Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F10010g5.433ON20820810161e-142
Suva_2.5395.433ON2272196063e-79
YDR367W (KEI1)5.433ON2212156011e-78
TDEL0E019205.433ON2202115905e-77
Skud_4.6365.433ON2342305778e-75
Smik_4.6335.433ON2212165699e-74
KAFR0E039305.433ON2112075636e-73
NCAS0F033705.433ON2112065497e-71
Kpol_1062.305.433ON2142055472e-70
KNAG0C049205.433ON2172105445e-70
CAGL0A02794g5.433ON2162105367e-69
TPHA0E017705.433ON2172075272e-67
TBLA0A065205.433ON2062024836e-61
SAKL0G02508g5.433ON2282224673e-58
TBLA0G020105.433ON2131884194e-51
Kwal_55.214325.433ON2072054012e-48
AER256C5.433ON2392053805e-45
Ecym_47625.433ON2212193526e-41
KLTH0F16082g5.433ON2061943491e-40
KLLA0E21099g5.433ON2241983501e-40
NDAI0B056605.433ON1611653084e-35
TBLA0C01050singletonON41630656.5
KLLA0A09295g5.57ON22636638.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F10010g
         (208 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 a...   395   e-142
Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]...   238   3e-79
YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa...   236   1e-78
TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 ...   231   5e-77
Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234...   226   8e-75
Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221...   223   9e-74
KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa...   221   6e-73
NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa...   216   7e-71
Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON...   215   2e-70
KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 ...   214   5e-70
CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 a...   211   7e-69
TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON...   207   2e-67
TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {...   190   6e-61
SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 a...   184   3e-58
TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.43...   166   4e-51
Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {O...   159   2e-48
AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 ...   150   5e-45
Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [66...   140   6e-41
KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa] ...   139   1e-40
KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127) ...   139   1e-40
NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5....   123   4e-35
TBLA0C01050 Chr3 complement(215303..216553) [1251 bp, 416 aa] {O...    30   6.5  
KLLA0A09295g Chr1 (810967..811647) [681 bp, 226 aa] {ON} similar...    29   8.7  

>ZYRO0F10010g Chr6 (812835..812861,812941..813540) [627 bp, 208 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 208

 Score =  395 bits (1016), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 196/208 (94%), Positives = 196/208 (94%)

Query: 1   MKTYLNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSI 60
           MKTYLNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSI
Sbjct: 1   MKTYLNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSI 60

Query: 61  FSFVVYAQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLEDNTPTQKSIA 120
           FSFVVYAQGLFTYSKPSLLVFSQIFIAFSID            NQWYTLEDNTPTQKSIA
Sbjct: 61  FSFVVYAQGLFTYSKPSLLVFSQIFIAFSIDTFLTCLFTLWFTNQWYTLEDNTPTQKSIA 120

Query: 121 AAAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQ 180
           AAAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQ
Sbjct: 121 AAAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQ 180

Query: 181 ELRTQPVWKRVWTRTQIRCLRYSKQLLT 208
           ELRTQPVWKRVWTRTQIRCLRYSKQLLT
Sbjct: 181 ELRTQPVWKRVWTRTQIRCLRYSKQLLT 208

>Suva_2.539 Chr2 (963328..963357,963470..964123) [684 bp, 227 aa]
           {ON} YDR367W (REAL)
          Length = 227

 Score =  238 bits (606), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 148/219 (67%), Gaps = 18/219 (8%)

Query: 7   LPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFVVY 66
           LPK FLGF+PLY+ VE+ LG++ILNKCSG +GILALFTGHPL+F+QWV YLWS+F+ +V+
Sbjct: 8   LPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLWSVFTLIVF 67

Query: 67  AQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLEDNTPTQKSIAAAAMQE 126
           AQGL+   KP+LLVFSQI + +++D             QW+TLE N       ++ A Q 
Sbjct: 68  AQGLYLIHKPNLLVFSQICVLYTVDTICTCFFTLWFTTQWFTLEGNASIVADASSTATQT 127

Query: 127 PN------------------QGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQH 168
            N                  QGAS+S+E+ +TI ITL SLI R YFNF+LASFVQ LL H
Sbjct: 128 INYNPIATGKLTARSTDTSGQGASESYEYSITILITLVSLIFRFYFNFILASFVQELLHH 187

