K+  L
Sbjct: 299 ELKKISAL 306

>KAFR0C05320 Chr3 complement(1065934..1066917) [984 bp, 327 aa] {ON}
           
          Length = 327

 Score =  163 bits (413), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 172/308 (55%), Gaps = 27/308 (8%)

Query: 9   STLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----KA 64
           S + LN GQ +P VGLG W+   +   + V +A+K GYR  DGA  YGNE EVG    KA
Sbjct: 3   SLVTLNNGQKMPLVGLGCWKISNDICAEQVYQAIKLGYRLFDGATDYGNEVEVGQGIKKA 62

Query: 65  IQDSGVPRNEIFLTTKLWCTQQR--NPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIK 122
           I +  V R+++F+ +KLW +     + + AL ++LQ LGLDY+DLY IH+P+  +    +
Sbjct: 63  IDEGLVKRSDLFVVSKLWNSYHHPDHVKLALKRNLQDLGLDYIDLYYIHFPIAFKFVPFE 122

Query: 123 DGNLFQFAEKPDGSKD---VDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLA 179
           +     F    D +++    + +   + T+  +++ +++G  K+IG+SNF+   ++DLL 
Sbjct: 123 EKYPPGFYTGVDDAREGILSEAKVPILDTYRALEECVDNGLIKSIGISNFNGVLVQDLLN 182

Query: 180 APTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLG-----------GENAP-I 227
               ++ P   Q+E HP L QE L+++ K  GI + AYS  G            ++ P +
Sbjct: 183 G--CRIKPVALQIEHHPYLTQEKLVEYCKLKGIQVVAYSSFGPQSFIELDSQLAKSTPSL 240

Query: 228 LSDPTVQEIAKANGVEA-GHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLSDSDV 283
           L  P +++IA A+       V++ WA Q+G+  +PKS    R++ NL V   +TL++ ++
Sbjct: 241 LEHPIIKKIAAAHRSSTPSEVLLRWATQRGIAVIPKSTKKERLLQNLNVEDSITLTEEEL 300

Query: 284 AKVDGLLK 291
            ++  L K
Sbjct: 301 NEISSLNK 308

>Suva_15.300 Chr15 (525715..526698) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  162 bits (411), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 159/308 (51%), Gaps = 29/308 (9%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----K 63
           +S + LN G  +P VGLG W+         + EA+K GYR  DGA  YGNE EVG    K
Sbjct: 2   SSLVTLNNGCKMPLVGLGCWKIDNKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQRNPQE---ALDQSLQRLGLDYVDLYLIHWPVPLRTEN 120
           AI +  V R +IF+T+KLW     +P     AL ++L  +GLDY+DLY IH+P+  +   
Sbjct: 62  AISEGLVTRKDIFVTSKLW-NNFHHPDHVKLALKKTLDDMGLDYLDLYYIHFPIAFKYVP 120

Query: 121 IKDG---NLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL 177
            ++      +  AE        +     I T+  ++  ++ G  K+IG+SNF  + ++DL
Sbjct: 121 FEEKYPPGFYTGAEDDKRGHITEAHVPIIDTYRALEACVDEGLIKSIGISNFQGSLVQDL 180

Query: 178 LAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLG-----------GENAP 226
           L     ++ P   Q+E HP L QE L+ + K + I + AYS  G            ++ P
Sbjct: 181 LRG--CRIKPVALQIEHHPYLTQEHLVDYCKLHDIQVVAYSSFGPQSFIEMDLGLAKSTP 238

Query: 227 ILSDPTVQEIAKAN--GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLSDS 281
            L +  V +    N  G     V++ WA Q+G+  +PKS    R++GNL++   LTL+D 
Sbjct: 239 TLFENDVVKKVSENHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKLTLTDQ 298

Query: 282 DVAKVDGL 289
           ++ ++  L
Sbjct: 299 ELKEISSL 306

>KLTH0G05786g Chr7 complement(460135..460995) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P47137 Saccharomyces
           cerevisiae YJR096W
          Length = 286

 Score =  161 bits (408), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 95/273 (34%), Positives = 155/273 (56%), Gaps = 36/273 (13%)

Query: 12  KLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAIQD---- 67
           KL++G  +P +GLGT+     E  + V +ALKAGYRH+D A +YGNE EVG+ ++     
Sbjct: 11  KLSSGYVLPSLGLGTYDIPRAETAEVVYQALKAGYRHLDTAVLYGNEREVGEGVEKWLKE 70

Query: 68  --SGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLG-LDYVDLYLIHWPVPLRTENIK 122
                 R+++F TTKLW +Q    N + A+ + L ++  L Y+D+ LIH P+        
Sbjct: 71  DPKNHRRHDVFYTTKLWNSQNGYSNAKRAIQECLDKVRPLGYIDMLLIHSPL-------- 122

Query: 123 DGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPT 182
                       G++        ++T++ MQ+ +++G  ++IGVSN+  +++ +LLA   
Sbjct: 123 -----------SGTR------RRLETYKAMQEAVDAGIVRSIGVSNYGKHHIDELLAWEE 165

Query: 183 TKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGV 242
            K  P VNQ+E+ P + ++DL  + K  G+V+EA+SPL   +   +  P V  +A+  G 
Sbjct: 166 LKHKPVVNQIEISPWVMRQDLADYCKSKGLVVEAFSPL--THGYKIKHPNVVRVAEEVGR 223

Query: 243 EAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV 275
             G V+I W++Q G V LPKS +  R+ GNL+V
Sbjct: 224 NTGQVLIRWSLQHGYVPLPKSRSVERLKGNLEV 256

>TBLA0F01720 Chr6 complement(430289..431269) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  162 bits (409), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 103/306 (33%), Positives = 159/306 (51%), Gaps = 26/306 (8%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----K 63
           +S   LN G  +P VGLG W+       + V +A+K GYR  DGA  YGNE EVG    +
Sbjct: 2   SSLAALNNGLKMPMVGLGCWKIPNTVCAEQVYQAIKLGYRLFDGAEDYGNEKEVGQGIRR 61

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQR--NPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           AI +  V R+++F+ +KLW T     + + A+ ++L  LGLDY+DLY IH+P+  +   I
Sbjct: 62  AIDEKIVKRSDLFIVSKLWNTYHHPDHVKLAVKKTLSDLGLDYLDLYYIHFPLAFKFVPI 121

Query: 122 KDG---NLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLL 178
           ++      +   E     K    +  ++ T+  M+ L+E G  K+IGVSN     L+D+L
Sbjct: 122 EEKYPPGFYTGKEDAAQGKISLQKVPYLDTYHAMEALVEEGLIKSIGVSNLQGGLLQDVL 181

Query: 179 AAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLG-----------GENAPI 227
                K+ P   Q+E HP L Q  L+ + K   I++ AYS  G            E+ P 
Sbjct: 182 MG--CKIKPVTLQIEHHPYLTQSRLVDYCKREQIIVVAYSSFGQQSYLELGSELKEDTPN 239

Query: 228 LSD-PTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLSDSDV 283
           L D P ++ IA    V    V++ WA Q G+  +PKS    R++ NL +   LTLS+ ++
Sbjct: 240 LFDHPVIKRIASKYNVTTSEVLLRWANQNGVAVIPKSSKKERLLMNLNIESTLTLSNEEL 299

Query: 284 AKVDGL 289
            ++  +
Sbjct: 300 VEISNI 305

>TPHA0E01860 Chr5 complement(373074..374054) [981 bp, 326 aa] {ON}
           Anc_5.409 YHR104W
          Length = 326

 Score =  161 bits (408), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 105/306 (34%), Positives = 164/306 (53%), Gaps = 26/306 (8%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----K 63
           +  + LN G  +P VGLG W+   +     V EA+K GYR  DGA  YGNE EVG    +
Sbjct: 2   SKLITLNNGLKMPIVGLGCWKIPNDTCAAQVYEAIKLGYRAFDGAQDYGNEKEVGEGINQ 61

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENI 121
           AI +  V R E+F+ +KLW +    ++ + AL ++L  + LDY+DLY IH+P+  +    
Sbjct: 62  AISEGIVKREELFVISKLWNSYHDPKHVKMALQRTLSDMKLDYLDLYYIHFPIAFKFVPF 121

Query: 122 KDGNLFQFAE-KPDGSKDVDLE--WNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLL 178
           ++     F   K D  K +  E     I T+  M++L   G  K+IG+SNF+   ++DLL
Sbjct: 122 EEKYPAGFYTGKEDAEKGIISEEVVPLIDTYRAMEQLATDGLIKSIGISNFNGALIQDLL 181

Query: 179 AAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGE-----------NAPI 227
              + K+ P   Q+E HP L Q  LI++ K N I + AYS  G +           +A +
Sbjct: 182 R--SCKIKPTCLQIEHHPYLTQPHLIEYCKLNDIQVVAYSSFGPQSFLELNVQKALDAKV 239

Query: 228 LSD-PTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLSDSDV 283
           L +   ++ IA  + VE   V++ WA Q+G+  +PKS    R++ NL +   LTLS+ ++
Sbjct: 240 LFEHEVIKSIATNHSVEPSQVLLRWATQRGIAIIPKSSKKERLLENLLIDEKLTLSEQEL 299

Query: 284 AKVDGL 289
           + +  L
Sbjct: 300 STISDL 305

>Ecym_7160 Chr7 (334780..335595) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii ABL209C
          Length = 271

 Score =  159 bits (403), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 97/279 (34%), Positives = 145/279 (51%), Gaps = 36/279 (12%)

Query: 10  TLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAI---- 65
           T  L  G  +P +GLG +   +N   + V +ALK GYRH D A  YGNE EVG+ I    
Sbjct: 5   TYTLTNGCLMPSLGLGCYSIPKNTTAQVVHQALKCGYRHFDTAVFYGNETEVGEGIAAWL 64

Query: 66  --QDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLG-LDYVDLYLIHWPVPLRTEN 120
               S   R ++F  TKLW +Q      + A+ Q LQ++  L Y+DL LIH P       
Sbjct: 65  AEDPSSNRRQDVFYVTKLWNSQNGYTEAKTAIQQCLQKVAPLGYIDLLLIHSPA------ 118

Query: 121 IKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180
              G+  + A                 T+E MQ+ +++G  K+IGVSN+  ++L++L A 
Sbjct: 119 --CGSAKRLA-----------------TYEAMQESVDAGIVKSIGVSNYERHHLQELYAM 159

Query: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240
           P  K  P VNQ+E+ P LP+ DL+ + K  G+ I+AYSPLG  +   ++DP +  +A   
Sbjct: 160 PNLKHNPVVNQIEVTPWLPRNDLVDYCKSIGLAIQAYSPLGCGDR--VNDPYIASLATQK 217

Query: 241 GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLS 279
                 ++I+W++ KG   LPK+    R+  NL    +S
Sbjct: 218 NCTPAQILIAWSLAKGYAPLPKTQNIQRLQSNLDSYNVS 256

>CAGL0C04543g Chr3 (434137..435000) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096w
          Length = 287

 Score =  159 bits (403), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 151/273 (55%), Gaps = 36/273 (13%)

Query: 12  KLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAI------ 65
           +L  G+ IP + LGT+    +   K V EALK GYRH D A +YGNE EVG+ I      
Sbjct: 12  ELQDGRKIPSLALGTYDIPNSVTAKVVTEALKCGYRHFDTAVLYGNEREVGQGIVNWINE 71

Query: 66  QDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRL-GLDYVDLYLIHWPVPLRTENIK 122
             +   R ++F TTKLW +Q      + A+ + +Q++ GL Y+D+ LIH P+  +     
Sbjct: 72  DKAHNKREDVFYTTKLWNSQNGYNEAKRAIKECMQKVSGLGYIDMLLIHSPLSGQRRR-- 129

Query: 123 DGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPT 182
                                  ++TW+ MQ+ ++ G  K+IGVSN+  +++++LL    
Sbjct: 130 -----------------------LETWKAMQEAVDEGIVKSIGVSNYGKHHIEELLGWDE 166

Query: 183 TKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGV 242
            K  P VNQ+E+ P + +++L  + K   +V+EAY+P+   +   ++DP ++EI+K  G+
Sbjct: 167 LKYKPVVNQIEISPWVMRQELADYCKSVNLVVEAYAPMA--HGYKMNDPGLREISKETGM 224

Query: 243 EAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV 275
             G ++I W++Q G + LPK+ T +R+  NL V
Sbjct: 225 NPGQLLIRWSLQHGYLPLPKTKTVARLASNLDV 257

>YJR096W Chr10 (611195..612043) [849 bp, 282 aa] {ON} Putative
           xylose and arabinose reductase; member of the aldo-keto
           reductase (AKR) family; GFP-fusion protein is induced in
           response to the DNA-damaging agent MMS
          Length = 282

 Score =  159 bits (402), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 151/280 (53%), Gaps = 36/280 (12%)

Query: 12  KLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAI-----Q 66
           KL+ G  IP + LGT+    ++  + V E +K GYRH D A +YGNE EVG  I     +
Sbjct: 7   KLSNGFKIPSIALGTYDIPRSQTAEIVYEGVKCGYRHFDTAVLYGNEKEVGDGIIKWLNE 66

Query: 67  DSG-VPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRL-GLDYVDLYLIHWPVPLRTENIK 122
           D G   R EIF TTKLW +Q   +  + A+ Q L  + GL Y+DL LIH P+        
Sbjct: 67  DPGNHKREEIFYTTKLWNSQNGYKRAKAAIRQCLNEVSGLQYIDLLLIHSPL-------- 118

Query: 123 DGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPT 182
                      +GSK + LE     TW  MQ+ ++ G  K+IGVSN+   ++ +LL  P 
Sbjct: 119 -----------EGSK-LRLE-----TWRAMQEAVDEGLVKSIGVSNYGKKHIDELLNWPE 161

Query: 183 TKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGV 242
            K  P VNQ+E+ P + +++L  + K  G+V+EA++PL   +   +++P + ++ K    
Sbjct: 162 LKHKPVVNQIEISPWIMRQELADYCKSKGLVVEAFAPLC--HGYKMTNPDLLKVCKEVDR 219

Query: 243 EAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSD 282
             G V+I W++Q G + LPK+ T  R+ GNL       SD
Sbjct: 220 NPGQVLIRWSLQHGYLPLPKTKTVKRLEGNLAAYNFELSD 259

>YHR104W Chr8 (323409..324392) [984 bp, 327 aa] {ON}  GRE3Aldose
           reductase involved in methylglyoxal, d-xylose,
           arabinose, and galactose metabolism; stress induced
           (osmotic, ionic, oxidative, heat shock, starvation and
           heavy metals); regulated by the HOG pathway
          Length = 327

 Score =  160 bits (405), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 102/308 (33%), Positives = 158/308 (51%), Gaps = 29/308 (9%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----K 63
           +S + LN G  +P VGLG W+  +      + EA+K GYR  DGA  YGNE EVG    K
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRK 61

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQRNPQE---ALDQSLQRLGLDYVDLYLIHWPVPLRTEN 120
           AI +  V R +IF+ +KLW     +P     AL ++L  +GLDY+DLY IH+P+  +   
Sbjct: 62  AISEGLVSRKDIFVVSKLW-NNFHHPDHVKLALKKTLSDMGLDYLDLYYIHFPIAFKYVP 120

Query: 121 IKDGNLFQFAEKPDGSKD---VDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL 177
            ++     F    D  K     +     I T+  +++ ++ G  K+IGVSNF  + ++DL
Sbjct: 121 FEEKYPPGFYTGADDEKKGHITEAHVPIIDTYRALEECVDEGLIKSIGVSNFQGSLIQDL 180

Query: 178 LAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLG-----------GENAP 226
           L     ++ P   Q+E HP L QE L++F K + I + AYS  G            +  P
Sbjct: 181 LRG--CRIKPVALQIEHHPYLTQEHLVEFCKLHDIQVVAYSSFGPQSFIEMDLQLAKTTP 238

Query: 227 ILSDPTVQEIAKAN--GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLSDS 281
            L +  V +    N  G     V++ WA Q+G+  +PKS    R++GNL++    TL++ 
Sbjct: 239 TLFENDVIKKVSQNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQ 298

Query: 282 DVAKVDGL 289
           ++  +  L
Sbjct: 299 ELKDISAL 306

>KLTH0F01892g Chr6 (149177..150085) [909 bp, 302 aa] {ON} similar to
           uniprot|P47137 Saccharomyces cerevisiae YJR096W
          Length = 302

 Score =  157 bits (396), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 99/286 (34%), Positives = 151/286 (52%), Gaps = 46/286 (16%)

Query: 6   NSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGE----V 61
           N  +  KLN G  +P +G G +     E  + V  AL+ GYRHID A VY N+ +    V
Sbjct: 8   NRDTRYKLNNGTEVPVIGFGVYDIPVEETAQRVYTALQEGYRHIDTAVVYENQKQAAQGV 67

Query: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLD------YVDLYLIHWPVP 115
            + ++++G PR E++ TTKLW TQQ   ++A  ++L+ +  D      YVDL L+H P+ 
Sbjct: 68  HRFLEETGTPREEVWFTTKLWNTQQ--GRDATPRALEEIAADVKEFIGYVDLLLLHSPL- 124

Query: 116 LRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKT-----KAIGVSNFS 170
                             D  +        ++TW ++++ ++   +     +AIGVSNF 
Sbjct: 125 -----------------TDAQRR-------LETWAVLERAVQEPASSALEIRAIGVSNFG 160

Query: 171 VNNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSD 230
           V +L++LL   T K  P V+Q+ELHP LP+ +L  F +ENGI+ EAYSPL       L D
Sbjct: 161 VRHLQELLEVATVK--PVVDQLELHPWLPRAELRAFLRENGILAEAYSPLT--QGVRLQD 216

Query: 231 PTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVL 276
           P +  +   +G+  G +++ W+  +G   L KS  P RI  NL VL
Sbjct: 217 PELLALEAKSGLSKGEILLRWSFLQGFAVLVKSNNPQRIRDNLAVL 262

>Smik_10.384 Chr10 (600097..600945) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  155 bits (391), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 149/280 (53%), Gaps = 36/280 (12%)

Query: 12  KLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAIQD---- 67
           KL+ G  IP + LGT+    ++  + V E +K GYRH D A +YGNE EVG  I      
Sbjct: 7   KLSNGIKIPSIALGTYEIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITRWLNE 66

Query: 68  --SGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRL-GLDYVDLYLIHWPVPLRTENIK 122
                 R +IF TTKLW +Q   R  + A+ Q L  + GL+Y+DL LIH P+        
Sbjct: 67  DPKNNKRTDIFYTTKLWNSQNGYRKAKAAIQQCLNEVSGLEYIDLLLIHSPL-------- 118

Query: 123 DGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPT 182
                      +GSK + LE     TW  MQ+ +++G  K+IGVSN+   ++ +LL    
Sbjct: 119 -----------EGSK-LRLE-----TWRAMQEAVDAGVVKSIGVSNYGRKHIDELLNWSE 161

Query: 183 TKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGV 242
            +  P VNQ+E+ P + +++L  + K  G+++EA++PL   +   +++P +  + K    
Sbjct: 162 LRHYPVVNQIEISPWIMRQELADYCKSKGLIVEAFAPLC--HGYKMTNPDLLIVCKEVDR 219

Query: 243 EAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSD 282
             G V+I W++Q G + LPK+ T  R+ GNL   +   SD
Sbjct: 220 NPGQVLIRWSLQHGYLPLPKTRTVKRLEGNLAAYSFELSD 259

>Smik_8.182 Chr8 (299804..300787) [984 bp, 327 aa] {ON} YHR104W
           (REAL)
          Length = 327

 Score =  156 bits (394), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 97/308 (31%), Positives = 159/308 (51%), Gaps = 29/308 (9%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVG----K 63
           +S + LN G  +P VGLG W+  +      + EA+K GYR  DGA  YGNE EVG    +
Sbjct: 2   SSLVTLNNGLKMPLVGLGCWKIDKKVCANQIYEAIKLGYRLFDGACDYGNEKEVGEGIRR 61

Query: 64  AIQDSGVPRNEIFLTTKLWCTQQRNPQE---ALDQSLQRLGLDYVDLYLIHWPVPLRTEN 120
           AI +  V R ++F+ +KLW     +P     AL ++L  +GLDY+DLY IH+P+  +   
Sbjct: 62  AISEGLVARKDVFVVSKLW-NNFHHPDHVKLALKKTLNDMGLDYLDLYYIHFPIAFKYVP 120

Query: 121 IKDGNLFQFAEKPDGSKD---VDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL 177
            ++     F    D  K     +     + T+  +++ ++ G  K+IG+SNF  + ++DL
Sbjct: 121 FEEKYPPGFYTGVDDEKKGHITEAHVPILDTYRALEECVDEGLIKSIGISNFQGSLVQDL 180

Query: 178 LAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLG-----------GENAP 226
           L     ++ P   Q+E HP L QE L++F + + I + AYS  G            +  P
Sbjct: 181 LRG--CRIKPVALQIEHHPYLTQEHLVEFCRLHNIQVVAYSSFGPQSFIEMDLQLAKTTP 238

Query: 227 ILSDPTVQEIAKAN--GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV---LTLSDS 281
            L +  V +    N  G     V++ WA Q+G+  +PKS    R++GNL++    TL++ 
Sbjct: 239 TLFENDVIKKISLNHPGSTTSQVLLRWATQRGIAVIPKSSKKERLLGNLEIEKKFTLTEQ 298

Query: 282 DVAKVDGL 289
           ++ ++  L
Sbjct: 299 ELKEISAL 306

>KNAG0D01370 Chr4 complement(230193..231041) [849 bp, 282 aa] {ON}
           Anc_7.468 YJR096W
          Length = 282

 Score =  153 bits (387), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 146/275 (53%), Gaps = 35/275 (12%)

Query: 10  TLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAIQD-- 67
           + KL +G  IP +GLGT+    +     V  AL+ GYRH+D A +YGNE EV +   +  
Sbjct: 6   SYKLASGFNIPTIGLGTYDLPPSNTTAIVEAALEVGYRHLDTAVLYGNEAEVAQGAMNFL 65

Query: 68  ---SGVPRNEIFLTTKLWCTQ--QRNPQEALDQSLQRLG-LDYVDLYLIHWPVPLRTENI 121
                V R +IF TTKLW +Q      + A+ + ++ +G L Y+DL L+H P+       
Sbjct: 66  GRHPDVSREDIFYTTKLWNSQFGYEKAKRAIRECVECIGGLGYIDLLLMHSPI------- 118

Query: 122 KDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181
                        G K V        TW+ MQ+ ++ G  ++IGVS++   +L+DL    
Sbjct: 119 -------------GGKQVRR-----GTWKAMQEAVDDGLVRSIGVSSYGQRHLEDLFEWS 160

Query: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241
             K  PAVNQ+E+ P + ++ L  + K  GIV+EAYSPL   +   L DP + ++A+  G
Sbjct: 161 ELKHAPAVNQIEISPWIMRQQLADYCKSKGIVVEAYSPL--THGYKLDDPDLLKVAEETG 218

Query: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVL 276
              G V++ W++Q G V LPK+ T SR+  NL V 
Sbjct: 219 KNPGQVLLRWSLQHGYVPLPKTKTVSRLQLNLDVF 253

>Kwal_47.18893 s47 (1017098..1017967) [870 bp, 289 aa] {ON} YJR096W
           - Hypothetical ORF [contig 189] FULL
          Length = 289

 Score =  153 bits (387), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 96/285 (33%), Positives = 150/285 (52%), Gaps = 37/285 (12%)

Query: 8   TSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAI-- 65
           ++T  L  G  IP + LG + + + E    V  ALK+GYRH+D A +YGNE EVG  I  
Sbjct: 6   STTKTLTNGVKIPVLALGVYEAPKEETEHTVFTALKSGYRHVDCAQLYGNEREVGLGIAK 65

Query: 66  ---QDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLG-LDYVDLYLIHWPVPLRTE 119
              +   V R+EIF TTK+          ++++ +SL+ +  ++Y+DL LIH P+    E
Sbjct: 66  FLKETPNVSRSEIFYTTKVSGDNHGYEKAKKSIIKSLEDVKEIEYIDLLLIHNPIAATEE 125

Query: 120 NIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLA 179
            +                          TW+ +Q+    GK +AIGVSN+S+ +L++L  
Sbjct: 126 RLG-------------------------TWKALQEAYAEGKVRAIGVSNYSIKHLEELYN 160

Query: 180 APTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKA 239
               KV P VNQ EL+P L +++L ++ ++ G+V+EA+SPL        SDP +QE+ K 
Sbjct: 161 WEGLKVEPMVNQFELNPWLTRKELCEYCEKKGMVLEAFSPLT--RGQKFSDPQLQELIKT 218

Query: 240 N--GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSD 282
           +        ++I W++Q G + LPKS    R + NL+ L    SD
Sbjct: 219 SYPNQTPAQILIRWSLQMGFIPLPKSSNSKRQISNLQALDFEISD 263

>Skud_10.318 Chr10 (568560..569408) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  152 bits (384), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 93/270 (34%), Positives = 145/270 (53%), Gaps = 36/270 (13%)

Query: 13  LNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAI------Q 66
           L+ G  IP + LGT+    ++  + V E +K GYRH D A +YGNE EVG  I       
Sbjct: 8   LSNGYRIPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGIIKWLNEN 67

Query: 67  DSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRL-GLDYVDLYLIHWPVPLRTENIKD 123
                R +IF TTKLW +Q   +  + A+ Q L  + GL Y+DL LIH P+         
Sbjct: 68  PESNKREKIFYTTKLWNSQNGYKRAKAAIQQCLNEVSGLKYIDLLLIHSPL--------- 118

Query: 124 GNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPTT 183
                     +GSK + LE     TW+ MQ+ ++ G  K+IGVSN+   ++ +LL  P  
Sbjct: 119 ----------EGSK-LRLE-----TWQAMQEAVDEGVVKSIGVSNYGKKHIDELLTWPDL 162

Query: 184 KVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGVE 243
              P VNQ+E+ P + +++L  + K  G+++EA++PL   +   +++P + ++ K     
Sbjct: 163 TYKPVVNQIEISPWVMRQELADYCKSKGLIVEAFAPLC--HGYKMTNPDLLKVCKEVDRN 220

Query: 244 AGHVVISWAVQKGLVTLPKSVTPSRIVGNL 273
            G V+I W++Q G + LPK+ T  R+ GNL
Sbjct: 221 PGQVLIRWSLQHGYLPLPKTKTVKRLEGNL 250

>NCAS0H00560 Chr8 complement(96020..96874) [855 bp, 284 aa] {ON}
           Anc_7.468
          Length = 284

 Score =  151 bits (382), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 93/275 (33%), Positives = 143/275 (52%), Gaps = 36/275 (13%)

Query: 13  LNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAI------Q 66
            N G  IP + LGT+   ++   K V EALKAGYRH D A +YGNE +VG+ I       
Sbjct: 10  FNNGNQIPSIALGTYDIPQSITAKIVYEALKAGYRHFDTAVLYGNEHQVGEGILQWIQED 69

Query: 67  DSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRL-GLDYVDLYLIHWPVPLRTENIKD 123
                R+++F TTKLW +Q      Q A+ + L ++ GL Y+D+ LIH P+  RT+ ++ 
Sbjct: 70  PQQNKRSDVFYTTKLWNSQNGYHQAQTAIKECLAKVHGLQYIDMLLIHSPLEGRTKRLE- 128

Query: 124 GNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPTT 183
                                   TW  MQ+ +ESG  K IGVSN+   ++++LL     
Sbjct: 129 ------------------------TWRAMQEAVESGLVKNIGVSNYGRQHVEELLQWERL 164

Query: 184 KVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGVE 243
            + P VNQ+E+ P + + +L  + K  G+V+EA++PL   +   L D  +  ++K  G  
Sbjct: 165 TIKPVVNQIEISPWVMRSELADYCKSVGLVVEAFAPLT--HGYKLHDADLVRVSKEVGRS 222

Query: 244 AGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTL 278
              V+I W++Q G + LPK+ T  R+  NL+    
Sbjct: 223 TVQVLIRWSLQHGYLPLPKTKTVKRLEENLEAYNF 257

>Suva_12.184 Chr12 (289608..290456) [849 bp, 282 aa] {ON} YJR096W
           (REAL)
          Length = 282

 Score =  150 bits (378), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 145/280 (51%), Gaps = 36/280 (12%)

Query: 12  KLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAIQD---- 67
           K + G  +P + LGT+    ++  + V E +K GYRH D A +YGNE EVG  I      
Sbjct: 7   KFSNGYKVPSIALGTYDIPRSQTAEIVYEGIKCGYRHFDTAVLYGNEKEVGDGITKWLHE 66

Query: 68  --SGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRL-GLDYVDLYLIHWPVPLRTENIK 122
                 R ++F TTKLW +Q   +  + A+ Q L  + GL Y+DL LIH P+        
Sbjct: 67  DPENNKREDVFYTTKLWNSQNGYKRAKVAIQQCLNEVSGLKYIDLLLIHSPL-------- 118

Query: 123 DGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPT 182
                      +GSK + LE     TW+ MQ+ ++ G  K+IGVSN+   ++ +LL    
Sbjct: 119 -----------EGSK-LRLE-----TWQAMQEAVDEGMVKSIGVSNYGKKHVDELLNWSQ 161

Query: 183 TKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGV 242
            K  P VNQ+E+ P + +++L  + K   +V+EA++PL   +   ++DP + ++ K    
Sbjct: 162 LKHKPVVNQIEISPWIMRQELADYCKSKNLVVEAFAPLC--HGYKMTDPDLLKVCKEVDR 219

Query: 243 EAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSD 282
             G V+I W++Q G + LPK+ T  R+  NL       SD
Sbjct: 220 NPGQVLIRWSLQHGYLPLPKTKTVKRLESNLAAYNFELSD 259

>Kwal_33.13276 s33 (153537..154445) [909 bp, 302 aa] {ON} YDL124W -
           Hypothetical ORF [contig 119] FULL
          Length = 302

 Score =  150 bits (378), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 151/292 (51%), Gaps = 37/292 (12%)

Query: 6   NSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGE----V 61
           N  +  KLN GQ IP +G G +   + +    V  ALK GYRHID A +Y N+ E    V
Sbjct: 8   NRETRYKLNNGQQIPVIGFGVYEIPKEDTADLVYSALKDGYRHIDTAVLYKNQKEAAQGV 67

Query: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLD------YVDLYLIHWPVP 115
            K + ++G  R  I+ TTKLW +Q    +E  +++LQ +  D      YVDL L+H P  
Sbjct: 68  RKYLDETGEARENIWFTTKLWDSQ--FGREETEKALQEVAADVKEYIGYVDLLLLHSPRG 125

Query: 116 LRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLK 175
                ++   + + A +  GSK +++                    K+IGVSNF V++L+
Sbjct: 126 GAKRRLETWAILEQAVQEPGSKALEI--------------------KSIGVSNFGVDHLE 165

Query: 176 DLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQE 235
           +LL     KV P ++Q+ELHP LP+ +L K+ KE  I  EAYSPL       L DP +  
Sbjct: 166 ELLK--VAKVKPVLDQLELHPWLPRVELRKYLKEKDIFAEAYSPLT--QGYRLQDPELLA 221

Query: 236 IAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDSDVAKVD 287
           +    G+    +++ W+  +G V L KS  P RI  NL VL  S++D  KV+
Sbjct: 222 LEAKTGINKAVILLRWSFLQGFVVLVKSSNPERIRQNLAVLP-SENDSWKVE 272

>KLTH0G02420g Chr7 complement(188767..189636) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  149 bits (377), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/286 (33%), Positives = 151/286 (52%), Gaps = 37/286 (12%)

Query: 6   NSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAI 65
            +++T  L  G  IP +G GT+ + + +    V  A K GYRH+D A +Y NE E   A+
Sbjct: 4   TASTTKTLTNGVKIPVLGFGTYETPKEKAESIVHAAFKQGYRHVDTAQLYENERECATAV 63

Query: 66  -----QDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLG-LDYVDLYLIHWPVPLR 117
                +   V R+++F TTK+          ++++ +SL+    L+YVDL+LIH P    
Sbjct: 64  AKFLKESPKVSRDQVFYTTKVAGDNHGYEKAKKSIIESLEMAKELEYVDLFLIHNPCAE- 122

Query: 118 TENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL 177
                        EK  G            T++ +Q+  ++GK KAIGVS++S+ +L++L
Sbjct: 123 ------------TEKRLG------------TYKALQEFYKAGKIKAIGVSSYSIKHLEEL 158

Query: 178 LAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIA 237
            +    +V P VNQ EL+P L ++DL+K+ KE  +VIEA+SP+    +   SDP VQ++ 
Sbjct: 159 YSWEGLEVKPMVNQFELNPWLTRKDLVKYCKERDLVIEAFSPIT--RSKRFSDPVVQKLL 216

Query: 238 KAN--GVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLSDS 281
           K +  G     ++I W++Q G V LPKSV   R   NL  L    S
Sbjct: 217 KESYPGRTPAQLLIRWSLQMGFVPLPKSVHEDRAESNLHALDFEIS 262

>KAFR0G00920 Chr7 complement(215664..216524) [861 bp, 286 aa] {ON}
           Anc_7.468 YJR096W
          Length = 286

 Score =  148 bits (374), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 96/276 (34%), Positives = 145/276 (52%), Gaps = 37/276 (13%)

Query: 10  TLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAIQDSG 69
           T KL++   IP V LGT+    +E  + V  AL  GYRH D A +Y NE EV + I +  
Sbjct: 8   TYKLSSNYYIPTVALGTYDLPSSETTEIVENALDVGYRHFDTAVLYDNEEEVAQGISNWL 67

Query: 70  V-----PRNEIFLTTKLWCTQ--QRNPQEALDQSLQRL-GLDYVDLYLIHWPVPLRTENI 121
           +      R+EIF TTKLW +Q   +N + A+ + + ++  L Y+DL L+H P+       
Sbjct: 68  IRHPETKRDEIFYTTKLWNSQFGYQNAKRAIRECVDKVQDLKYIDLLLMHSPI------- 120