Query: 169 PRYMVDYVDVEQELRTQPVWKRVWTRTQIRCLRYSKQLL 207
           P+Y+VD  DVEQ+L+ +P+WKR+W ++Q  C +  K LL
Sbjct: 188 PKYLVDRDDVEQDLKNKPIWKRLWAKSQKGCYKLCKNLL 226

>YDR367W Chr4 (1212848..1212877,1212979..1213614) [666 bp, 221 aa]
           {ON}  KEI1Component of inositol phosphorylceramide (IPC)
           synthase; forms a complex with Aur1p and regulates its
           activity; required for IPC synthase complex localization
           to the Golgi; post-translationally processed by Kex2p;
           KEI1 is an essential gene
          Length = 221

 Score =  236 bits (601), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 111/215 (51%), Positives = 147/215 (68%), Gaps = 12/215 (5%)

Query: 5   LNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFV 64
           L LPK FLGF+PLY+ VE+ LG++ILNKCSG +GILALFTGHPL+F+QW+ YLWS+F+ +
Sbjct: 6   LTLPKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWIAYLWSVFTLI 65

Query: 65  VYAQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLED-------NTPTQK 117
           V++QGL+   KP+LLVFSQI + ++ID             QW+TLED       N     
Sbjct: 66  VFSQGLYLIHKPNLLVFSQICVLYTIDTISTCFFTLWFTTQWFTLEDTANIDGNNALQSN 125

Query: 118 SIAAAAMQE-----PNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYM 172
            I+   + E       Q A++S+E+ MTI ITL SLI R YFNF+LASFVQ LL HP+Y+
Sbjct: 126 PISTGKLTERGIDISKQSATESYEYTMTILITLVSLIFRFYFNFILASFVQELLHHPKYL 185

Query: 173 VDYVDVEQELRTQPVWKRVWTRTQIRCLRYSKQLL 207
           VD  DVEQ L+ +P+WKR+W ++Q  C +  K LL
Sbjct: 186 VDRDDVEQNLKNKPIWKRLWAKSQKGCYKLCKNLL 220

>TDEL0E01920 Chr5 complement(363042..363665,363727..363765) [663 bp,
           220 aa] {ON} Anc_5.433 YDR367W
          Length = 220

 Score =  231 bits (590), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 144/211 (68%), Gaps = 8/211 (3%)

Query: 5   LNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFV 64
           + LPK FLGF+PLYIGVE+ALG++I+NKCSG +GILALFTGHPL+ +QWVLY+WSIF+ +
Sbjct: 9   MGLPKSFLGFVPLYIGVEIALGISIINKCSGAYGILALFTGHPLDSMQWVLYIWSIFTLI 68

Query: 65  VYAQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLEDNTPTQKSIAAAAM 124
           +  QGL+   KP++L FS IFI F ID             QWY LE N+   K   ++  
Sbjct: 69  ICVQGLYQIHKPNVLTFSHIFITFIIDTLFTSFFTLWFTAQWYNLEGNSNNVKDTKSSYS 128

Query: 125 QEP--------NQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYV 176
             P        +QGAS+ FE+ +T+FIT+ SL  +LYF F++ASFVQ LL HPRYM+D  
Sbjct: 129 DAPVDYSSKIAHQGASEGFEYGVTMFITILSLAGKLYFTFIIASFVQELLLHPRYMLDQD 188

Query: 177 DVEQELRTQPVWKRVWTRTQIRCLRYSKQLL 207
           DVEQ+L+ Q  WKR W ++Q  C + SK LL
Sbjct: 189 DVEQDLKHQSFWKRWWIKSQKSCYKMSKSLL 219

>Skud_4.636 Chr4 (1135660..1135689,1135789..1136463) [705 bp, 234
           aa] {ON} YDR367W (REAL)
          Length = 234

 Score =  226 bits (577), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 109/230 (47%), Positives = 150/230 (65%), Gaps = 25/230 (10%)

Query: 3   TYLNLPK----RFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLW 58
           ++L LPK     FLGF+PLY+ VE+ LG++ILNKCSG +GILALFTGHPL+F+QWV YLW
Sbjct: 4   SFLTLPKIFIKSFLGFMPLYLAVEIVLGISILNKCSGAYGILALFTGHPLDFMQWVAYLW 63

Query: 59  SIFSFVVYAQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLEDNTP---- 114
           S+F+ +V++QGL+   KP+LLVFSQI I +++D             QW+TLE+ T     
Sbjct: 64  SVFTLIVFSQGLYLIHKPNLLVFSQICILYTVDTIFTCFFTLWFTTQWFTLENPTDFGSI 123

Query: 115 -----------------TQKSIAAAAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFV 157
                                + A +  +  Q A++++E+ +TIFITLASLI R YFN +
Sbjct: 124 ANSTADTALRTNGLSPIMAGKLTARSADKSGQSATENYEYSITIFITLASLIFRFYFNLI 183

Query: 158 LASFVQGLLQHPRYMVDYVDVEQELRTQPVWKRVWTRTQIRCLRYSKQLL 207
           L SFVQ LL HP+Y+VD  DVEQ+L+ +P+WKR+W ++Q  C R  K LL
Sbjct: 184 LGSFVQELLHHPKYLVDRDDVEQDLKNKPIWKRLWAKSQKSCYRLCKNLL 233

>Smik_4.633 Chr4 (1132870..1132899,1133000..1133635) [666 bp, 221
           aa] {ON} YDR367W (REAL)
          Length = 221

 Score =  223 bits (569), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 145/216 (67%), Gaps = 12/216 (5%)

Query: 5   LNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFV 64
           L LPK FLGF+PLY+ VE+ LG++ILNKCSG++GILALFTGHPL+F+QWV YLWS+F+ +
Sbjct: 6   LTLPKSFLGFMPLYLAVEIVLGISILNKCSGVYGILALFTGHPLDFMQWVAYLWSVFTLI 65

Query: 65  VYAQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLED------------N 112
           +++QGL+   KP+LL+FSQI   +++D             QW+TLED            N
Sbjct: 66  IFSQGLYLIHKPNLLLFSQICALYTLDTLFTCFFTLWFTTQWFTLEDTAGGVASQSNNSN 125

Query: 113 TPTQKSIAAAAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYM 172
             + + +         Q A++S+E+ +TI ITL SLI R YFN +LASFVQ LL HP+Y+
Sbjct: 126 LISTERLTVRNTDISKQSATESYEYSITILITLVSLIFRFYFNLILASFVQELLHHPKYL 185

Query: 173 VDYVDVEQELRTQPVWKRVWTRTQIRCLRYSKQLLT 208
           VD  DVEQ L+ +P+WKR++ ++Q  C +  K LL 
Sbjct: 186 VDRDDVEQNLKNKPIWKRLYAKSQKGCYKLCKNLLN 221

>KAFR0E03930 Chr5 (777060..777089,777170..777775) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  221 bits (563), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 107/207 (51%), Positives = 135/207 (65%), Gaps = 2/207 (0%)

Query: 3   TYLNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFS 62
           T  +LPK FLG LPLY+ VE+ LG+T  NK SG FGILALFTGHPL F+QWV YLWS  +
Sbjct: 4   TSFSLPKSFLGVLPLYLAVEIVLGITAFNKVSGAFGILALFTGHPLAFMQWVFYLWSTVT 63

Query: 63  FVVYAQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLEDNTPTQ--KSIA 120
             V+AQGLF   KP++L FSQIF+ +SID              W+ +E  T      +I 
Sbjct: 64  LFVFAQGLFEIHKPNILTFSQIFVFYSIDTLCNCFFTLWFTGDWFNVESQTEAAVGSTIT 123

Query: 121 AAAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQ 180
                  +QGASQ +E+ MTIFITL SL+ R YFNF+LASFVQ LL+HP+YM D  D+EQ
Sbjct: 124 KRTEDISSQGASQGYEYSMTIFITLTSLVFRFYFNFILASFVQELLRHPKYMFDQDDIEQ 183

Query: 181 ELRTQPVWKRVWTRTQIRCLRYSKQLL 207
           +L+ + +WKR W + Q  C +  K LL
Sbjct: 184 DLKNKSIWKRWWLKCQKSCYKLCKNLL 210

>NCAS0F03370 Chr6 (681041..681070,681141..681746) [636 bp, 211 aa]
           {ON} Anc_5.433 YDR367W
          Length = 211

 Score =  216 bits (549), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 143/206 (69%), Gaps = 4/206 (1%)

Query: 5   LNLPK---RFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIF 61
           + LPK    F G +PLY+GVE+ LG+TI NKCSG +GILALFTGHPL+F+QWV YLWSIF
Sbjct: 6   ITLPKCFQSFFGIIPLYLGVEIVLGITIFNKCSGAYGILALFTGHPLDFVQWVFYLWSIF 65