Query: 122 KDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181
                        G   +  E     TW  MQ+ ++ G  K+IGVSNF + +LK+L    
Sbjct: 121 -------------GGPQIREE-----TWRAMQEAVDEGIVKSIGVSNFGIKHLKELFQWD 162

Query: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKA-- 239
             K  P VNQ+E+ P L +++L  F K  G+V+EAY+PL   +   ++ P + +I+    
Sbjct: 163 GLKYRPVVNQIEISPWLMRQELADFCKMEGLVVEAYAPLT--HGYKINHPDLIKISNELN 220

Query: 240 NGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV 275
           N    G ++I W++Q G V LPK+ T  R+  NL V
Sbjct: 221 NTKNTGQILIRWSLQHGYVPLPKTKTIGRLESNLDV 256

>SAKL0F02574g Chr6 complement(220827..221696) [870 bp, 289 aa] {ON}
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 289

 Score =  148 bits (373), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 161/290 (55%), Gaps = 39/290 (13%)

Query: 9   STLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGE----VGKA 64
           +T  L  G  +P +GLG +++ + E    V  ALK GYR +D A +YGNE E    + K 
Sbjct: 7   TTHALKNGVKMPCLGLGLYQTPKEETTNIVHNALKLGYRQVDSAQLYGNEREACLGITKF 66

Query: 65  IQDS-GVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLG-LDYVDLYLIHWPVPLRTEN 120
           +++S  V R++IF TTK+    Q   + ++++++SL R+  LDY+DL+LIH P+  + + 
Sbjct: 67  LEESPKVSRSDIFFTTKIKTQDQGYESAKKSIEESLNRVKELDYIDLFLIHAPLTNKEKR 126

Query: 121 IKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAA 180
           +                          TW+  Q+  E+GK KAIGVSN+ + +L+++   
Sbjct: 127 LG-------------------------TWKAFQEYYETGKIKAIGVSNYGIQHLEEMYQW 161

Query: 181 PTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKAN 240
              K+ P VNQ EL+P L +++L  +  + G+VI+AYSPL    A  L DP + ++ + +
Sbjct: 162 DGLKIDPMVNQYELNPWLTRKELSNYCHQKGMVIQAYSPLT--RARRLQDPELVKLVEDS 219

Query: 241 GVE--AGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV--LTLSDSDVAKV 286
             E  +  ++++W++Q G V L K+V   R+  N+K     LS +D+ K+
Sbjct: 220 YPEQTSAQILVNWSLQMGFVPLVKTVHEDRLKENIKSCDFELSSADLKKL 269

>ZYRO0G17600g Chr7 (1455426..1456277) [852 bp, 283 aa] {ON} highly
           similar to uniprot|P47137 Saccharomyces cerevisiae
           YJR096W
          Length = 283

 Score =  147 bits (371), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 95/288 (32%), Positives = 152/288 (52%), Gaps = 48/288 (16%)

Query: 16  GQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAIQD------SG 69
           G  IP + LG +    ++    V EALK GYRH D A +YGNE EVG+ I        + 
Sbjct: 12  GIKIPSLALGCYDIPRSQTANVVYEALKRGYRHFDTAVLYGNEKEVGEGIYKWLKEDPAN 71

Query: 70  VPRNEIFLTTKLWCTQ------QRNPQEALDQSLQRLGLDYVDLYLIHWPV--PLRTENI 121
             R ++F TTKLW +Q      +R   E +++ ++ LG  Y+DL LIH P+  P R    
Sbjct: 72  NKREDVFYTTKLWNSQNGYSPAKRGISECMNK-VKELG--YIDLLLIHSPLSGPRRR--- 125

Query: 122 KDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAP 181
                                   ++T++ MQ+ ++ G  K+IGVSN+   ++++L    
Sbjct: 126 ------------------------LETYQAMQEAVDDGIVKSIGVSNYGKQHIEELYKWD 161

Query: 182 TTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241
             K  P  NQ+E+ P   +EDL  + +  G+++EA+SPL   +   L +P +  +AK  G
Sbjct: 162 KLKHKPVANQIEISPWCMREDLTSWCQSKGLIVEAFSPL--THGYKLKEPGLVSLAKKLG 219

Query: 242 VEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV--LTLSDSDVAKVD 287
            + G V+I W++Q+GL+ LPK+  P+R+  NL+V    L+  DV ++D
Sbjct: 220 RDTGQVLIRWSLQRGLLPLPKTQNPARLSSNLEVYDFELTPEDVKELD 267

>KLLA0F05775g Chr6 (560270..561199) [930 bp, 309 aa] {ON} highly
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 309

 Score =  147 bits (372), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 108/303 (35%), Positives = 170/303 (56%), Gaps = 52/303 (17%)

Query: 13  LNTGQTIPQV---GLGT--WRSKENEGY--KAVIEALKA------GYRHIDGAAVYGNEG 59
           L+ G  IP V   G GT  ++S+E +    + +++ +K       G  HID A +Y    
Sbjct: 9   LSNGNKIPAVAIVGTGTAWYKSEETDATFSQPLVDIVKKTLDTVPGVVHIDAAEIYRTYP 68

Query: 60  EVGKAIQDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLGLDYVDLYLIHWPVPLR 117
           E+G A++D+  PR+EIF+T K    +Q   NP+ AL+ SL++LG+DYVDLYL+H P+   
Sbjct: 69  ELGAALKDTKKPRDEIFITDKYSTLKQLSENPKVALETSLKKLGVDYVDLYLLHSPI--- 125

Query: 118 TENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL 177
              IK+  L             D+E N    W+ +++L +SGK K IGVSNF+V +L+ L
Sbjct: 126 ---IKESKL-------------DVEAN----WKYLEELYKSGKAKNIGVSNFAVKDLEKL 165

Query: 178 LAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPLGG-ENAPILSD--PT 232
           LA    +V P VNQ+E  P L  +   +++F ++NGI++EAYSPLG  +  P  +D  P 
Sbjct: 166 LAV--AEVKPQVNQIEFSPFLQNQTPGIVEFSQKNGILLEAYSPLGPLQRRPEDADKLPF 223

Query: 233 VQEIA----KANGVEAGHVVISWAVQKGLVTLPKSVTPSRI--VGNLKVLTLSDSDVAKV 286
            Q IA    K N  EA  +++SW  ++G++ +  S    RI    ++   +L++ +V K+
Sbjct: 224 YQYIAELSKKYNKSEA-QILLSWVYERGILPVTTSSKIERIQQAQDIFSFSLANEEVQKI 282

Query: 287 DGL 289
             L
Sbjct: 283 TQL 285

>TDEL0C03320 Chr3 (591171..592022) [852 bp, 283 aa] {ON} Anc_7.468
           YJR096W
          Length = 283

 Score =  146 bits (369), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 94/282 (33%), Positives = 153/282 (54%), Gaps = 38/282 (13%)

Query: 13  LNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAIQD----- 67
           L+ G  IP + LGT+   ++     V EALK GYRH D A +Y NE +VG+ I       
Sbjct: 9   LSNGVKIPSLALGTYDLPKSTTANIVYEALKCGYRHFDTAVLYNNERKVGEGIYQWLQED 68

Query: 68  -SGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRL-GLDYVDLYLIHWPVPLRTENIKD 123
                R ++F TTKLW +Q   +  ++A+ + LQ++  L Y+DL LIH P+         
Sbjct: 69  PKNNKREDVFYTTKLWNSQNGYQPAKQAIKECLQKVEKLGYIDLLLIHSPL--------- 119

Query: 124 GNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPTT 183
                      GS+        ++T++ MQ+ ++ G  K+IGVSN+  ++L++LL+    
Sbjct: 120 ----------SGSR------KRLETYKAMQEAVDEGIVKSIGVSNYGQHHLEELLSWEGL 163

Query: 184 KVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGVE 243
           K  P VNQ+E+ P   +++L ++ +  GIV+E Y+PL   +   L DP + ++A+  G  
Sbjct: 164 KYKPVVNQIEISPWCMRQELAQWCQSQGIVVEDYAPLT--HGYKLKDPQLVKVAEEVGKN 221

Query: 244 AGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV--LTLSDSDV 283
            G V+I W++Q G + LPK+    R+ GNL V    L++S +
Sbjct: 222 TGQVLIRWSLQHGYLPLPKTSNVDRLPGNLDVYDFKLTESQI 263

>ABL209C Chr2 complement(11410..12342) [933 bp, 310 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR096W
          Length = 310

 Score =  140 bits (354), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 84/273 (30%), Positives = 139/273 (50%), Gaps = 37/273 (13%)

Query: 12  KLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGEVGKAI-----Q 66
           +L+ G  IP VGLG ++  E      V EAL+ GYR  D A  Y NE  V + I      
Sbjct: 14  RLSDGTQIPSVGLGVYQVSEQTVQDLVYEALEVGYRLFDSAQAYHNEDGVARGIAAWLKH 73

Query: 67  DSGVPRNEIFLTTKLWCTQQRN---PQEALDQSLQRLG-LDYVDLYLIHWPVPLRTENIK 122
             G  R +++ TTK+  TQ       +++L++SL   G L Y+DL L+H P+  RT  + 
Sbjct: 74  APGRRREDVYFTTKI-NTQNHGYEATKKSLEKSLHAAGPLGYIDLVLVHAPMSDRTRRLG 132

Query: 123 DGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPT 182
                                    TW+ +++ +  G+ ++IGVSN+   +L +LL    
Sbjct: 133 -------------------------TWQALEEAVVEGQVRSIGVSNYGQQHLSELLGWEG 167

Query: 183 TKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGV 242
            K+ P VNQVE++P L +++L+++ +EN I ++A+SPL       L DP +Q++A     
Sbjct: 168 LKIRPVVNQVEINPWLCRQELVQYCRENNIAVQAFSPL--MRGKRLDDPILQKVAHQYDK 225

Query: 243 EAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV 275
               +++ W++Q G + LPK+    R+  N  +
Sbjct: 226 GVAQILVRWSIQMGFIVLPKAAKKERLAPNFDI 258

>Smik_4.113 Chr4 (216885..217823) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  140 bits (352), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 104/306 (33%), Positives = 153/306 (50%), Gaps = 53/306 (17%)

Query: 11  LKLNTGQTIPQV---GLGT-WRSKE-------NEGYKAVIEALK-AGYRHIDGAAVYGNE 58
           + LN G  IP +   G GT W  +E       N   + ++ ALK  G  HID A +Y   
Sbjct: 8   ITLNNGNKIPAIAIIGTGTRWYKEEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTY 67

Query: 59  GEVGKAIQDSGVPRNEIFLTTKLWCTQ---QRNPQEALDQSLQRLGLDYVDLYLIHWPVP 115
            EVGKA+  +  PRNEIFLT K + TQ     +P   LD +L+++G DYVDLYL+H P  
Sbjct: 68  PEVGKALSLTEKPRNEIFLTDK-YSTQIKVSESPAVGLDIALKKMGTDYVDLYLLHSPFV 126

Query: 116 LRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLK 175
                 K+ N F   E                 W+ M++L  SGK K IGVSNF++ +L+
Sbjct: 127 -----SKETNGFTLEE----------------AWKDMEQLYRSGKAKNIGVSNFAMKDLE 165

Query: 176 DLLAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPLG--------GENA 225
            +L     ++ P VNQ+E  P L  +   + KF +EN I++EAYSPLG         E+ 
Sbjct: 166 RILKV--AEIRPQVNQIEFSPFLQNQTPGIYKFCQENDILLEAYSPLGPLQKRTTKDESL 223

Query: 226 PILSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRI--VGNLKVLTLSDSDV 283
           P      V+E+++        + + W  ++G++ +  S  P RI    NL    L+D +V
Sbjct: 224 PFFE--YVKELSEKYIKSEAQITLRWVTRRGVLPVTTSSKPQRISDAQNLFSFDLTDEEV 281

Query: 284 AKVDGL 289
            ++  L
Sbjct: 282 NQITEL 287

>NCAS0A13740 Chr1 complement(2699208..2700137) [930 bp, 309 aa] {ON}
           Anc_7.285
          Length = 309

 Score =  139 bits (350), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 105/312 (33%), Positives = 159/312 (50%), Gaps = 57/312 (18%)

Query: 13  LNTGQTIPQV---GLGT--WRSKENEGY--KAVIEALKA-----GYRHIDGAAVYGNEGE 60
           LN G  IP +   G GT  ++++E +    + +++ LK      G  HID A +Y    E
Sbjct: 10  LNNGNKIPAIAVIGTGTRWFKTEETDATFSQQLVDELKVALTLPGIVHIDAAEIYRTYPE 69

Query: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQR---NPQEALDQSLQRLGLDYVDLYLIHWPVPLR 117
           V  A+++S  PR+EIF+T K + TQ +   +P   L+ SL+ LGLDYVDLYL+H P    
Sbjct: 70  VAAALRESNRPRDEIFITDK-YSTQLKLSDDPIAGLNISLKTLGLDYVDLYLLHSPF--- 125

Query: 118 TENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL 177
              IK+G+  +                  + W+ M+KL +SGK K IGVSNF V +L+ +
Sbjct: 126 ---IKNGSTLE------------------ECWKQMEKLYKSGKAKNIGVSNFRVEDLEKI 164

Query: 178 LAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPLG--------GENAPI 227
           L   T K  P +NQ+E +  L  +   ++KF KEN I +EAY+PLG         E  P 
Sbjct: 165 LKIATIK--PQINQIEFNAALQNQSPGIVKFCKENNIQLEAYTPLGPFQRIQDTPEAKPF 222

Query: 228 LSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRI--VGNLKVLTLSDSDVAK 285
                + E++K        +++ W  ++G++ +  S  P R+    NL    L  S+V K
Sbjct: 223 YD--YIAELSKKYNKTEAQILLRWVTKRGILPVTTSSKPQRLHDAQNLFSFDLESSEVDK 280

Query: 286 VDGL-LKAKGER 296
           +  L LK K  R
Sbjct: 281 ITELGLKLKATR 292

>TDEL0D02790 Chr4 complement(533517..534506) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  137 bits (344), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 106/311 (34%), Positives = 162/311 (52%), Gaps = 54/311 (17%)

Query: 13  LNTGQTIPQV---GLGT--WRSKENEG--YKAVIEALKA-----GYRHIDGAAVYGNEGE 60
           LN G  IP V   G GT  ++++E E    K ++E +K      G  H+D A  Y    E
Sbjct: 29  LNNGNKIPAVAVVGTGTTWFKNEETESNFSKELVEQIKYALTLPGIVHLDAAECYNTYQE 88

Query: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQRNPQ--EALDQSLQRLGLDYVDLYLIHWPVPLRT 118
           +G+A+++S  PR+EIF+T K   T + +    E  +  ++++G+DYVDLYLIH P+    
Sbjct: 89  LGQALRESPKPRDEIFITDKFSPTPKNHGGVLERFESGIKKMGVDYVDLYLIHSPL---I 145

Query: 119 ENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLL 178
           E  K+G              V LE    + W+ ++KL E+GK K IGVSNF V +L+ +L
Sbjct: 146 EKEKNG--------------VTLE----EVWKDLEKLYEAGKAKNIGVSNFRVEDLQRIL 187

Query: 179 AAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPLGGENAPILSDPT---- 232
                KV P VNQ+E H  L  +   ++KF ++N I +EAY+PLG    P+    +    
Sbjct: 188 KV--AKVKPQVNQIEFHVFLQNQTPGIVKFSQDNNIQLEAYTPLG----PLQRKQSDAGD 241

Query: 233 ----VQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRI--VGNLKVLTLSDSDVAKV 286
               V+E+AK  G     V++ W  ++ ++ +  S  P RI    +L    L+D +V K+
Sbjct: 242 FYNYVEELAKKYGKTEAQVLLRWVTRRHVLPITTSSKPQRIQAAQDLFSFDLTDEEVKKI 301

Query: 287 DGL-LKAKGER 296
             L LK K  R
Sbjct: 302 TELGLKHKPLR 312

>YDL124W Chr4 (240259..241197) [939 bp, 312 aa] {ON} NADPH-dependent
           alpha-keto amide reductase; reduces aromatic alpha-keto
           amides, aliphatic alpha-keto esters, and aromatic
           alpha-keto esters; member of the aldo-keto reductase
           (AKR) family
          Length = 312

 Score =  134 bits (337), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 100/301 (33%), Positives = 149/301 (49%), Gaps = 47/301 (15%)

Query: 13  LNTGQTIPQV---GLGT-WRSKE-------NEGYKAVIEALK-AGYRHIDGAAVYGNEGE 60
           LN G  IP +   G GT W   E       N   + ++ ALK  G  HID A +Y    E
Sbjct: 10  LNNGNKIPAIAIIGTGTRWYKNEETDATFSNSLVEQIVYALKLPGIIHIDAAEIYRTYPE 69

Query: 61  VGKAIQDSGVPRNEIFLTTKL--WCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRT 118
           VGKA+  +  PRN IFLT K         +P + LD +L+++G DYVDLYL+H P   + 
Sbjct: 70  VGKALSLTEKPRNAIFLTDKYSPQIKMSDSPADGLDLALKKMGTDYVDLYLLHSPFVSKE 129

Query: 119 ENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLL 178
            N                  + LE    + W+ M++L +SGK K IGVSNF+V +L+ +L
Sbjct: 130 VN-----------------GLSLE----EAWKDMEQLYKSGKAKNIGVSNFAVEDLQRIL 168

Query: 179 AAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPLGGENAPILSDPT---- 232
                +V P VNQ+E  P L  +   + KF +E+ I++EAYSPLG        D +    
Sbjct: 169 K--VAEVKPQVNQIEFSPFLQNQTPGIYKFCQEHDILVEAYSPLGPLQKKTAQDDSQPFF 226

Query: 233 --VQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRI--VGNLKVLTLSDSDVAKVDG 288
             V+E+++        +++ W  ++G++ +  S  P RI    NL    L+  +V K+  
Sbjct: 227 EYVKELSEKYIKSEAQIILRWVTKRGVLPVTTSSKPQRISDAQNLFSFDLTAEEVDKITE 286

Query: 289 L 289
           L
Sbjct: 287 L 287

>CAGL0J09394g Chr10 (925839..926774) [936 bp, 311 aa] {ON} similar
           to uniprot|Q07551 Saccharomyces cerevisiae YDL124w
          Length = 311

 Score =  134 bits (336), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 100/305 (32%), Positives = 147/305 (48%), Gaps = 51/305 (16%)

Query: 11  LKLNTGQTIPQV---GLGTWRSKENEG----YKAVIEALKA-----GYRHIDGAAVYGNE 58
            KLN G  +P V   G GT   K NE      + +++ LK      G  H+D A  Y   
Sbjct: 7   FKLNNGHEMPGVAIVGTGTKWHKVNETDENFSQTLVDQLKYALSLPGVVHLDAAEFYMTY 66

Query: 59  GEVGKAIQDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLGLDYVDLYLIHWPVPL 116
            EVG+A+ ++  PR+EIF+T K W   +   NP   L+  L+RLGL+YVDLYL+H P   
Sbjct: 67  REVGRALAETSKPRDEIFITDKYWTLSKVTENPIVGLETGLKRLGLEYVDLYLLHSPFI- 125

Query: 117 RTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKD 176
                K+ N F   E                 W +M++L  SGK K IGVSNF+  +L+ 
Sbjct: 126 ----SKETNGFSLEE----------------AWGMMEELYHSGKAKNIGVSNFAKEDLER 165

Query: 177 LLAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPLG--------GENAP 226
           +L     KV P VNQ+E +  L  +   +  F K+N I + AYSPLG        G + P
Sbjct: 166 VLKV--CKVKPQVNQIEFNAFLQNQTPGIYNFCKQNDIQLAAYSPLGPLQKKPADGNSQP 223

Query: 227 ILSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLT--LSDSDVA 284
             S   + ++A+      G V++ W  ++G+V +  S    RI    ++    L D +V 
Sbjct: 224 FYS--YINKLAQHYNKTPGQVLLRWVTKRGVVAVTTSEKKERIKQAQEIFEFDLKDDEVT 281

Query: 285 KVDGL 289
           ++  L
Sbjct: 282 EITKL 286

>Skud_4.131 Chr4 (235946..236884) [939 bp, 312 aa] {ON} YDL124W
           (REAL)
          Length = 312

 Score =  132 bits (333), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 99/302 (32%), Positives = 152/302 (50%), Gaps = 49/302 (16%)

Query: 13  LNTGQTIPQV---GLGT-W-------RSKENEGYKAVIEALK-AGYRHIDGAAVYGNEGE 60
           LN G  IP +   G GT W        +  N   + ++ AL+  G  HID A +Y    E
Sbjct: 10  LNNGNKIPAIAIIGTGTRWFKNVETDATFSNSLVEQIMYALELPGIVHIDAAEIYRTYPE 69

Query: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQR---NPQEALDQSLQRLGLDYVDLYLIHWPVPLR 117
           VGKA+  +  PR+EIFLT K + TQ +   +P   L+ SL+++G DYVDLYL+H P    
Sbjct: 70  VGKALSLTKKPRDEIFLTDK-YSTQIKVSDSPAAGLEVSLKKMGTDYVDLYLLHSPFV-- 126

Query: 118 TENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL 177
               K+ N F   E                 W+ M++L ++GK K IGVSNF+V +L+ +
Sbjct: 127 ---SKEANGFTLEE----------------AWKDMEQLYKAGKAKNIGVSNFAVKDLEKI 167

Query: 178 LAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPLGGENAPILSDPT--- 232
           L     +V P VNQ+E  P L  +   + KF ++N I++EAYSPL         D +   
Sbjct: 168 LK--IAEVKPQVNQIEFSPFLQNQTPGIYKFCQDNNILLEAYSPLAPLQKKTAQDDSKPF 225

Query: 233 ---VQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRI--VGNLKVLTLSDSDVAKVD 287
              V+E+++        +++ W  ++G++ +  S  P RI    NL    L+D +V ++ 
Sbjct: 226 FEYVKELSEKYFKSEAQIILRWVSKRGVLPVTTSSKPQRISDAQNLFSFDLTDEEVDEIT 285

Query: 288 GL 289
            L
Sbjct: 286 EL 287

>Kpol_1020.13 s1020 (27790..28731) [942 bp, 313 aa] {ON}
           (27790..28731) [942 nt, 314 aa]
          Length = 313

 Score =  132 bits (331), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 147/296 (49%), Gaps = 54/296 (18%)

Query: 11  LKLNTGQTIPQV---GLGT-WRSK---ENEGYKAVIEALKA-----GYRHIDGAAVYGNE 58
             LN G  IP +   G GT W  +   E+     ++E +K      G  HID A  YG  
Sbjct: 8   FDLNNGNQIPSISIIGTGTRWFKRPGSEHTFSDELVEQIKYALSLPGIIHIDAAECYGTY 67

Query: 59  GEVGKAIQDSGVPRNEIFLTTKLWCTQQR---NPQEALDQSLQRLGLDYVDLYLIHWPVP 115
            E+ KA+++S  PR+EIF+T K + TQ +   +P E L+  L+ LGLDYVDLYLIH P  
Sbjct: 68  PELAKALKESSKPRSEIFITDK-YSTQTKFTNDPIEGLNTGLKTLGLDYVDLYLIHSP-- 124

Query: 116 LRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLK 175
                      F     P+    + LE    K W+ M+ L + GK K+IGVSNFSV N++
Sbjct: 125 ----------FFD----PEFKGSLTLE----KVWKDMETLYKEGKAKSIGVSNFSVKNIE 166

Query: 176 DLLAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPLGGENAPILSDPT- 232
           ++L     K  P VNQ+E +  L  +   ++ + ++N I +EAYSPLG    P+   P  
Sbjct: 167 EILKIAGIK--PQVNQIEFNAFLQNQTPGIVNYCQKNNIQLEAYSPLG----PLQKRPEN 220

Query: 233 ---------VQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLS 279
                    + E+A   G     ++++W   +G++ +  S    RI+    + + +
Sbjct: 221 SNELPFYNYIDELASKYGKTDSQILLNWVYNRGILPITTSSKTQRIIDAQNIFSFN 276

>NDAI0A02300 Chr1 (516594..517535) [942 bp, 313 aa] {ON} Anc_7.285
          Length = 313

 Score =  129 bits (325), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 98/308 (31%), Positives = 150/308 (48%), Gaps = 48/308 (15%)

Query: 7   STSTLKLNTGQTIPQV---GLGT-WRSKENEGYK---AVIEALKA-----GYRHIDGAAV 54
           S     LN G  IP +   G GT W   + E  K    +++ L+      G  HID A +
Sbjct: 4   SQEFFTLNNGNKIPAISIIGTGTKWHHGKLESGKFSDELVDQLQYALTLPGIIHIDAAEM 63

Query: 55  YGNEGEVGKAIQDSGVPRNEIFLTTKLWCTQQR---NPQEALDQSLQRLGLDYVDLYLIH 111
           Y    EV KA++ +   R+EIF+T K +    +   NP   L +SL+ L LDYVDLYL+H
Sbjct: 64  YNTYPEVNKALKSTSKVRDEIFITDKYYSGSPKLTENPIAGLTKSLKELELDYVDLYLLH 123

Query: 112 WPVPLRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSV 171
            P               F  K          +   + W+ M+KL + GK K IGVSNFSV
Sbjct: 124 SP---------------FITKESCG------YTMEEAWKQMEKLYKDGKAKNIGVSNFSV 162

Query: 172 NNLKDLLAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPLGG-ENAPIL 228
           ++LK +L     ++ P +NQ+E +  L  +   ++KF +++ I++EAYSPLG     P  
Sbjct: 163 DDLKRILK--ICEIKPQINQIEFNAFLQNQTPGIVKFCQDHDILVEAYSPLGPLRKKPTD 220

Query: 229 SDP-----TVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRI--VGNLKVLTLSDS 281
            DP      ++E+AK  G   G V++ W  ++ ++ +  S    RI    +L    L+  
Sbjct: 221 RDPGPFYQYIEELAKKYGKSEGQVLLRWVTKRKILPITTSGKEERIKDAQDLFSFDLTSE 280

Query: 282 DVAKVDGL 289
           +V K+  L
Sbjct: 281 EVEKITKL 288

>SAKL0F09746g Chr6 complement(746292..747230) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  129 bits (324), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 101/321 (31%), Positives = 159/321 (49%), Gaps = 48/321 (14%)

Query: 13  LNTGQTIPQV---GLGT-WRSKENEGYK---AVIEALKA-----GYRHIDGAAVYGNEGE 60
           LN G  IP V   G GT W   E    K    +++ +K      G  HID A +Y    E
Sbjct: 10  LNNGNKIPAVAVIGTGTKWFKTEENASKFSDELVDQVKYALTLPGVVHIDAAEIYRTYPE 69

Query: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLGLDYVDLYLIHWPVPLRT 118
           +GKA++++  PRNEI++T K   + +   NP    +  L+ LG+DY+DLYL+H   P  T
Sbjct: 70  LGKALRETKKPRNEIWITDKYSTSLKLSDNPIVGFENGLKELGVDYIDLYLLH--SPFIT 127

Query: 119 ENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLL 178
           E               G     LE    + W+ +++L +SGK K IGVSNF+  +L+ +L
Sbjct: 128 E---------------GRNGFTLE----QAWKYLEELYKSGKAKNIGVSNFAKEDLERIL 168

Query: 179 AAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPLGG-ENAPILSDP---- 231
                ++ P VNQ+E    L  +   +  F KEN I++EAYSPLG  +  P  +D     
Sbjct: 169 K--IAEIKPQVNQIEYSAFLQNQTPGIYNFAKENDILLEAYSPLGPLQRRPEEADSLPFY 226

Query: 232 -TVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLT--LSDSDVAKVDG 288
             + E+A+  G     V++ W  ++G++ +  S  P R+     + T  L+ ++V K+  
Sbjct: 227 KYINELAEKYGKSEAQVLLRWVSKRGVLPVTTSSKPHRVHDAQHIFTFDLTSTEVEKITE 286

Query: 289 L-LKAKGERRTCYQDFSPFPI 308
           L LK +  R     ++S F +
Sbjct: 287 LGLKHEALRLYWVDEYSKFNV 307

>Kpol_381.8 s381 complement(20844..21359,21366..21695,21698..21781)
           [930 bp, 309 aa] {ON}
           complement(20844..21359,21366..21695,21698..21781) [930
           nt, 310 aa]
          Length = 309

 Score =  128 bits (321), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 89/275 (32%), Positives = 136/275 (49%), Gaps = 45/275 (16%)

Query: 45  GYRHIDGAAVYGNEGEVGKAIQDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLGL 102
           G  H+D A  Y    E+ KA+++S  PRNEIF+T K     +   NP EAL+ +L  LGL
Sbjct: 53  GIVHVDAAEYYRTYPELNKALKESSKPRNEIFITDKFSTLLKITANPIEALNTALDSLGL 112

Query: 103 DYVDLYLIHWPVPLRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTK 162
           DYVDLY++H+P                 E     KD+ +E      W  M+ L + GK K
Sbjct: 113 DYVDLYVLHFP-----------------EFDPEYKDLSIE----TAW--MELLYKEGKAK 149

Query: 163 AIGVSNFSVNNLKDLLAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPL 220
            IGVSNFS+ +L+ ++      V P VNQ+E +  L  +   ++K+ ++NG  +EAYSPL
Sbjct: 150 NIGVSNFSIEHLERVMK--IADVKPQVNQIEFNAFLQNQTPGIVKYCQQNGFQLEAYSPL 207

Query: 221 GGENAPILSDPT----------VQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIV 270
               AP+   P           + E++   G     +++ W  ++G+V +  S    RIV
Sbjct: 208 ----APLQRKPKNFNELPFYKYIDEVSAKYGKTDSEILLRWVTKRGIVPITTSSRHERIV 263

Query: 271 G--NLKVLTLSDSDVAKVDGLLKAKGERRTCYQDF 303
              NL    L+D +V K+  L   +   R  + +F
Sbjct: 264 NAQNLFSFDLTDEEVDKITKLGLEQPALRLYWNEF 298

>KNAG0C04110 Chr3 (806389..807324) [936 bp, 311 aa] {ON} Anc_7.285
           YDL124W
          Length = 311

 Score =  128 bits (321), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 96/310 (30%), Positives = 150/310 (48%), Gaps = 47/310 (15%)

Query: 4   LQNSTSTLKLNTGQTIPQV---GLGT-WRSKENEGY---KAVIEALK-----AGYRHIDG 51
           + ++ + + LN G  +P V   G GT W  K+ + +     +IE L+      G  HID 
Sbjct: 1   MSHNQAFVTLNNGHKMPAVAIIGTGTHWHHKKEKDHALSHELIEQLEFALSLPGVVHIDA 60

Query: 52  AAVYGNEGEVGKAIQDSGVPRNEIFLTTK--LWCTQQRNPQEALDQSLQRLGLDYVDLYL 109
           A +YG   E+  A++ +  PR+EIF+T K  L     ++P   L+ SL+   LDYVDLYL
Sbjct: 61  AEMYGTYPELSAALRMTEKPRSEIFITDKHALHAAMSKDPIAGLEDSLKANNLDYVDLYL 120

Query: 110 IHWPVPLRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNF 169
           +H P             F   EKP     + LE      W  M++L + GK K IGVSNF
Sbjct: 121 LHSP-------------FVAKEKPG----LTLE----GAWRQMEQLYKDGKAKNIGVSNF 159

Query: 170 SVNNLKDLLAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPLGGENAPI 227
           SV +LK +L+    ++ P VNQ+E HP L  +   ++KF ++  I +EA++PLG      
Sbjct: 160 SVEDLKRVLS--VAEIKPQVNQIEFHPFLQNQTPGILKFCQDENIELEAFTPLGPLQVKT 217

Query: 228 LSDPT------VQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVG--NLKVLTLS 279
             D        +  ++         +++ W  ++G++ +  S    RI    NL    L 
Sbjct: 218 QEDENDEFFKYISSLSGKYQKTEAQIILRWVTKRGVIPVTTSRRHDRIADAQNLFEFDLE 277

Query: 280 DSDVAKVDGL 289
           D +V K+  L
Sbjct: 278 DEEVTKITRL 287

>KLTH0G00638g Chr7 (43280..44221) [942 bp, 313 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 313

 Score =  126 bits (317), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 95/305 (31%), Positives = 149/305 (48%), Gaps = 51/305 (16%)

Query: 15  TGQTIPQVGLGT---WRSKENEGYKA----------VIEALKAGYRHIDGAAVYGNEGEV 61
           +G  +P +G G+   WR  + EG K           V  A+KAG+ HID A  Y    EV
Sbjct: 13  SGDKLPVIGFGSGTKWRIAKAEGEKKDQFIQELADQVSNAIKAGFNHIDAAEAYKTHPEV 72

Query: 62  GKAIQDSGVPRNEIFLTTKL----WCTQQ-RNPQEALDQSLQRLGLDYVDLYLIHWPVPL 116
           G  I +SGVPR ++++T K     W  ++ + P E+L+ SL ++ + YVDLYL+H P   
Sbjct: 73  GAGIANSGVPREKLWVTDKYTPWSWTWRKGKGPLESLELSLGKMQMQYVDLYLVHVPFI- 131

Query: 117 RTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKD 176
                           P+ +  +DL+    + W  M+++ + G  K IGVSNF V +L+ 
Sbjct: 132 ---------------NPE-TAGIDLK----EAWRQMEEIYDRGWAKNIGVSNFDVESLEY 171

Query: 177 LLAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPL----GGENAPILSD 230
           +      K  P VNQ+E    + Q+   +I + K++GI IE YSPL     G+  P+  D
Sbjct: 172 IRT--IGKYQPVVNQIEFSAYMQQQSPGIISYCKKHGIAIEGYSPLVPLTKGKPGPL--D 227

Query: 231 PTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV--LTLSDSDVAKVDG 288
             +  +AK  G     +++ W VQ G++ +  S    RI  +L +    LS  D   +  
Sbjct: 228 DILPLMAKKYGKSELQILLRWVVQNGVIAITTSAQQKRIDESLDIFDFELSSEDFTSITE 287