Query: 62  SFVVYAQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLEDNTPTQKSIAA 121
           + +++AQGL+   KP+LL FSQI + +S+D            +QW+  E  T T++++  
Sbjct: 66  TLIIFAQGLYEIHKPTLLTFSQILVFYSLDTICTCIFTLWFTSQWFQTEP-TGTEEALQR 124

Query: 122 AAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQE 181
                 +QGA++++E++MTIFITL +L  RLYFN +LA+FVQ LL HP+Y+VD  DVEQ+
Sbjct: 125 RNESLESQGATEAYEYMMTIFITLVTLTFRLYFNCLLAAFVQELLHHPKYLVDQDDVEQD 184

Query: 182 LRTQPVWKRVWTRTQIRCLRYSKQLL 207
           L+ +PVWKR W + Q    +    LL
Sbjct: 185 LKNKPVWKRWWIKNQKWSYKVCSHLL 210

>Kpol_1062.30 s1062 complement(66657..67301) [645 bp, 214 aa] {ON}
           complement(66657..67301) [645 nt, 215 aa]
          Length = 214

 Score =  215 bits (547), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 100/205 (48%), Positives = 138/205 (67%), Gaps = 4/205 (1%)

Query: 4   YLNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSF 63
           Y NLP+ F GFLPLYIGVE  LG+TILNKCSG +GILALFTGHPL   QWV YLWS+F+ 
Sbjct: 14  YSNLPRSFFGFLPLYIGVETVLGITILNKCSGAYGILALFTGHPLNVFQWVSYLWSVFTL 73

Query: 64  VVYAQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLEDNTPTQKSIAAAA 123
           ++Y+QGLF    PSLL +SQIF+ FS D            +QW+T   +  +  S     
Sbjct: 74  IIYSQGLFQVHTPSLLTYSQIFVVFSFDTFLTCVFTMIFSSQWFTETGSGMSDGS----G 129

Query: 124 MQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQELR 183
           + E  QGAS+++E+  TI IT+ +L++R+YFNF+LA+F Q L  HP+YMVD+ DVEQ+L+
Sbjct: 130 VDEYGQGASETYEYTFTILITVVALVSRMYFNFILAAFNQELFLHPKYMVDFDDVEQDLK 189

Query: 184 TQPVWKRVWTRTQIRCLRYSKQLLT 208
            +    + W +++  C   ++ +LT
Sbjct: 190 NKNKIVQWWIKSKKSCYNLARHILT 214

>KNAG0C04920 Chr3 complement(950839..951462,951584..951613) [654 bp,
           217 aa] {ON} Anc_5.433 YDR367W
          Length = 217

 Score =  214 bits (544), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 136/210 (64%), Gaps = 8/210 (3%)

Query: 6   NLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFVV 65
           +LPK F G  PLYIGVE+ LGVT+LNKCSG FGILALFTGHPL+ +QW  YLWS+F+ VV
Sbjct: 7   SLPKTFFGIFPLYIGVEIVLGVTLLNKCSGAFGILALFTGHPLDLMQWASYLWSVFTLVV 66

Query: 66  YAQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLEDNTPTQKSIAAAAMQ 125
           YAQGL+   KP LL FSQI + FSID              W+  E NT      AA+A+ 
Sbjct: 67  YAQGLYQIHKPKLLTFSQIVVVFSIDTVLTCLFTLWFTGVWFAEESNTDAAMGTAASAVA 126

Query: 126 E--------PNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVD 177
                      QGA++S+E+V TI IT+ SL+ RLYFNF+LASFVQ LL+HP+Y+VD  D
Sbjct: 127 RLVKRGAEIDTQGATESYEYVFTIIITMVSLVFRLYFNFLLASFVQELLRHPQYLVDQDD 186

Query: 178 VEQELRTQPVWKRVWTRTQIRCLRYSKQLL 207
           +EQ+L+ +   +R W  +Q       + +L
Sbjct: 187 IEQDLKNKFFLRRWWVVSQKSSYSICRHVL 216

>CAGL0A02794g Chr1 (295534..295563,295751..296371) [651 bp, 216 aa]
           {ON} highly similar to uniprot|Q06346 Saccharomyces
           cerevisiae YDR367w
          Length = 216

 Score =  211 bits (536), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 98/210 (46%), Positives = 138/210 (65%), Gaps = 7/210 (3%)

Query: 5   LNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFV 64
           ++ PK F GFLPLY+GVE+ LG+TILNKCSG +GILALFTGHPL+++QW+ YLWS+F+ +
Sbjct: 6   ISFPKSFFGFLPLYLGVEIVLGITILNKCSGAYGILALFTGHPLDYMQWISYLWSVFTLI 65