Query: 289 LLKAK 293
           + K K
Sbjct: 288 VGKTK 292

>ZYRO0C09196g Chr3 complement(698826..699764) [939 bp, 312 aa] {ON}
           highly similar to uniprot|Q07551 Saccharomyces
           cerevisiae YDL124W NADPH-dependent alpha-keto amide
           reductase reduces aromatic alpha-keto amides aliphatic
           alpha-keto esters and aromatic alpha-keto esters
          Length = 312

 Score =  124 bits (312), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 100/303 (33%), Positives = 147/303 (48%), Gaps = 51/303 (16%)

Query: 13  LNTGQTIPQV---GLGT-WRSKE----NEGYKAVIEALKA----GYRHIDGAAVYGNEGE 60
           LN G  IP V   G GT W  KE    N  +  V +   A    G  H+D A VY    E
Sbjct: 10  LNNGNKIPAVAVIGTGTRWYKKEETDANFSHALVKQIEYALTLPGVVHVDHAEVYRTYPE 69

Query: 61  VGKAIQDSGVPRNEIFLTTKLWCTQQR---NPQEALDQSLQRLGLDYVDLYLIHWPVPLR 117
             +A++++  PRNEIF+T K +  Q++   +P+E LD  L+R GL+YVDLYL+H P    
Sbjct: 70  FSEALKNTKKPRNEIFVTDK-YSVQEKITNDPREGLDTGLKRTGLEYVDLYLLHSPFA-- 126

Query: 118 TENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL 177
               K+ N F   E                 W  +++L   GK K IGVSNF V +L+ +
Sbjct: 127 ---SKEKNGFTIEE----------------AWAQLEELYHEGKAKNIGVSNFRVEDLEKI 167

Query: 178 LAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPLG-------GENAPIL 228
           L     KV P VNQ+E    L  +   ++KF +++ I +EAY+PLG        E A   
Sbjct: 168 LKV--AKVKPQVNQIEFSAFLQNQTPGVVKFSQDHDIQLEAYAPLGPLSKRDESEQAKPF 225

Query: 229 SDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRI--VGNLKVLTLSDSDVAKV 286
            D   +   K +  EA  +++ W  ++G++ +  S  P RI    NL    L+  +V ++
Sbjct: 226 YDYIKKLTEKYSKTEA-QILLRWVSKRGILPVTTSGQPKRIEDAQNLFGFDLTKDEVDEI 284

Query: 287 DGL 289
             L
Sbjct: 285 TKL 287

>KAFR0B01200 Chr2 (224411..225358) [948 bp, 315 aa] {ON} Anc_7.285
           YDL124W
          Length = 315

 Score =  124 bits (310), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 104/326 (31%), Positives = 160/326 (49%), Gaps = 60/326 (18%)

Query: 13  LNTGQTIPQV---GLGT-WRSKEN--EGY-KAVIEALKA-----GYRHIDGAAVYGNEGE 60
           LN G  +P +   G GT W   E   E + + +++ +K      G  HID A VY    E
Sbjct: 11  LNNGNKMPSIAIIGTGTAWYKTEETPETFSQELVDQIKYALTLPGIVHIDAAEVYRTYPE 70

Query: 61  VGKAIQDSG--VPRNEIFLTTKLWCTQQR---NPQEALDQSLQRLGLDYVDLYLIHWPVP 115
           VGKA+++S    PR+EIF+T K + TQ +   NP   L   L++LGLDYVDLYL+H P  
Sbjct: 71  VGKALRESHNVKPRDEIFITDK-YSTQLKISENPMVGLTNGLKKLGLDYVDLYLLHSPFI 129

Query: 116 LRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLK 175
                 K+ N F   E                 W+ M+ L ++GK K IGVSNFS+ +L+
Sbjct: 130 -----SKEKNGFTMEE----------------AWKYMEDLYKAGKVKNIGVSNFSMADLQ 168

Query: 176 DLLAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPLG----------GE 223
            +L +   +V P VNQ+E +  L  +   ++ F +EN I + AY+PLG           E
Sbjct: 169 RILKS--CEVKPQVNQIEFNAFLQNQTPGIVNFCRENDIQVVAYTPLGPLQRKSKNFEQE 226

Query: 224 NAPILSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLT--LSDS 281
           N        V+++A+        +++ W  ++G++ +  S    RI     + T  L+DS
Sbjct: 227 NFHKF----VKQLAEKYDKSEAQILLRWVSKRGIIPVTTSSKEKRIKDAQYLFTFDLTDS 282

Query: 282 DVAKVDGL-LKAKGERRTCYQDFSPF 306
           +V K+  L LK + +R      +  F
Sbjct: 283 EVEKITQLGLKHEPQRMYWNDQYDKF 308

>Kwal_47.19278 s47 complement(1169418..1170362) [945 bp, 314 aa]
           {ON} YDL124W - Hypothetical ORF [contig 344] FULL
          Length = 314

 Score =  123 bits (309), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 96/332 (28%), Positives = 159/332 (47%), Gaps = 58/332 (17%)

Query: 4   LQNSTSTLKLN-TGQTIPQVGLGT---WRSKENEGYKA----------VIEALKAGYRHI 49
           + +   TL+L  +G  IP +G G+   WR  +  G K           V  A+ AG+ HI
Sbjct: 1   MNSKIPTLRLKGSGDEIPIIGFGSGTKWRIAKASGEKKDQFITELADQVTSAINAGFNHI 60

Query: 50  DGAAVYGNEGEVGKAIQDSGVPRNEIFLTTKL--WCTQQRN---PQEALDQSLQRLGLDY 104
           D A  Y    EVG+ +++SGVPR+++++T K   W    R    P E+L  SL+++ + Y
Sbjct: 61  DAAEAYKTHPEVGRGVKNSGVPRDKLWITDKYTPWSWDWRKGTGPLESLSLSLEKMQMSY 120

Query: 105 VDLYLIHWPVPLRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAI 164
           VDLYL+H  VP  T                 +  +DL+    + W  M+++ + G  K I
Sbjct: 121 VDLYLLH--VPFITVQ---------------TAGIDLK----EAWRQMEEIYDRGLAKNI 159

Query: 165 GVSNFSVNNLKDLLAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPL-- 220
           GVSNF V +L+ +      K  P VNQ+E +  L Q+   +I + K++ IV+E YSPL  
Sbjct: 160 GVSNFDVESLEYI--TKIGKYLPVVNQIEFNAYLQQQSPGIIAYCKDHDIVVEGYSPLVP 217

Query: 221 --GGENAPILSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV--L 276
              G   P+  D  +  +A+        +++ W  Q G+V +  S   +R+  ++ +   
Sbjct: 218 LTKGRPGPL--DKLLPALAEKYHKSELQILLRWVTQNGVVVITTSAQQARVKESVNIFDF 275

Query: 277 TLSDSDVAKVDGLLKAK------GERRTCYQD 302
            L+  D   +  + + K      GE+ + Y D
Sbjct: 276 ELTAEDFDSITKIGREKIFRGFMGEQYSKYDD 307

>ZYRO0E09614g Chr5 complement(765913..766839) [927 bp, 308 aa] {ON}
           similar to uniprot|Q07551 Saccharomyces cerevisiae
           YDL124W NADPH-dependent alpha-keto amide reductase
           reduces aromatic alpha-keto amides aliphatic alpha-keto
           esters and aromatic alpha-keto esters
          Length = 308

 Score =  119 bits (299), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 93/308 (30%), Positives = 146/308 (47%), Gaps = 67/308 (21%)

Query: 14  NTGQTIPQVGLGT---WRSKENEG----------YKAVIEALKAGYRHIDGAAVYGNEGE 60
            T   IP +G GT   WR  + EG             ++ A+  G+ HID A  Y    E
Sbjct: 13  ETHTHIPVLGFGTGTQWRIAKREGETKGQFIDKLVDQLVTAVDLGFNHIDTAEFYLTHEE 72

Query: 61  VGKAIQDSGVPRNEIFLTTK--------LWCTQQRNPQEALDQSLQRLGLDYVDLYLIHW 112
           VG+A++ S +PR+++F+T K        L C+    P +A  + L+ LG+ Y DLY++H 
Sbjct: 73  VGEALRRSQLPRDKLFITDKYNQGAWTGLDCS---GPIQAAKKGLEALGIKYFDLYMLH- 128

Query: 113 PVPLRTENIKDGNLFQFAEKPDGSKD---VDLEWNFIKTWELMQKLLESGKTKAIGVSNF 169
                              +PD +K+   +DL+    + W  +++L E+G  KAIGVSNF
Sbjct: 129 -------------------RPDITKENAGIDLQ----EAWRQVEELYEAGIAKAIGVSNF 165

Query: 170 SVNNLKDLLAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPLGGENAPI 227
            +  LK + +    +  P V+QVE HP L  +   ++++ +   IV+EAYSPL    AP+
Sbjct: 166 PLETLKQMESY--CRYLPMVHQVEFHPYLQNQSPGVVEWCQNKHIVVEAYSPL----APL 219

Query: 228 LS------DPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVL--TLS 279
                   D  +  + K  G     +V+ W + +G+V L  S    RI   L  L   L 
Sbjct: 220 FRARPGPLDDILPNLMKKYGKSETQIVLRWVIDRGIVALTTSSKEERIHEILGTLDFELE 279

Query: 280 DSDVAKVD 287
            SDV  ++
Sbjct: 280 KSDVELIN 287

>TBLA0F01980 Chr6 (493378..494286) [909 bp, 302 aa] {ON} Anc_7.285
           YDL124W
          Length = 302

 Score =  119 bits (297), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 89/289 (30%), Positives = 144/289 (49%), Gaps = 41/289 (14%)

Query: 8   TSTLKLNTGQTIPQV---GLGTWRSKEN--EGY-----KAVIEALK-AGYRHIDGAAVYG 56
           TS + LN G  IP +   G GT   K N  + Y     K +  AL+  G  HID A +Y 
Sbjct: 5   TSLITLNNGNKIPGISIIGTGTRWYKYNPEDKYSDALVKQIENALELPGMLHIDCAEMYQ 64

Query: 57  NEGEVGKAIQDSGVPRNEIFLTTKLWCTQQ--RNPQEALDQSLQRLGLDYVDLYLIHWPV 114
              EVG+A+++S  PR+EIF+T K    ++   NP+E L  +L+++GL+YVDLYL+H+P 
Sbjct: 65  THAEVGEALRNSKKPRDEIFITDKYAIPRKFSSNPKEGLKLALEKMGLEYVDLYLLHFP- 123

Query: 115 PLRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNL 174
                 I D  L+ F           LE    + W++M+ L   G  K IGVSNF V +L
Sbjct: 124 ------IIDPKLYDFT----------LE----EAWKMMEDLYNEGLAKNIGVSNFRVEDL 163

Query: 175 KDLLAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYS---PLGGENAPILS 229
           + L  + +  + P +NQ+E +  L  +   +  +  +N I +EA+    PL   N   L 
Sbjct: 164 EQL--SKSWVIKPQINQIEFNAYLQNQTPGIYDYCIKNNIQLEAFCPLVPLREVNEKDLL 221

Query: 230 DPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTL 278
              V+++A+        +++ W  Q+ ++ +  S  P R+     + + 
Sbjct: 222 PLYVKQLAQKYSKTENQIMLRWVSQRKVIPVTTSSRPERVRDAYDIFSF 270

>SAKL0F00704g Chr6 (60941..61888) [948 bp, 315 aa] {ON} similar to
           uniprot|Q07551 Saccharomyces cerevisiae YDL124W
           NADPH-dependent alpha-keto amide reductase reduces
           aromatic alpha-keto amides aliphatic alpha-keto esters
           and aromatic alpha-keto esters
          Length = 315

 Score =  115 bits (288), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 93/323 (28%), Positives = 149/323 (46%), Gaps = 52/323 (16%)

Query: 10  TLKLNTGQTIPQVGLGT---WRSKENEG----------YKAVIEALKAGYRHIDGAAVYG 56
           TLK  +G  +P +G G+   WR  ++ G             V  A++ G+ HID A  Y 
Sbjct: 10  TLK-GSGDLLPSIGFGSGTKWRIAKSSGKTKGVYIDALADQVTNAIQCGFNHIDTAEAYK 68

Query: 57  NEGEVGKAIQDSGVPRNEIFLTTKL--WCTQQRN---PQEALDQSLQRLGLDYVDLYLIH 111
              EVG  I ++ VPR  +++T K   W  + R    P E+L  SL+ + LDYVDLY+IH
Sbjct: 69  TYKEVGTGISNAQVPRETLWITDKYTPWSWEWRKGSGPLESLTLSLKEMNLDYVDLYMIH 128

Query: 112 WPVPLRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSV 171
            P                  K  G   +DL+    + W  M+++      + IGVSNF V
Sbjct: 129 VP--------------NITTKTAG---IDLK----EAWLQMEEIYTRKMARNIGVSNFDV 167

Query: 172 NNLKDLLAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYSPL----GGENA 225
            +L+ + +    K  P VNQ+E    + Q+   ++K+ +EN IV+E YSPL     G+  
Sbjct: 168 ESLEYIKSF--AKYQPVVNQIEFSAYMQQQSPGILKYCRENNIVVEGYSPLVPLTKGKPG 225

Query: 226 PILSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV--LTLSDSDV 283
           P+  D  +  IA   G     V++ W  Q G+V +  +    R+  +L +    LS  D 
Sbjct: 226 PL--DEILPGIAAKYGKSQLQVLLRWVTQNGIVVITTTGKKERLNESLNIFDFELSKEDF 283

Query: 284 AKVDGLLKAKGERRTCYQDFSPF 306
            ++  + + K  R   +  +  +
Sbjct: 284 DQITNVGREKILRNYMHMLYEKY 306

>Ecym_3264 Chr3 complement(503010..503945) [936 bp, 311 aa] {ON}
           similar to Saccharomyces cerevisiae YDL124W
          Length = 311

 Score =  114 bits (284), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 81/224 (36%), Positives = 122/224 (54%), Gaps = 41/224 (18%)

Query: 13  LNTGQTIPQ---VGLGTWRSKE---NEGYKAVIEALKA-----GYRHIDGAAVYGNEGEV 61
           LN G +IP    VG+G   +K     +G K ++E LK      G+ HI  A  Y N G +
Sbjct: 11  LNNGNSIPAITTVGVGNKWTKIYGIRDGAKNLMEYLKEILALPGFLHIMTAEFYPNNGLL 70

Query: 62  GKAIQDSGVPRNEIFLTTKLWCTQQR---NPQEALDQSLQRLGLDYVDLYLIHWPVPLRT 118
             A++ S  PR+EI++T K +C+Q +   +P EAL++SL RLG DYVDLYLIH P     
Sbjct: 71  SAALKASQKPRHEIWITDK-YCSQCKLSSSPIEALERSLDRLGFDYVDLYLIHNPC---- 125

Query: 119 ENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLL 178
                         P+G   + LE    K W+ M+ L ++GK K IGVSNF + +L+ L 
Sbjct: 126 ----------LDSSPNG---ISLE----KAWKQMELLYKTGKVKNIGVSNFRIEDLERLK 168

Query: 179 AAPTTKVTPAVNQVELHPLLPQE--DLIKFGKENGIVIEAYSPL 220
            A   ++ P VN++E H  L  +  ++ ++ K + +++  YSPL
Sbjct: 169 DA---EIKPQVNEIEFHAFLQNQTPNIYEYAKTHDLLLCGYSPL 209

>Kwal_33.13274 s33 (151643..151969) [327 bp, 108 aa] {ON} YJR096W -
           Hypothetical ORF [contig 119] FULL
          Length = 108

 Score = 67.0 bits (162), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 55/102 (53%), Gaps = 6/102 (5%)

Query: 6   NSTSTLKLNTGQTIPQVGLGTWRSKENEGYKAVIEALKAGYRHIDGAAVYGNEGE----V 61
           N  +  KLN GQ IP +G G +   + +    V  ALK GYRHID A +Y N+ E    V
Sbjct: 8   NRETRYKLNNGQQIPVIGFGVYEIPKEDTADRVYSALKDGYRHIDTAVLYRNQKEAAQGV 67

Query: 62  GKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQSLQRLGLD 103
            K + ++G  R  I+ TTKLW +Q    +E   ++LQ +  D
Sbjct: 68  RKYLDETGEARENIWFTTKLWDSQ--FGREETKKALQEVAAD 107

>Suva_4.122 Chr4 (228898..228945,228942..229163,229167..229517) [621
           bp, 206 aa] {ON} YDL124W (REAL)
          Length = 206

 Score = 54.3 bits (129), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 48/179 (26%), Positives = 80/179 (44%), Gaps = 31/179 (17%)

Query: 60  EVGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEAL--DQSLQRLGLDYVDLYLIHWPVPLR 117
           EVG+A+  +  P+ EIFLT K     + +   A+  D +L+++ ++YVD++ +H P   +
Sbjct: 21  EVGEALSLTKKPKTEIFLTDKSSTQTEVSATLAMRPDMALKKISVEYVDMHFLHSPFVFK 80

Query: 118 TENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL 177
             N+ +                      +K       L  S K    G S+ +V  L+ +
Sbjct: 81  QANVLN----------------------LKDAMHTDHLRRSNKANNRGASSVNVEELRRV 118

Query: 178 LAAPTTKVTPAVNQVELHPLLPQED--LIKFGKENGIVIEAYS---PLGGENAPILSDP 231
           L   T    P VNQ++L   L  +   + K  +EN I++  YS   PL  +NA   S P
Sbjct: 119 LK--TEDEEPQVNQIKLRSSLRNQTPGISKLCQENDILMAVYSTLDPLQRKNARNDSQP 175

>Suva_12.272 Chr12 complement(441543..442262,442266..442340) [795
           bp, 265 aa] {ON} YDL124W (REAL)
          Length = 265

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 91/206 (44%), Gaps = 41/206 (19%)

Query: 26  TWRSKENEGYKAVIEALKAGYRHIDGAAVY-GNEGEVGKAIQDSGVPRNEIFLTTKL--- 81
           T+    N+    ++  LKAG + ID A +Y  NE    KAI +  +P +   + TK    
Sbjct: 9   TFSLLSNQNSNEIVTVLKAGVKDIDTARIYPDNE----KAIGELQLP-DRFTIHTKASGF 63

Query: 82  --WCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKDGNLFQFAEKPDGSKDV 139
              C  + N  +++++SL  LG+  V+ +L+H P P                      ++
Sbjct: 64  SGGCLTRDNINKSIEESLSLLGVPSVETFLLHSPDP----------------------EI 101

Query: 140 DLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDLLAAPTTK--VTPAVNQVELHPL 197
            LE    +T + +  L E GK +  G+SNFS  ++K +     +K  V P V Q   + L
Sbjct: 102 PLE----ETLDAINSLYEQGKFEKFGLSNFSTEDVKRIYDYAKSKDYVLPTVYQGNYNAL 157

Query: 198 LPQ--EDLIKFGKENGIVIEAYSPLG 221
                 DL    KE  I + AYSP+ 
Sbjct: 158 SRAIVNDLFPLLKELHISLYAYSPIA 183

>Suva_9.17 Chr9 (18179..19105) [927 bp, 308 aa] {ON} YNL331C (REAL)
          Length = 308

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/195 (25%), Positives = 81/195 (41%), Gaps = 41/195 (21%)

Query: 37  AVIEALKAGYRHIDGAAVYGNEGEVGKAIQDSGVPRNEIFLTTKL-----WCTQQRNPQE 91
           A++E  KAG + ID A +Y +  ++   +Q   +P N   + TK       C  + N  +
Sbjct: 27  AILE--KAGVKDIDTARIYPDSEKIIGELQ---LP-NRFTIHTKASGFSGGCLTKDNINK 80

Query: 92  ALDQSLQRLGLDYVDLYLIHWPVPLRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWEL 151
           ++++SL  LG+  V+ + +H P P                          E    +T   
Sbjct: 81  SIEESLSLLGVPSVETFFLHSPDP--------------------------ETPIEETLGA 114

Query: 152 MQKLLESGKTKAIGVSNFSVNNLKDLLAAPTTK--VTPAVNQVELHPL--LPQEDLIKFG 207
           +  L E GK K  G+SNF+  ++K +     +K  V P V Q   +      + DL    
Sbjct: 115 INSLYEQGKFKKFGLSNFATEDVKRIYEYAKSKNFVLPTVYQGSYNAFSRAIENDLFPLL 174

Query: 208 KENGIVIEAYSPLGG 222
           +E      AYSP+ G
Sbjct: 175 RELHFSFYAYSPIAG 189

>TPHA0H00110 Chr8 (10204..11241) [1038 bp, 345 aa] {ON} 
          Length = 345

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/292 (21%), Positives = 103/292 (35%), Gaps = 91/292 (31%)

Query: 29  SKENEGYKAVIEALKAGYRHIDGAAVYGN---EGEVGKAIQDSGVPRNEIFLTTKLWC-- 83
           S + E ++ +      G R  D A  Y N   E  +G+ ++   + R  + + +KL+   
Sbjct: 37  SDKEEVFRLLKYCYDKGLRTYDTANTYSNGVSEQLLGEFLKRYNIRRETVVIMSKLFFPA 96

Query: 84  ---------------------------TQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPL 116
                                        +RN  E+  QS++RLG  Y+D+  IH     
Sbjct: 97  DDSLPDFQLTNGFKDEEEKLHLINQFGLNRRNVIESAKQSVERLGT-YMDVLQIH----- 150

Query: 117 RTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKD 176
                                  D E  F +T   +  ++ +G TK IG S        +
Sbjct: 151 ---------------------RCDRETPFEETMRALNDVVNAGYTKYIGASLMRATEFAE 189

Query: 177 L-LAAPTTKVTPAVNQVELHPLLPQED---LIKFGKENGIVIEAYSPL---------GGE 223
           +   A        VN   LH L+ +ED   LI F K++GI +  YSPL         G +
Sbjct: 190 MQFIAEKHDWHKFVNVQSLHNLIYREDERELIPFTKKHGIALTPYSPLQKGYLAKPYGTK 249

Query: 224 NAPILSD-------------------PTVQEIAKANGVEAGHVVISWAVQKG 256
                +D                     V++++K   V    V ++W +Q+G
Sbjct: 250 TVRNTTDKHMLRIKIDNMRDSDKEIISRVEKVSKDKKVSMAEVSLAWLIQQG 301

>Kpol_400.9 s400 complement(19154..20179) [1026 bp, 341 aa] {ON}
           complement(19154..20179) [1026 nt, 342 aa]
          Length = 341

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 64/283 (22%), Positives = 100/283 (35%), Gaps = 88/283 (31%)

Query: 35  YKAVIEALKAGYRHIDGAAVYGN-EGEV--GKAIQDSGVPRNEIFLTTKLWCTQQRN--- 88
           +K +  A   G R  D A VY N E E+  G+ +++  +PR  + + TKL+     N   
Sbjct: 43  FKILKYAYDKGLRTYDTANVYSNGESEIILGEFLKNYKIPRETVIIMTKLYFPTNDNADY 102

Query: 89  ------PQEALDQ-----------------SLQRLGLDYVDLYLIHWPVPLRTENIKDGN 125
                 P+  L+                  S++RLG  Y D+  IH   P          
Sbjct: 103 DIFSMTPEAILNNVNITGLSRKNIINSARDSVRRLGT-YADIIQIHRADP---------- 151

Query: 126 LFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL-LAAPTTK 184
                + P           F +T   +  ++  G T+ IG S+       ++   A    
Sbjct: 152 -----DTP-----------FEETMRALNDIVVDGLTRYIGASSMLATEFVEMQFIAEKND 195

Query: 185 VTPAVNQVELHPLLPQED---LIKFGKENGIVIEAYSPL--GGENAPILSDPT------- 232
               +N    + LL +ED   LI F K + I +  +SPL  G    P+    T       
Sbjct: 196 WFKFINSQSCYNLLYREDERELIPFAKRHNIALTPWSPLQRGVLCRPVGETSTRFEKDQF 255

Query: 233 -------------------VQEIAKANGVEAGHVVISWAVQKG 256
                              V+EIAK    +   V + W +QKG
Sbjct: 256 MSIGNIKDINSSDEEIITRVEEIAKKRNTKMATVALYWVIQKG 298

>Ecym_2296 Chr2 complement(574287..575309) [1023 bp, 340 aa] {ON}
           similar to Ashbya gossypii ABR094W
          Length = 340

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 65/148 (43%), Gaps = 42/148 (28%)

Query: 41  ALKAGYRHIDGAAVYG-NEGEVGKAIQD--SGVPRNEIFLTTKL-------WCTQQRNPQ 90
           A+  G   ID +  YG +E   GKA+Q+     PR E F+ TK+       +   + N +
Sbjct: 50  AMSRGINAIDTSPYYGPSEIIYGKALQEIKDEFPREEYFICTKVGRVGRAEFNYSKENVR 109

Query: 91  EALDQSLQRLGLDYVDLYLIHWPVPLRTENIKDGNLFQFAEKPDGSKDVDLEW-NFIKTW 149
            ++ +S +RL  DY+DL  +H                            D+E+  + K W
Sbjct: 110 FSVKRSCERLHTDYLDLVYLH----------------------------DIEYVEYDKIW 141

Query: 150 EL---MQKLLESGKTKAIGVSNFSVNNL 174
           E    ++KL + G  + IG+S + V+ L
Sbjct: 142 EALRELRKLKDEGVIRHIGISGYPVDLL 169

>TDEL0A08000 Chr1 (1399350..1400309) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/136 (24%), Positives = 59/136 (43%), Gaps = 30/136 (22%)

Query: 91  EALDQSLQRLGLDYVDLYLIHWPVPLRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWE 150
           E++ QS   L +D V++Y +H P P+                              +T +
Sbjct: 80  ESIKQSFDELKVDSVEIYYLHAPDPITP--------------------------IEETID 113

Query: 151 LMQKLLESGKTKAIGVSNFSVNNLKDLLAAPTTK--VTPAVNQVELHPLLP--QEDLIKF 206
            + +L + GK K  G+SN++ +++K +     +K  V P V Q   +      ++DL   
Sbjct: 114 AINELYKQGKFKKFGLSNYTPDDVKKIYEYAKSKNYVLPTVFQGNYNAFSRSIEKDLFPV 173

Query: 207 GKENGIVIEAYSPLGG 222
            ++ GI   AYSP+ G
Sbjct: 174 LRKYGISFYAYSPIAG 189

>TBLA0G01120 Chr7 complement(285827..286858) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 64/315 (20%), Positives = 115/315 (36%), Gaps = 96/315 (30%)

Query: 31  ENEGYKAVIEALKAGYRHIDGAAVYGN---EGEVGKAIQDSGVPRNEIFLTTKLWC---- 83
           +NE +K +  A  +G R  D A  Y N   E  +G+ +++  +PR  + + TK+W     
Sbjct: 39  KNEVFKILKTAYDSGLRTFDTADGYSNGQSEILLGEFLKEYEIPRETVIIMTKVWAPVDS 98

Query: 84  ----TQQRNPQ--------------------EALDQSLQRLGLDYVDLYLIHWPVPLRTE 119
                Q+  P                     EA   S++RLG  Y+D+Y IH        
Sbjct: 99  SLEGFQRTGPMNEDQKVHFANQQGLSRKHIIEACKNSVRRLG-TYIDVYQIH-------- 149

Query: 120 NIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL-L 178
                            +D  +E    +T   +  +++ G T+ IG S+       +   
Sbjct: 150 --------------RADQDTPME----ETMRALNDVVQQGLTRYIGASSMLGTEFAEYQF 191

Query: 179 AAPTTKVTPAVNQVELHPLLPQE---DLIKFGKENGIVIEAYSPLGGENAPILSDPT--- 232
            A     +  VN  + + LL +E   ++I + K++GI    +SPL      +LS P    
Sbjct: 192 IAEKNGWSKFVNMQDCYNLLYREEEREMIPYIKKHGIAQTPWSPL---QRGLLSRPVEVS 248

Query: 233 ----------------------------VQEIAKANGVEAGHVVISWAVQKGLVTLPKSV 264
                                       V+++A   G+    V  +W + KG   +    
Sbjct: 249 SYREDNDRVLKGRRLNQYEDFEIEIINRVEQVAVKKGITMAEVATAWLLSKGTFPILGLN 308

Query: 265 TPSRIVGNLKVLTLS 279
           +  R+   +K L ++
Sbjct: 309 SVQRVKEAIKALDVT 323

>Smik_3.208 Chr3 (305264..306298) [1035 bp, 344 aa] {ON} YPL088W
           (REAL)
          Length = 344

 Score = 40.8 bits (94), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 107/288 (37%), Gaps = 99/288 (34%)

Query: 38  VIEALK----AGYRHIDGAAVYGN---EGEVGKAIQDSGVPRNEIFLTTKLWC------- 83
           + E LK    +G R  D A VY N   E  +G+ ++   + R  + + TK++        
Sbjct: 44  IFEILKHCYDSGMRTFDTADVYSNGLSERILGEFLKHYKIKRETVVILTKVYYPVDESLK 103

Query: 84  --------------------TQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKD 123
                                 +++  EA   S++RLG  Y+D+  IH     R ++   
Sbjct: 104 LTHSAKISESDMLGLVNQTGLSRKHILEAAKNSVERLG-TYIDVLQIH-----RLDH--- 154

Query: 124 GNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLES---GKTKAIGVSNFSVNNLKDL-LA 179
                         D  +E       E+M+ L +    G T+ IG S+       +L   
Sbjct: 155 --------------DTPME-------EIMKALNDVVGLGYTRYIGASSMLATEFAELQFI 193

Query: 180 APTTKVTPAVNQVELHPLLPQED---LIKFGKENGIVIEAYSP---------LGGENAPI 227
           A     T  +     + LL +ED   LI F K++GI +  +SP         L  E    
Sbjct: 194 AEKHDWTKFICSQSCYSLLYREDERELIPFAKKHGIGLIPWSPNARGVLTRPLNQETDRK 253

Query: 228 LSDPT-------------------VQEIAKANGVEAGHVVISWAVQKG 256
           +SDPT                   V+E+AK  G+    V I+W + KG
Sbjct: 254 ISDPTLKRLKFDCLESHEKRIVNRVEEVAKKKGISMAMVSIAWVLSKG 301

>Kpol_449.4 s449 (14334..15359) [1026 bp, 341 aa] {ON}
           (14334..15359) [1026 nt, 342 aa]
          Length = 341

 Score = 40.4 bits (93), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 87/233 (37%), Gaps = 21/233 (9%)

Query: 23  GLGTW----RSKENEGYKAVIEALKAGYRHIDGAAVYGN---EGEVGKAIQDSGVPRNEI 75
           G  TW    +  + E +K +  A   G R  D A VY N   E  +G+ ++   +PR  +
Sbjct: 27  GSKTWDEWVQDDKEEAFKILKHAYDRGIRSYDTANVYSNGQSEIILGEFLRKYNIPRETV 86

Query: 76  FLTTKLWCTQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPL---RTENIKDGNLFQFAEK 132
            + TKL      N           + L+ V++  +         R    + G      + 
Sbjct: 87  VIMTKLRFPADENMDIDFKNMTPEMKLNVVNMQGLSRKSIFSSSRASVKRLGTYIDILQI 146

Query: 133 PDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL-LAAPTTKVTPAVNQ 191
             G  D   E    +T   +  ++  G T+ +G S        ++   A        VN 
Sbjct: 147 HRGDPDTPFE----ETMGALNDVVIEGLTRYVGASLMLATEFAEMQFVAEKHGWFKFVNS 202

Query: 192 VELHPLLPQED---LIKFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANG 241
              + L+ +ED   LI F K + I +  +SPL   N  +L  P   E  ++N 
Sbjct: 203 QSCYHLMYREDERELIPFAKRHNIALTPFSPL---NRGLLCRPLGTETTRSNS 252

>TBLA0E05040 Chr5 (1303453..1304481) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 39.3 bits (90), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 63/308 (20%), Positives = 112/308 (36%), Gaps = 91/308 (29%)

Query: 40  EALKAGYRHIDGAAVYGN---EGEVGKAIQDSGVPRNEIFLTTKLWC------------- 83
            A   G R  D A VY N   E  +G+ ++   +PR  + + TK++              
Sbjct: 48  HAYDRGLRTYDTADVYSNGMSETILGEFLRTYNIPRETVVIMTKVFFPVDDKMDISSNRT 107

Query: 84  -TQQRNPQ-------------EALDQSLQRLGLDYVDLYLIHWPVPLRTENIKDGNLFQF 129
            T++ N Q              A+  S++RLG  Y+D+Y IH                  
Sbjct: 108 KTEEENLQLINQQHLSRKHILNAVKNSVKRLG-TYIDVYQIH------------------ 148

Query: 130 AEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL-LAAPTTKVTPA 188
                     D E  F +T   +  ++E G  + +G S+       ++   A        
Sbjct: 149 --------RCDHETPFEETMRALNDVVEQGDVRYLGASSMLAVEFAEMQFIAEKHGWHKF 200

Query: 189 VNQVELHPLLPQED---LIKFGKENGIVIEAYSP---------LGGENAPILSDPT---- 232
           VN    + L+ +ED   +I F K +GI +  +SP         LG       +D      
Sbjct: 201 VNMQSCYNLVYREDEREMIPFCKRHGIALTPWSPIQKGLLARPLGSHTHRESTDGVLIAR 260

Query: 233 ---------------VQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLT 277
                          V+++A    ++   + + W +QKG + +    +  R+   +K LT
Sbjct: 261 KLNQFTESEKEIINRVEKLAIKKNLKMVDISLGWVIQKGTLPILGMSSIERVDEAIKTLT 320

Query: 278 --LSDSDV 283
             L++ D+
Sbjct: 321 TKLTEDDM 328

>NCAS0C02450 Chr3 complement(455582..456613) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 38.9 bits (89), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 66/286 (23%), Positives = 115/286 (40%), Gaps = 57/286 (19%)

Query: 22  VGLGTWRSK---------ENEGYKAVIEALKAGYRHIDGAAVYGN---EGEVGKAIQDSG 69
           VG  T+ SK         + E +K +      G R  D A VY N   E  +G+ ++   
Sbjct: 21  VGCMTYGSKNWANWVLEDKEEIFKILKHCYDNGLRTFDTADVYSNGTSERILGEFLKRFN 80