Query: 65  VYAQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLEDNTPTQKSIAAAAM 124
           V++QGLF   KP L+VFSQI + F+ D             QW+   +    + S      
Sbjct: 66  VFSQGLFMIHKPKLIVFSQILVYFTADTVLTCFFTLWFSAQWFQSANEEKHETSAPVGVS 125

Query: 125 QE-------PNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVD 177
           Q         +QGAS+ +E+ +T+  TL +L+ R+YFNF+LASFVQ LL+HP+YMVD  D
Sbjct: 126 QNYRRSTDLASQGASERYEYTVTMLFTLVTLMFRMYFNFILASFVQELLRHPKYMVDQDD 185

Query: 178 VEQELRTQPVWKRVWTRTQIRCLRYSKQLL 207
           VEQ+L+ +   KR W ++Q  C +  +  L
Sbjct: 186 VEQDLKNKSAIKRWWIKSQKFCYKLCRHTL 215

>TPHA0E01770 Chr5 complement(356743..357396) [654 bp, 217 aa] {ON}
           Anc_5.433 YDR367W
          Length = 217

 Score =  207 bits (527), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 101/207 (48%), Positives = 137/207 (66%), Gaps = 1/207 (0%)

Query: 1   MKTYLNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSI 60
           M+T   LPK F GFLPLYIGVE  LG+TI NKCSG++GILALFTGHPL  +QWV YLWS 
Sbjct: 11  MQTPKLLPKSFFGFLPLYIGVETVLGITIFNKCSGIYGILALFTGHPLTAIQWVSYLWSS 70

Query: 61  FSFVVYAQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLEDNTPTQKSIA 120
           F+ ++YAQGLF    P+LL + QI I +S D            + W+T E N     + +
Sbjct: 71  FTLLIYAQGLFQVHHPNLLTYCQILITYSFDTICTCFFTIYFCSHWFTEESNAGDNIN-S 129

Query: 121 AAAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQ 180
           +  + + NQGAS+S EF  T+ +TL +L++R YFNF+LASF Q L  HP+YM+D  DVEQ
Sbjct: 130 STTVDKYNQGASESKEFFWTMTLTLIALVSRFYFNFILASFTQQLFLHPKYMIDQDDVEQ 189

Query: 181 ELRTQPVWKRVWTRTQIRCLRYSKQLL 207
           +L+ + +  + W +++ RC   SK+ L
Sbjct: 190 DLKNKSIIVQWWIKSKKRCYYTSKRFL 216

>TBLA0A06520 Chr1 complement(1599308..1599928) [621 bp, 206 aa] {ON}
           Anc_5.433 YDR367W
          Length = 206

 Score =  190 bits (483), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 94/202 (46%), Positives = 129/202 (63%), Gaps = 10/202 (4%)

Query: 7   LPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFVVY 66
           LPKRF G  PLY+GVE+ LG+TI NKC G +GILALF GHPLEF QWVLY WSI    +Y
Sbjct: 15  LPKRFCGVAPLYLGVELVLGITIFNKCGGAYGILALFNGHPLEFAQWVLYTWSIVCLAIY 74

Query: 67  AQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLEDNTPTQKSIAAAAMQE 126
           AQGL    +P+L  FSQ+FI FS+D            ++W+    NT T+   A      
Sbjct: 75  AQGLAKVHRPTLYTFSQVFIFFSVDTLLTCAFTVYFTHEWFA--ANTTTRPPAA------ 126

Query: 127 PNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQELRTQP 186
             QGAS ++E+ +++ +TLASL++RLYFNF++ SF+Q L   P Y +D  +VE ELR   
Sbjct: 127 --QGASDAYEYSVSLLVTLASLVSRLYFNFIVGSFLQELFFRPAYTLDTDEVETELRHSS 184

Query: 187 VWKRVWTRTQIRCLRYSKQLLT 208
           + +R+W + Q  C   S+++L+
Sbjct: 185 LLRRLWLQNQHYCYILSRRILS 206

>SAKL0G02508g Chr7 (207823..207855,207940..208593) [687 bp, 228 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 228

 Score =  184 bits (467), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 137/222 (61%), Gaps = 18/222 (8%)

Query: 5   LNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFV 64
           ++LPK FLGFLPLYIGVE+ LG++I NK SG +GILALFTGHPL+F+QW  Y  S+ + +
Sbjct: 7   VHLPKSFLGFLPLYIGVELGLGISIFNKFSGFYGILALFTGHPLDFMQWCFYSLSVLTLL 66