Query: 70  VPRNEIFLTTKLWCTQQRNPQEALD-QSLQRLGLDYVDLYLIHWPVPLRTENIKDGNLFQ 128
           + R  + + +K++        E+LD     ++  +Y+DL L  +   L  ++I  G +  
Sbjct: 81  IKRETVVIMSKIFFP----VDESLDLHQGSKVDQEYIDLQL-SFQQGLNRKHIMAG-VAN 134

Query: 129 FAEKPDGSKDV------DLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL-LAAP 181
             E+     D+      D E +  +    +  ++ SG+ + IG S+       +L   A 
Sbjct: 135 SVERLGTYIDILQIHRLDKEASMEEIMRSLNDVVVSGQVRYIGASSMLATEFAELQFIAK 194

Query: 182 TTKVTPAVNQVELHPLLPQED---LIKFGKENGIVIEAYSP--LGGENAP-------ILS 229
                  +N    + +L +ED   LI F K++G+ +  +SP   G    P       +LS
Sbjct: 195 QNGWFQFINVQSYYNVLNREDENELIPFCKKHGVGLTVWSPNARGVLTRPADKTGTRMLS 254

Query: 230 DPT-------------------VQEIAKANGVEAGHVVISWAVQKG 256
           DPT                   V+ IAK  G+    V ++W + KG
Sbjct: 255 DPTFIKMGLDKLDESDKEIIGVVEAIAKKKGISMAMVSMAWILNKG 300

>Skud_3.179 Chr3 (292171..293205) [1035 bp, 344 aa] {ON} YPL088W
           (REAL)
          Length = 344

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 106/288 (36%), Gaps = 99/288 (34%)

Query: 38  VIEALKAGY----RHIDGAAVYGN---EGEVGKAIQDSGVPRNEIFLTTKLWC------- 83
           + E LK  Y    R  D A VY N   E  +G+ ++   + R  + + TK++        
Sbjct: 44  IFEILKHCYDGGMRTFDTADVYSNGLSERILGEFLKHYKIKRETVVILTKVYYPVDESLE 103

Query: 84  --------------------TQQRNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKD 123
                                 +++  EA   S++RLG  Y+D+  IH            
Sbjct: 104 LTHFGKVSEFDMLGLVNQSGLSRKHILEAAKNSVERLG-TYIDVLQIH------------ 150

Query: 124 GNLFQFAEKPDGSKDVDLEWNFIKTWELMQKL---LESGKTKAIGVSNFSVNNLKDL-LA 179
                   K D   D  +E       E+M+ L   +E G T+ IG S+       +L   
Sbjct: 151 --------KLD--HDTPME-------EIMKALNGVVELGYTRYIGASSMLATEFAELQFI 193

Query: 180 APTTKVTPAVNQVELHPLLPQED---LIKFGKENGIVIEAYSP--LGGENAPIL------ 228
           A     T  +     + LL +ED   LI F K++GI +  +SP   G    P+       
Sbjct: 194 AEKRDWTKFICSQSCYSLLYREDERELIPFAKKHGIGLIPWSPNARGILTRPLNQATDRK 253

Query: 229 -SDPT-------------------VQEIAKANGVEAGHVVISWAVQKG 256
            SDPT                   V+E+AK  G+    V I+W + KG
Sbjct: 254 NSDPTFKRLKFDCLESHEKGIVNRVEELAKKKGISMAMVSIAWVLSKG 301

>Skud_16.195 Chr16 (353315..354343) [1029 bp, 342 aa] {ON} YPL088W
           (REAL)
          Length = 342

 Score = 38.1 bits (87), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 44/185 (23%), Positives = 76/185 (41%), Gaps = 37/185 (20%)

Query: 150 ELMQKL---LESGKTKAIGVSNFSVNNLKDL-LAAPTTKVTPAVNQVELHPLLPQED--- 202
           E+M+ L   +E+G  + IG S+       +L   A        ++    + LL +ED   
Sbjct: 158 EIMRALNDVVEAGHVRYIGASSMLATEFAELQFIADKYGWFQFISSQSYYNLLHREDERE 217

Query: 203 LIKFGKENGIVIEAYS---------PLGGENAPILSDPT-------------------VQ 234
           LI F K + I +  +S         PLG     + SDPT                   V+
Sbjct: 218 LIPFAKRHNIGLLPWSSNARGLLTRPLGQNTERMRSDPTFKSLQLDTLEEDQMEIINRVE 277

Query: 235 EIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVL--TLSDSDVAKVDGLLKA 292
           +I+K   V    + I+W + KG   +    + SR+   +  L  TL++ ++  ++   K 
Sbjct: 278 KISKDKNVSMAMISIAWVLHKGCHPIVGLSSTSRVDEAIAALHVTLTEKEIEYLEEPYKP 337

Query: 293 KGERR 297
           K +RR
Sbjct: 338 KRQRR 342

>KLTH0E01474g Chr5 complement(143734..144675) [942 bp, 313 aa] {ON}
           conserved hypothetical protein
          Length = 313

 Score = 37.4 bits (85), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 47/194 (24%), Positives = 84/194 (43%), Gaps = 41/194 (21%)

Query: 38  VIEALKAGYRHIDGAAVY-GNEGEVGKAIQDSGVPRNEIFLTTKLWCTQQRNPQEALDQS 96
           V+E  K     +D A +Y G+E  +GK      +P++ I  T      +    +E++++S
Sbjct: 28  VLEKYKV--EELDTARIYPGSEEAIGKF----ELPKSFIIDTKARGFGEGTLTKESINES 81

Query: 97  LQR----LGLDYVDLYLIHWPVPLRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELM 152
           ++     LG++ V+++ +H P P                         LE    +T + +
Sbjct: 82  IEESFGLLGVESVEIFYLHCPDPA----------------------TPLE----ETLDAI 115

Query: 153 QKLLESGKTKAIGVSNFSVNNLKDLLAAPTTK--VTPAVNQVELHPL--LPQEDLIKFGK 208
             L + GK K  GVSNFS  +++ + +    K  V P V Q   + +    +  L    +
Sbjct: 116 DALYKEGKFKKFGVSNFSPEDVRKIYSYNKEKGYVLPTVYQGNYNAVGRKIETSLFPVLR 175

Query: 209 ENGIVIEAYSPLGG 222
           E G+   AYSP+ G
Sbjct: 176 ELGLSFYAYSPIAG 189

>NCAS0A12950 Chr1 complement(2551851..2552822) [972 bp, 323 aa] {ON}
           Anc_2.604 YMR041C
          Length = 323

 Score = 37.4 bits (85), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 66/156 (42%), Gaps = 34/156 (21%)

Query: 41  ALKAGYRHIDGAAVYGN-EGEVGKAIQDSG--VPRNEIFLTTKL-------WCTQQRNPQ 90
           A + G   ID +  YGN E  +GKA+ + G   PR+   + TK+       +     N +
Sbjct: 33  AFENGINCIDTSPYYGNSEILIGKALHNLGDKFPRDSYLICTKVGRLSLDSFDYSADNVR 92

Query: 91  EALDQSLQRLGLDYVDLYLIHWPVPLRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWE 150
            ++ +S +RL  DY+DL  +H    +   N+KD +L    E                   
Sbjct: 93  RSVVRSCKRLNSDYLDLVYLH---DVEFVNMKD-SLVALRE------------------- 129

Query: 151 LMQKLLESGKTKAIGVSNFSVNNLKDLLAAPTTKVT 186
            ++KL   G  K  G+S + V+ L  L +    K T
Sbjct: 130 -LKKLKNEGIIKRFGISGYPVDYLFHLSSYCAKKDT 164

>Smik_16.149 Chr16 (265088..266116) [1029 bp, 342 aa] {ON} YPL088W
           (REAL)
          Length = 342

 Score = 37.0 bits (84), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 42/186 (22%), Positives = 78/186 (41%), Gaps = 39/186 (20%)

Query: 150 ELMQKL---LESGKTKAIGVSNFSVNNLKDL-LAAPTTKVTPAVNQVELHPLLPQED--- 202
           E+M+ L   +E+G  + IG S+       +L   A        ++    + LL +ED   
Sbjct: 158 EIMKALNDVVEAGHVRYIGASSMLATEFAELQFIADKYGWFQFISSQSYYNLLNREDERE 217

Query: 203 LIKFGKENGIVIEAYSP---------LGGENAPILSDPT-------------------VQ 234
           LI F K + I +  +SP         LG     I SDPT                   V+
Sbjct: 218 LIPFAKRHNIGLLPWSPNARGILTRPLGQNTDRIKSDPTFKSLQLDSLEEDQMEIINRVE 277

Query: 235 EIAKANGVEAGHVVISWAVQKG---LVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLK 291
           +++K   V    + ++W + KG   +V L  +     ++  L++ TL++ ++  ++   +
Sbjct: 278 KLSKDKNVSMAMISVAWVLHKGCHPIVGLNSTSRVDEVIAALQI-TLTEKEIEYLEEPYR 336

Query: 292 AKGERR 297
            K +RR
Sbjct: 337 PKSQRR 342

>Kwal_26.8377 s26 (759190..760206) [1017 bp, 338 aa] {ON} YMR041C -
           Hypothetical ORF [contig 59] FULL
          Length = 338

 Score = 36.6 bits (83), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 43/81 (53%), Gaps = 10/81 (12%)

Query: 41  ALKAGYRHIDGAAVYGN-EGEVGKAIQD--SGVPRNEIFLTTKL-------WCTQQRNPQ 90
           A++ G R ID +  YG+ E   GKA++     +PR   F+ TK+       +   + + +
Sbjct: 52  AVQHGIRAIDTSPYYGDSEKLFGKALESLKDEIPRENYFICTKVGRIRLDEFDYSREHVR 111

Query: 91  EALDQSLQRLGLDYVDLYLIH 111
            ++ +S +RL  DY+D+  +H
Sbjct: 112 SSVLRSCERLRTDYLDVVFLH 132

>KAFR0F03890 Chr6 complement(761303..762262) [960 bp, 319 aa] {ON} 
          Length = 319

 Score = 36.2 bits (82), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 67/307 (21%), Positives = 116/307 (37%), Gaps = 55/307 (17%)

Query: 23  GLGTWRSKENEGYKAVIEALKAGY----RHIDGAAVYGN---EGEVGKAIQDSGVPRNEI 75
           G   W     E  + V   LK  Y    R  D A  Y N   E  +G+ ++   + R  +
Sbjct: 4   GKKKWSEWVEEDKEKVFNTLKYCYDKGLRTFDTADYYSNGYSEILLGEFLKKYKIKRETV 63

Query: 76  FLTTKLWCTQQRNPQEALDQSL--QRLGLDYVDLYLIHWPVPLRTENIKDGNLFQFAEKP 133
            + TK++        E LD  L  + +G+D +D+        L  ++I DG + +  E+ 
Sbjct: 64  VILTKIFFP----VDETLDLHLGEEPIGVDQLDVVNQR---GLSRKHIVDG-VKRSVERL 115

Query: 134 DGSKDV------DLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL-LAAPTTKVT 186
               DV      D +    +  + +  ++E G  + IG S+       ++   A   +  
Sbjct: 116 GTYIDVLQIHRFDQDTPIKERMKALNDVVEKGHVRYIGASSMLATEFAEMQFVAEKYEWF 175

Query: 187 PAVNQVELHPLLPQED---LIKFGKENGIVIEAYSP---------LGGENAPILSDP--- 231
             VN   L+ L+ +ED   LI F K + I +  +SP         +G       +DP   
Sbjct: 176 QFVNSQSLYNLIYREDERELIPFCKRHNIALTPWSPNHQGLLTRPIGSTTERSENDPFVK 235

Query: 232 ----------------TVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKV 275
                            V+E+AK        +  +W + KG V +      SR+   +K 
Sbjct: 236 CTLTKKLEKSDIEIINRVEELAKKKKCSMAVISTAWVISKGCVPIVGMSKTSRVDDAIKA 295

Query: 276 LTLSDSD 282
           L +  +D
Sbjct: 296 LKVKFTD 302

>SAKL0H09438g Chr8 (803426..804454) [1029 bp, 342 aa] {ON} highly
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 342

 Score = 35.4 bits (80), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 63/267 (23%), Positives = 100/267 (37%), Gaps = 47/267 (17%)

Query: 31  ENEGYKAVIEALKAGYRHIDGAAVYGN---EGEVGKAIQDSGVPRNEIFLTTKLWCTQQR 87
           E E +K +      G R  D A  Y N   E  VGK ++   + R  + + TK++     
Sbjct: 39  EEEIFKVLKHCYDNGLRTFDTADFYSNGLSERLVGKFLKRYNINRETVVILTKVFFPVD- 97

Query: 88  NPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKDGNLFQFAEKPDGSKDV------DL 141
              E LD S  + G+D      +     L  ++I DG + +  E+     DV      D 
Sbjct: 98  ---ETLDLSHSK-GMDEATQLTVANQRGLSRKHILDG-VAKSVERLGTYIDVLQIHRFDT 152

Query: 142 EWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL-LAAPTTKVTPAVNQVELHPLLPQ 200
           E    +T + +  ++  G  + IG S+       +L   A        ++    + LL +
Sbjct: 153 ETPVNETMKALNDVVSKGYARYIGASSMLATQFAELQFVAEKHDWFKFISSQSCYNLLYR 212

Query: 201 ED---LIKFGKENGIVIEAYSP---------LGGENAPILSD------------------ 230
           ED   LI F K + I +  +SP         LG +     +D                  
Sbjct: 213 EDERELIPFAKRHNIGLIPWSPNARGVLTRPLGTQTLRHSTDFGLKRISAFDLQPHEEEI 272

Query: 231 -PTVQEIAKANGVEAGHVVISWAVQKG 256
              V EIA+  GV    V I+W + KG
Sbjct: 273 VRRVGEIAEKRGVTMAVVSIAWVLSKG 299

>KAFR0D04230 Chr4 complement(833614..834642) [1029 bp, 342 aa] {ON} 
          Length = 342

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 67/165 (40%), Gaps = 32/165 (19%)

Query: 147 KTWELMQKLLESGKTKAIGVSNFSVNNLKDL-LAAPTTKVTPAVNQVELHPLLPQED--- 202
           +T   +  ++E G T+ IG S+     L +L   A        VN    + L+ +ED   
Sbjct: 159 ETMRALNDVVEMGLTRYIGASSMLGTQLAELQFTADKYNWFQFVNVQSCYNLVYREDERE 218

Query: 203 LIKFGKENGIVIEAYSP---------LGGENAPILSD-------------------PTVQ 234
            I F K++ +++  +SP         +G E+    SD                     V+
Sbjct: 219 TIPFAKKHNLMLTPWSPNHQGLLTRPVGVESTRSSSDIIINAWGLKNLKPWEVTVINRVE 278

Query: 235 EIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVLTLS 279
           E+AK   V    +  +W +QKG   +    + +R+  N+K L +S
Sbjct: 279 EMAKKKNVSMAVIATAWVIQKGCAPILGMSSIARVDDNIKALDVS 323

>ZYRO0F00858g Chr6 (68107..69147) [1041 bp, 346 aa] {ON} similar to
           uniprot|Q04212 Saccharomyces cerevisiae YMR041C
           Hypothetical ORF
          Length = 346

 Score = 35.4 bits (80), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 46/88 (52%), Gaps = 14/88 (15%)

Query: 38  VIEALKAGYRH----IDGAAVYG-NEGEVGKAIQD--SGVPRNEIFLTTKLWCTQ----- 85
           +++ LK G+ H    ID +  YG +E   G+A++      PRN  ++ TK+   Q     
Sbjct: 42  LVDMLKHGFNHGIRAIDTSPYYGPSEILYGQALEHIRDEFPRNSYYICTKVGRIQLDEFD 101

Query: 86  --QRNPQEALDQSLQRLGLDYVDLYLIH 111
             + + + ++ +S QRL  DY+DL  +H
Sbjct: 102 YSREHVRFSVLRSCQRLKTDYLDLVYLH 129

>SAKL0C14058g Chr3 (1248968..1249915) [948 bp, 315 aa] {ON}
           conserved hypothetical protein
          Length = 315

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 67/157 (42%), Gaps = 36/157 (22%)

Query: 91  EALDQSLQRLGLDYVDLYLIHWPVPLRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWE 150
           E++ +SL  L  D V+ + +H P P  T  I++                        T +
Sbjct: 81  ESIGESLSLLKTDKVETFYLHCPDP--TTPIEE------------------------TLK 114

Query: 151 LMQKLLESGKTKAIGVSNFSVNNLKDLLAAPTTK--VTPAVNQVELHPLLP--QEDLIKF 206
            + +L + GK    G+SN+  N+++ +     +K  V P V Q   + +    ++DL   
Sbjct: 115 AINELYKEGKFVHFGLSNYPANDVRKIYEYADSKGYVLPTVYQGNYNAVSRKIEKDLFPV 174

Query: 207 GKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGVE 243
            +E  I   AYSP+ G         TVQEI +  GVE
Sbjct: 175 LRELKIAFYAYSPIAGG----FLARTVQEIEE--GVE 205