Query: 65  VYAQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLEDNTPTQKSIAAAAM 124
           VY  GL+   KP+ L +S + + F+ID             QW+++E+N   + ++  + +
Sbjct: 67  VYLSGLWQIRKPNPLTYSLVLVVFTIDTLLNCFFTIWFSAQWFSIEENDDNKGAVGTSKL 126

Query: 125 QE------------------PNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLL 166
           Q                    +Q ASQ +E+ MT+  T+ +L  R YFNF+LA+FVQ +L
Sbjct: 127 QSAGRALGPAKELNRRNNSLASQSASQGYEYTMTMLFTVLTLAVRFYFNFILAAFVQQML 186

Query: 167 QHPRYMVDYVDVEQELRTQPVWKRVWTRTQIRCLRYSKQLLT 208
           +HP+Y+VD  DVEQ+L+ + +++R+  +++  C    ++ L 
Sbjct: 187 RHPKYIVDKDDVEQDLKNKSLFRRLCIKSEKWCYNACQRALA 228

>TBLA0G02010 Chr7 (525436..526077) [642 bp, 213 aa] {ON} Anc_5.433
           YDR367W
          Length = 213

 Score =  166 bits (419), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 118/188 (62%), Gaps = 4/188 (2%)

Query: 7   LPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFVVY 66
           LP  F    PLY+GVE+ LG+ ILNKCSG +GILALFTGHPL  +QW+ Y+WSIF+ ++Y
Sbjct: 13  LPNSFFILFPLYLGVELILGICILNKCSGFYGILALFTGHPLSIVQWLTYIWSIFTLLIY 72

Query: 67  AQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLE-DNTPTQKSIAAAAMQ 125
            QG+F   KP++ +FSQIF  FS+D              W++ +  N  ++ S+      
Sbjct: 73  TQGMFHIKKPNVYLFSQIFTIFSLDTIFTLFLTLYFALDWFSSDHSNKQSENSLQRTEKD 132

Query: 126 ---EPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQEL 182
                 QGAS ++E  + + +TL +LI+R Y+N VLASF+  L  +P++++D  DVE +L
Sbjct: 133 IELSQKQGASSTYELFLIVIVTLFTLISRCYYNLVLASFLHKLFINPKFIIDQDDVETDL 192

Query: 183 RTQPVWKR 190
           + +  +K+
Sbjct: 193 KNKSFFKK 200

>Kwal_55.21432 s55 complement(834129..834752) [624 bp, 207 aa] {ON}
           YDR367W - Protein required for cell viability [contig
           130] FULL
          Length = 207

 Score =  159 bits (401), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 81/205 (39%), Positives = 119/205 (58%), Gaps = 21/205 (10%)

Query: 19  IGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFVVYAQGLFTYSKPSL 78
           +GVE+ LG+T+LNKCSG +GIL L TGH L+F+QWVLYL SI + +VY+ GL +  KPS+
Sbjct: 1   MGVEIGLGITVLNKCSGFYGILGLLTGHHLDFMQWVLYLTSIITVIVYSVGLSSIYKPSV 60

Query: 79  LVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLE-----------------DNTPTQKSIAA 121
           L +S I + F+ D             QW++ +                 +N+P+   I+ 
Sbjct: 61  LSYSLILLTFTTDTLVTCFFTLWFSGQWFSAKNSELTDPNSTTLQSSAGNNSPSGNLISK 120

Query: 122 AAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQE 181
                 +Q ASQ  E+  TI +T+ +L  R YFNF++ +FVQ LL+HP+Y+VD  DVEQ+
Sbjct: 121 RGDTLSSQSASQGTEYFFTILVTIFALATRFYFNFIIMAFVQRLLRHPKYVVDQDDVEQD 180

Query: 182 LRTQPVWKRVWTRTQIR----CLRY 202
           L+ +   +R W R +      C RY
Sbjct: 181 LKHRGFLRRWWIRAETHSYKICRRY 205

>AER256C Chr5 complement(1109526..1110152,1110213..1110305) [720 bp,
           239 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YDR367W; 1-intron
          Length = 239

 Score =  150 bits (380), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 116/205 (56%), Gaps = 12/205 (5%)