>KAFR0J00220 Chr10 complement(37107..38138) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 33.9 bits (76), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 63/305 (20%), Positives = 114/305 (37%), Gaps = 90/305 (29%)

Query: 35  YKAVIEALKAGYRHIDGAAVYGN---EGEVGKAIQDSGVPRNEIFLTTKLW--------- 82
           +K +      G R  D A VY N   E  + + +++  + R  + + TKL+         
Sbjct: 43  FKILKHCYDQGLRTFDTADVYSNGLCERLLKEFLEEYKIRRETVVIMTKLFFPVDETLDL 102

Query: 83  ---------------CTQQ----RNPQEALDQSLQRLGLDYVDLYLIHWPVPLRTENIKD 123
                            QQ    ++  +A  +S++RLG  Y+D+  IH            
Sbjct: 103 SLGGAIEDGVGKLDLTNQQGLSRKHILDAAKKSVERLG-TYIDVLQIH------------ 149

Query: 124 GNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL-LAAPT 182
                   + D +  V       +T   +  ++E G T+ IG S+     L +L   A  
Sbjct: 150 --------RFDPNTPVK------ETMRALNDVVEMGLTRYIGASSMLGTQLAELQFTADK 195

Query: 183 TKVTPAVNQVELHPLLPQED---LIKFGKENGIVIEAYSP---------LGGENAP---- 226
                 VN    + L+ +ED   +I F K + +++  +SP         +G E+A     
Sbjct: 196 YNWFQFVNVQSCYNLIYREDEREIIPFAKRHNLMLTPWSPNHGGLLTRPVGVESARSSTD 255

Query: 227 -ILSD--------------PTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVG 271
            IL+D                ++E+AK   V    +  +W + KG   +    + +R+  
Sbjct: 256 IILNDWGMKHLKPWEITIVNRIEELAKKKNVSMAVISAAWVISKGCAPIIGMSSIARVDD 315

Query: 272 NLKVL 276
           N+K L
Sbjct: 316 NIKAL 320

>TBLA0F00680 Chr6 (175497..176135) [639 bp, 212 aa] {ON} 
          Length = 212

 Score = 32.7 bits (73), Expect = 0.74,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 57/134 (42%), Gaps = 31/134 (23%)

Query: 91  EALDQSLQRLGLDYVDLYLIHWPVPLRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWE 150
           +A   S++RLG  Y+D+Y IH   P                      D  +E    +T  
Sbjct: 70  DACKNSVRRLGT-YIDVYQIHRADP----------------------DTPIE----ETMR 102

Query: 151 LMQKLLESGKTKAIGVSNFSVNNLKDL-LAAPTTKVTPAVNQVELHPLLPQED---LIKF 206
            +  +++ G T+ IG S+       +    A     +  VN  + + LL +E+   +I F
Sbjct: 103 ALNDVVQEGLTRYIGASSMLATEFAEYQFIAEKNGWSKFVNMQDCYNLLYREEEREMIPF 162

Query: 207 GKENGIVIEAYSPL 220
            K++GI +  +SPL
Sbjct: 163 VKKHGITLTPWSPL 176

>SAKL0E00286g Chr5 complement(13788..14804) [1017 bp, 338 aa] {ON}
           similar to uniprot|Q02895 Saccharomyces cerevisiae
           YPL088W Putative aryl alcohol dehydrogenase
           transcription is activated by paralogous transcription
           factors Yrm1p and Yrr1p along with genes involved in
           multidrug resistance
          Length = 338

 Score = 33.1 bits (74), Expect = 0.81,   Method: Compositional matrix adjust.
 Identities = 65/284 (22%), Positives = 110/284 (38%), Gaps = 44/284 (15%)

Query: 31  ENEGYKAVIEALKAGYRHIDGAAVYGN---EGEVGKAIQDSGVPRNEIFLTTKLWCTQQR 87
           + E +K +      G R  D A VY N   E  +G+ ++   + R  + + +K+     R
Sbjct: 39  KEEIFKILKHCYDNGLRTFDTADVYSNGLSERLLGEFLKRYKINRETVVILSKV-----R 93

Query: 88  NP-QEALDQSLQRL-GLDYVDLYLIHWPVPLRTENIKDGNLFQFAEKPDGSKDV------ 139
            P  E+L+  L  + G D V    +     L  ++I DG + +  E+     DV      
Sbjct: 94  FPVDESLELPLSTIYGTDEVTALTLANQGGLSRKHIMDG-VAKSVERLGTYIDVLQIHRF 152

Query: 140 DLEWNFIKTWELMQKLLESGKTKAIGVSNFSVNNLKDL-LAAPTTKVTPAVNQVELHPLL 198
           D E    +T + +  ++E G T+ IG S+       +L   A        ++    + LL
Sbjct: 153 DHETPMEETMKALNDVVEKGYTRYIGASSMLATEFAELQFVAEKHSWFKFISSQSCYNLL 212

Query: 199 PQED---LIKFGKENGIVIEAYSP---------LGGENAPILSDPT-------------- 232
            +ED   LI F K + I +  +SP         LG   A   +D                
Sbjct: 213 YREDERELIPFAKRHRIGLIPWSPNSRGLLTRPLGLTTARYEADSRLHNIAPDEQEIIRR 272

Query: 233 VQEIAKANGVEAGHVVISWAVQKGLVTLPKSVTPSRIVGNLKVL 276
           V+E+AK        V  +W + KG   +    +  R+   LK +
Sbjct: 273 VEEVAKKRDTTMAIVSTAWVLSKGCYPIVGLSSTERVDEALKAI 316

>KAFR0C03670 Chr3 complement(747792..748823) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score = 33.1 bits (74), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 40/182 (21%), Positives = 73/182 (40%), Gaps = 36/182 (19%)

Query: 147 KTWELMQKLLESGKTKAIGVSNFSVNNLKDL-LAAPTTKVTPAVNQVELHPLLPQED--- 202
           +T + +  ++ESG  + IG S+       ++   A        VN   ++ L+ +ED   
Sbjct: 159 ETMKALNDVIESGHVRYIGASSMLATQFAEMQFIADKYNWFQFVNAQSMYNLVYREDERE 218

Query: 203 LIKFGKENGIVIEAYSP---------LGGENAPILSD-------------------PTVQ 234
           LI F K + I +  +SP         +G ++    SD                     V+
Sbjct: 219 LIPFCKRHNIALTPWSPNHRGFLTRPIGTKSLRSESDRFTINKLRDNVLESDIKIVKRVE 278

Query: 235 EIAKANGVEAGHVVISWAVQKG---LVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLK 291
           E+A+  GV    +  +W V KG   ++ L K+      +  L V T +D ++  ++   K
Sbjct: 279 ELAEKKGVSMAAISTAWVVSKGCQPIIGLSKTERVDDAISALSV-TFTDEELKYLEDPYK 337

Query: 292 AK 293
            K
Sbjct: 338 PK 339

>TDEL0C06010 Chr3 complement(1082207..1083241) [1035 bp, 344 aa]
           {ON} 
          Length = 344

 Score = 33.1 bits (74), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 69/326 (21%), Positives = 109/326 (33%), Gaps = 93/326 (28%)

Query: 23  GLGTWRSKENEGYKAVIEALKAGYRH----IDGAAVYGNEGE---VGKAIQDSGVPRNEI 75
           G   W     E  + +   LK  Y H     D A VY N      VG+ ++   + R  +
Sbjct: 30  GCKQWAEWVLEDKEKIFSILKHCYDHGLRTFDTADVYSNGASGRLVGEFLKKYNIDRETV 89

Query: 76  FLTTKLW----------------------CTQQRNPQE-----ALDQSLQRLGLDYVDLY 108
            + TKL+                       T  R             S++RLG  Y+D+ 
Sbjct: 90  VILTKLFYPVDESLDLKHGGTFDEEEKLQLTHHRGLSRKHIIAGAKASMERLG-TYIDVL 148

Query: 109 LIHWPVPLRTENIKDGNLFQFAEKPDGSKDVDLEWNFIKTWELMQKLLESGKTKAIGVSN 168
            IH                            D E    +T   +  +++ G T+ IG S 
Sbjct: 149 QIH--------------------------RFDDETPMEETMRALNYVVDQGFTRYIGAST 182

Query: 169 FSVNNLKDL-LAAPTTKVTPAVNQVELHPLLPQED---LIKFGKENGIVIEAYSP--LGG 222
                  ++   A        ++    + LL +ED   LI F + +G+ +  +SP   G 
Sbjct: 183 MRATEFAEMQFIAEKHGWYKFISSQSSYNLLYREDERELIPFAQRHGVGLIPWSPNARGV 242

Query: 223 ENAP-------ILSDPT-------------------VQEIAKANGVEAGHVVISWAVQKG 256
              P       I SDPT                   V+EIAK  GV    + I+W + KG
Sbjct: 243 LTRPSNQTSERIKSDPTYSRLGWNALRANQKEIVDRVEEIAKTKGVSMAVISIAWVLSKG 302

Query: 257 LVTLPKSVTPSRIVGNLKVLTLSDSD 282
              +    +  R+   L+ L +  +D
Sbjct: 303 AYPIVGLNSIERVNEALQALDVRLTD 328

>TDEL0F00160 Chr6 (17872..19386) [1515 bp, 504 aa] {ON} 
          Length = 504

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 49/109 (44%), Gaps = 16/109 (14%)

Query: 149 WELMQKLLESGKTKAIGVSNF--SVNNLKDLLAAP-TTKVTPAVNQVELHPLLPQEDLIK 205
           +ELM+  L +G   A+G   F      + + +  P   K    +N  E+ PLLP+   I 
Sbjct: 300 YELMKLRLLNGTHSAMGYLGFLAGYQYIHEAITDPLINKYIRTMNHEEVIPLLPKIKGID 359

Query: 206 FGKENGIVIEAYSP------------LGGENAPILSDPTVQE-IAKANG 241
           FG+ +  V+E +S             +G    P    P++ E +AKA+G
Sbjct: 360 FGEYSHTVLERFSNPAIKDQVSRICLMGSGKMPKYVLPSITEQLAKADG 408

>SAKL0E00264g Chr5 complement(12234..13181) [948 bp, 315 aa] {ON}
           conserved hypothetical protein
          Length = 315

 Score = 32.3 bits (72), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 40/80 (50%), Gaps = 4/80 (5%)

Query: 147 KTWELMQKLLESGKTKAIGVSNFSVNNLKDL--LAAPTTKVTPAVNQVELHPLLP--QED 202
           +T E + +L + GK    G+SN+  ++++ +   AA    V P V Q   + +    ++D
Sbjct: 111 ETLEAINELYKDGKFVHFGLSNYPASDVRKIYEYAASKGYVLPTVYQGNYNAVSRKIEKD 170

Query: 203 LIKFGKENGIVIEAYSPLGG 222
           L    +E  I   AYSP+ G
Sbjct: 171 LFPVLRELKITFYAYSPIAG 190

>Kwal_47.19313 s47 complement(1186091..1189306) [3216 bp, 1071 aa]
           {ON} YGL251C (HFM1) - C4 zinc finger DNA-binding protein
           of low sequence specificity in vitro; Probable 119 kD
           DNA/RNA helicase family member [contig 344] FULL
          Length = 1071

 Score = 32.3 bits (72), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 59/140 (42%), Gaps = 12/140 (8%)

Query: 150 ELMQKLLES----GKTKAIGVSNFSVNNLKDLLAAPTTKVTPAVNQV-ELHPLLPQEDLI 204
            ++QKL E+    G + A+   + SV  +K+ ++ PT       NQ+  L P LP+   +
Sbjct: 555 HVLQKLSETYSSTGYSTAMSAHSLSVQTIKEFISLPTQL---GFNQIILLLPHLPEFGFV 611

Query: 205 KFGKENGIVIEAYSPLGGENAPILSDPTVQEIAKANGVEAGHVVISWAVQKGLVTLPKSV 264
                     +A S    +   ++S P   E+AK   +    + I    + G   LP+S 
Sbjct: 612 TIKASERKFYQAMS----QPPTVISLPYTGEVAKEEWLRQRKIAILLQFKLGTSQLPESY 667

Query: 265 TPSRIVGNLKVLTLSDSDVA 284
             S +V +        SDVA
Sbjct: 668 QASNLVTSFYTDLSCVSDVA 687

>Skud_13.220 Chr13 (372489..373994) [1506 bp, 501 aa] {ON} YMR064W
           (REAL)
          Length = 501

 Score = 31.6 bits (70), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 2/64 (3%)

Query: 171 VNNLKDLLAAPTTKVTPAVNQVELHPLLPQEDLIKFGKENGIVIEAYSPLGGE-NAPILS 229
           V  L+DLLAA   +  P   +  LHP++  E L+ F  E G + E+   LG   N  +L 
Sbjct: 241 VTALRDLLAAINNRFFPKRCEDSLHPIII-EQLLSFYIEIGNLNESKKFLGHLINKGVLP 299

Query: 230 DPTV 233
           DP++
Sbjct: 300 DPSI 303

>NDAI0J01200 Chr10 (280820..282103) [1284 bp, 427 aa] {ON} 
          Length = 427

 Score = 31.2 bits (69), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 3/35 (8%)

Query: 124 GNLFQFAEKPDGSKD-VDLEWN--FIKTWELMQKL 155
           G LFQFA KP G+KD   + WN     +W+ + KL
Sbjct: 29  GRLFQFASKPQGTKDSAFMSWNSHLSSSWDQIAKL 63

>CAGL0B01969g Chr2 complement(181406..182677) [1272 bp, 423 aa] {ON}
           similar to uniprot|Q04623 Saccharomyces cerevisiae
           YDR125c ECM18 or uniprot|Q12385 Saccharomyces cerevisiae
           YLR099c ICT1
          Length = 423

 Score = 30.8 bits (68), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 10/62 (16%)

Query: 113 PVPLRTENIKDGNLFQFAEKPDGS-------KDVDLEWNFIKTWELMQKLLESGKTKAIG 165
           P+PL+ ENI DGN FQ     D +       K +D   + I+ W L  KL   GK   + 
Sbjct: 159 PLPLKIENIDDGNEFQLPYVIDSAHHRYVLQKLLDYYVDRIEQWRLDNKL---GKINVVA 215

Query: 166 VS 167
            S
Sbjct: 216 HS 217

>KLLA0B09658g Chr2 complement(837873..838901) [1029 bp, 342 aa] {ON}
           similar to uniprot|Q06494 Saccharomyces cerevisiae
           YPR127W
          Length = 342

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/62 (25%), Positives = 31/62 (50%), Gaps = 7/62 (11%)

Query: 238 KANGVEAGHVVISW--AVQKG-----LVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLL 290
           +++ V    V I W  A+ K      ++ +P   T  ++  N   + LSD ++AK+D  L
Sbjct: 269 RSDNVTLPQVAIGWIRAISKNYPNTKIIPIPSGTTVDKVTSNYSFIELSDEELAKIDKFL 328

Query: 291 KA 292
           ++
Sbjct: 329 QS 330

>KLTH0G00990g Chr7 (71533..73131) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|P43616 Saccharomyces cerevisiae
           YFR044C Hypothetical ORF
          Length = 532

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 19/29 (65%)

Query: 262 KSVTPSRIVGNLKVLTLSDSDVAKVDGLL 290
           K+V PS++VG   + T+ D D AK+D  +
Sbjct: 385 KTVIPSKVVGKFSIRTVPDMDSAKLDKFV 413

>Suva_16.224 Chr16 (392092..393120) [1029 bp, 342 aa] {ON} YPL088W
           (REAL)
          Length = 342

 Score = 30.0 bits (66), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 45/182 (24%), Positives = 74/182 (40%), Gaps = 39/182 (21%)

Query: 150 ELMQKL---LESGKTKAIGVSNFSVNNLKDL-LAAPTTKVTPAVNQVELHPLLPQED--- 202
           E+M+ L   +E+G  + IG S+       +L   A        ++    + LL +ED   
Sbjct: 158 EIMRALNDVVEAGDVRYIGASSMLATEFAELQFIADKYGWFQFISSQSYYNLLNREDERE 217

Query: 203 LIKFGKENGIVIEAYSP--LGGENAPI-------LSDPT-------------------VQ 234
           LI F K + I +  +SP   G    P+        SDPT                   V+
Sbjct: 218 LIPFAKRHNIGLLPWSPNARGVLTRPLDKTTDRQKSDPTFKSLKLDALEDDQMEIVNRVE 277

Query: 235 EIAKANGVEAGHVVISWAVQKG---LVTLPKSVTPSRIVGNLKVLTLSDSDVAKVDGLLK 291
           +I+K   V    + I+W + KG   +V L  +      +  L+ LTL++ DV  ++   K
Sbjct: 278 KISKEKNVSMAMISIAWVLHKGCHPIVGLNSTSRVDEAIAALQ-LTLTEEDVKYLEEPYK 336

Query: 292 AK 293
            K
Sbjct: 337 PK 338

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 33,377,305
Number of extensions: 1465041
Number of successful extensions: 3232
Number of sequences better than 10.0: 162
Number of HSP's gapped: 2926
Number of HSP's successfully gapped: 166
Length of query: 310
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 201
Effective length of database: 40,982,805
Effective search space: 8237543805
Effective search space used: 8237543805
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 65 (29.6 bits)