Query: 6   NLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFVV 65
           +LPK F G LPLYIGVE++LG+ I NK  GLFG+LALFTGHPL+ LQW+ YLWS  + +V
Sbjct: 28  HLPKSFFG-LPLYIGVELSLGIAIFNKFCGLFGLLALFTGHPLDILQWLFYLWSFVTLLV 86

Query: 66  YAQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLED--NTPTQKSIAAAA 123
           Y  GL    +P L  +  + + +S D              W+   D   T T K   A A
Sbjct: 87  YLHGLMQIYQPRLAAYCLVLVVYSTDTILTCLYTLWFTRGWFIDGDVGVTATAKEDDADA 146

Query: 124 MQ-------EP--NQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVD 174
            Q       EP  +Q AS+S+E+  T+  TL +L  R Y NF++ASFVQ + QH ++   
Sbjct: 147 TQGSVTVENEPVSHQSASKSYEYAFTMAFTLFALSLRFYSNFLIASFVQRMFQHNKFAAG 206

Query: 175 YVDVEQELRTQPVWKRVWTRTQIRC 199
             DVEQ+L+ + V  R + + Q  C
Sbjct: 207 CDDVEQDLKHKSVAYRAYAKMQRWC 231

>Ecym_4762 Chr4 complement(1482336..1482983,1483049..1483066) [666
           bp, 221 aa] {ON} similar to Ashbya gossypii AER256C
           1-intron
          Length = 221

 Score =  140 bits (352), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 74/219 (33%), Positives = 114/219 (52%), Gaps = 19/219 (8%)

Query: 7   LPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFVVY 66
           LP+ F G LPLYIGVE++LGV I NK  GL+GILALFTG PL+ +QW  Y+WS  + +V+
Sbjct: 4   LPQSFFG-LPLYIGVELSLGVAIFNKFCGLYGILALFTGRPLDLIQWGFYVWSFAALLVF 62

Query: 67  AQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLEDNTPTQKSIAAAAMQ- 125
            +GL    KP L+ +  +   +S+D              W++ ED +     ++   +  
Sbjct: 63  TKGLSQVYKPKLMTYCMVLTVYSLDTVLACFFAVLFTGDWFSKEDTSSGSNPVSGKGIGV 122

Query: 126 -----------------EPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQH 168
                            +  Q AS  +E+  TI +TL     R Y NF++ASFV+ +++ 
Sbjct: 123 VDVGKSGTQNFAYRRTVDDTQSASTHYEYSSTILLTLIVSALRFYSNFIIASFVRRMMKQ 182

Query: 169 PRYMVDYVDVEQELRTQPVWKRVWTRTQIRCLRYSKQLL 207
            RY+ +  DVE +L+   V  R +  TQ  C  + ++ L
Sbjct: 183 NRYITEPDDVEYDLKNTSVAYRAYVSTQRWCYYFCRRYL 221

>KLTH0F16082g Chr6 complement(1305673..1306293) [621 bp, 206 aa]
           {ON} similar to uniprot|Q06999 Saccharomyces cerevisiae
           YDR367W Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 206

 Score =  139 bits (349), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 119/194 (61%), Gaps = 16/194 (8%)

Query: 19  IGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFVVYAQGLFTYSKPSL 78
           +GVE+ LG+TILNKCSG +GIL L TGH L+F+QWVLYL S+F+ VVY+ GL T  KP L
Sbjct: 1   MGVEIGLGITILNKCSGFYGILGLLTGHQLDFMQWVLYLTSVFTLVVYSLGLTTVYKPKL 60

Query: 79  LVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLED------NTPTQKS----------IAAA 122
             ++ + + F+ D              W+  ++      ++ TQ++          + A 
Sbjct: 61  QTYAFVLLTFTADTLITCFFTLWFSGMWFAAKESELSDPSSATQQTSGGISSGSKLLTAR 120

Query: 123 AMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHPRYMVDYVDVEQEL 182
                +Q ASQ+ E+  TI ++L +L++R YFNF++ +FVQ L +HP+Y+VD  DV+Q+L
Sbjct: 121 GETLSSQSASQATEYFFTILVSLIALVSRFYFNFIILAFVQRLFRHPKYLVDQDDVDQDL 180

Query: 183 RTQPVWKRVWTRTQ 196
           + + +W+R W R +
Sbjct: 181 KHKKLWQRWWIRAE 194

>KLLA0E21099g Chr5 complement(1885338..1885976,1886092..1886127)
           [675 bp, 224 aa] {ON} similar to uniprot|Q06999
           Saccharomyces cerevisiae YDR367W Protein of unknown
           function green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm in a punctate pattern
          Length = 224

 Score =  139 bits (350), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 111/198 (56%), Gaps = 16/198 (8%)

Query: 5   LNLPKRFLGFLPLYIGVEVALGVTILNKCSGLFGILALFTGHPLEFLQWVLYLWSIFSFV 64
           ++LP+ FL + PLYIGVEVALGV   NK SG++G+LALFTGHPL+F+QW  Y+WSIF  V
Sbjct: 8   VHLPQTFLSY-PLYIGVEVALGVLTFNKFSGMYGVLALFTGHPLDFVQWTFYIWSIFCLV 66

Query: 65  VYAQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWYTLEDNTP-TQKSIAAAA 123
           V+  G+    KP++L+ S +   FS+D              W++ E +T  T    A  A
Sbjct: 67  VFISGIRQVYKPNILLMSTVTFVFSVDTIVSCIYCLWFTAVWFSQEGSTDVTDLKSAGTA 126

Query: 124 MQEPNQG--------------ASQSFEFVMTIFITLASLIARLYFNFVLASFVQGLLQHP 169
           +   ++G              AS  +EF + I +TL  L  R YFNF++ +F Q LL+  
Sbjct: 127 LGPAHEGTTSTISTKVDTSKSASSGYEFFLIILLTLVPLAVRFYFNFIIIAFQQQLLRSG 186

Query: 170 RYMVDYVDVEQELRTQPV 187
           ++  D  D+E  L  + +
Sbjct: 187 KFTFDQNDIEVNLHNRNI 204

>NDAI0B05660 Chr2 (1382276..1382761) [486 bp, 161 aa] {ON} Anc_5.433
           YDR367W
          Length = 161

 Score =  123 bits (308), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 64/165 (38%), Positives = 98/165 (59%), Gaps = 11/165 (6%)

Query: 51  LQWVLYLWSIFSFVVYAQGLFTYSKPSLLVFSQIFIAFSIDXXXXXXXXXXXXNQWY--- 107
           +QWV YLWSIF  +++AQGL+   KP+LL FSQI + F++D             QW+   
Sbjct: 1   MQWVAYLWSIFCLIIFAQGLYQIHKPTLLTFSQITVFFTLDTLFTCFFTLWFTAQWFQGS 60

Query: 108 ----TLEDNTPTQKSIAAAAMQEPNQGASQSFEFVMTIFITLASLIARLYFNFVLASFVQ 163
                ++ +T  QK   + A    +QGA+  +E+ +T+ IT  +L  R YFN +LASFVQ
Sbjct: 61  EGESAVQTSTGVQKRDTSLA----SQGATAGYEYFVTMLITFITLTFRFYFNCILASFVQ 116

Query: 164 GLLQHPRYMVDYVDVEQELRTQPVWKRVWTRTQIRCLRYSKQLLT 208
            LL +P++M+D  DVEQ+L+ + + KR W + +  C R  K +L+
Sbjct: 117 ELLSNPKFMIDQDDVEQDLKNKSMVKRWWIKNEKFCYRLCKSVLS 161

>TBLA0C01050 Chr3 complement(215303..216553) [1251 bp, 416 aa] {ON} 
          Length = 416

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 17/30 (56%), Gaps = 3/30 (10%)

Query: 37  FGILALFTGHPLEF---LQWVLYLWSIFSF 63
           FGI A + GHP EF   L   L  W IF+F
Sbjct: 273 FGIQAAYEGHPREFDNALAIFLLAWCIFTF 302

>KLLA0A09295g Chr1 (810967..811647) [681 bp, 226 aa] {ON} similar
          to uniprot|P38869 Saccharomyces cerevisiae YHR181W
          SVP26 Component of Sed5p vesicles
          Length = 226

 Score = 28.9 bits (63), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 5/36 (13%)

Query: 35 GLFGILALFTGHPLEFLQWVLYLWSIFSFVVYAQGL 70
          G++ +L LF G P     W+L  +SIF++VVY Q +
Sbjct: 53 GIYVLLLLFDGFP-----WLLTAFSIFTYVVYLQNM 83

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.141    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,224,731
Number of extensions: 683175
Number of successful extensions: 1958
Number of sequences better than 10.0: 26
Number of HSP's gapped: 1980
Number of HSP's successfully gapped: 26
Length of query: 208
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 103
Effective length of database: 41,441,469
Effective search space: 4268471307
Effective search space used: 4268471307
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 63 (28.9 bits)