Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F09966g5.431ON55455426450.0
TDEL0E019405.431ON56755013640.0
Suva_8.1715.431ON56755011871e-157
YOR118W (RTC5)5.431ON56755011851e-156
Smik_15.2965.431ON56655311481e-151
SAKL0G02464g5.431ON56357011371e-149
Skud_15.2815.431ON56755811241e-147
NCAS0H020505.431ON57356310991e-143
Kwal_55.214375.431ON55454910521e-137
Kpol_1016.75.431ON56257310491e-136
NDAI0C016105.431ON58459210401e-134
KLTH0F16126g5.431ON55454810361e-134
KLLA0E21143g5.431ON57258610301e-133
TPHA0H017905.431ON5655569821e-126
KNAG0B042305.431ON5775579711e-124
Ecym_47645.431ON5665749071e-115
CAGL0L11616g5.431ON5555859061e-115
AER258C5.431ON5575757831e-96
TBLA0A065305.431ON4925187092e-86
Kwal_33.134391.90ON1202143733.2
NCAS0A104503.251ON45967705.3
Kwal_56.246955.82ON41859706.3
TDEL0G010605.82ON42458697.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F09966g
         (554 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} simila...  1023   0.0  
TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {O...   530   0.0  
Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W ...   461   e-157
YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Prote...   461   e-156
Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118...   446   e-151
SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} simila...   442   e-149
Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118...   437   e-147
NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.4...   427   e-143
Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {...   409   e-137
Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON...   408   e-136
NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {O...   405   e-134
KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]...   403   e-134
KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]...   401   e-133
TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.4...   382   e-126
KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {O...   378   e-124
Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {O...   353   e-115
CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa...   353   e-115
AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}...   306   1e-96
TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa] ...   277   2e-86
Kwal_33.13439 s33 complement(224508..228116) [3609 bp, 1202 aa] ...    33   3.2  
NCAS0A10450 Chr1 (2075423..2076802) [1380 bp, 459 aa] {ON} Anc_3...    32   5.3  
Kwal_56.24695 s56 (1108048..1109304) [1257 bp, 418 aa] {ON} YGR2...    32   6.3  
TDEL0G01060 Chr7 (218816..220090) [1275 bp, 424 aa] {ON} Anc_5.8...    31   7.4  

>ZYRO0F09966g Chr6 (809604..811268) [1665 bp, 554 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 554

 Score = 1023 bits (2645), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/554 (90%), Positives = 500/554 (90%)

Query: 1   MGQRTSQATLQSSTHFTSNSDILKSFNDRALKQFTVTELVSFKNKLGKDLNERLTNEELT 60
           MGQRTSQATLQSSTHFTSNSDILKSFNDRALKQFTVTELVSFKNKLGKDLNERLTNEELT
Sbjct: 1   MGQRTSQATLQSSTHFTSNSDILKSFNDRALKQFTVTELVSFKNKLGKDLNERLTNEELT 60

Query: 61  KWLSVPQDEILLRELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSR 120
           KWLSVPQDEILLRELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSR
Sbjct: 61  KWLSVPQDEILLRELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSR 120

Query: 121 NYDQLKLWFIALSIRKTVKEDPNLXXXXXXXXXFDVTRILKTFDGLHVNELSVPFAYMVP 180
           NYDQLKLWFIALSIRKTVKEDPNL         FDVTRILKTFDGLHVNELSVPFAYMVP
Sbjct: 121 NYDQLKLWFIALSIRKTVKEDPNLSSSSSSEESFDVTRILKTFDGLHVNELSVPFAYMVP 180

Query: 181 FISWLLILTTYCPINNCKLENVAMFDNWNSYIKSAHTILRSMRPMDESSWIEYEPFAHTM 240
           FISWLLILTTYCPINNCKLENVAMFDNWNSYIKSAHTILRSMRPMDESSWIEYEPFAHTM
Sbjct: 181 FISWLLILTTYCPINNCKLENVAMFDNWNSYIKSAHTILRSMRPMDESSWIEYEPFAHTM 240

Query: 241 RSIAPHIFDPLTRVMEHLLFKDDELVDPLSENRGEIXXXXXXXXXXXXXXXXXXXXXXPI 300
           RSIAPHIFDPLTRVMEHLLFKDDELVDPLSENRGEI                      PI
Sbjct: 241 RSIAPHIFDPLTRVMEHLLFKDDELVDPLSENRGEIASSKLLNSALLAQISSALSKQLPI 300

Query: 301 YHLQRLYLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSVKNTRFRKFLHEYP 360
           YHLQRLYLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSVKNTRFRKFLHEYP
Sbjct: 301 YHLQRLYLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSVKNTRFRKFLHEYP 360

Query: 361 KLKPSDMDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSR 420
           KLKPSDMDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSR
Sbjct: 361 KLKPSDMDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSR 420

Query: 421 ENALYFNTXXXXXXXXNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGL 480
           ENALYFNT        NKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGL
Sbjct: 421 ENALYFNTIGGGIGIGNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGL 480

Query: 481 VVGDKDFEVKMLLQDVEVWGCGGXXXXXXXXXXXXXXXSEAKRRQQINLRSIGEDRALLE 540
           VVGDKDFEVKMLLQDVEVWGCGG               SEAKRRQQINLRSIGEDRALLE
Sbjct: 481 VVGDKDFEVKMLLQDVEVWGCGGEKELEEQLKQWEWEESEAKRRQQINLRSIGEDRALLE 540

Query: 541 MAGLVGQAQSGGSV 554
           MAGLVGQAQSGGSV
Sbjct: 541 MAGLVGQAQSGGSV 554

>TDEL0E01940 Chr5 complement(365414..367117) [1704 bp, 567 aa] {ON}
           Anc_5.431 YOR118W
          Length = 567

 Score =  530 bits (1364), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 262/550 (47%), Positives = 361/550 (65%), Gaps = 12/550 (2%)

Query: 15  HFTSNSDILKSFNDRALKQFTVTELVSFKNKL-GKDLNERLTNEELTKWLSVPQDEILLR 73
            FTSNS++++ F+ RA+  FT TEL +FK+KL GK L + + +EELT+WL +P + +LL 
Sbjct: 20  QFTSNSELMEFFDKRAVHMFTATELAAFKSKLEGKTLKDPVRSEELTRWLRIPCENVLLC 79

Query: 74  ELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWFIALS 133
           E +Y FV+VL NFPLMK+S+++VTG+G+LK+++LTNP +C KYV  +NYD +KL FIALS
Sbjct: 80  EAVYEFVRVLSNFPLMKDSFDDVTGVGLLKSVLLTNPSKCHKYVGVKNYDHMKLLFIALS 139

Query: 134 IRKTVKEDPNLXXXXXXXXXFDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILTTYCP 193
           +RK+VKE+P+               +L+T++ + V++L++P   +V  ++WLLILT+YCP
Sbjct: 140 MRKSVKEEPSCSSSTSLEDGGGSINLLRTYNNIVVDDLAIPATSLVQLLAWLLILTSYCP 199

Query: 194 INNCKLENVAMFDNWNSYIKSAHTILRSMR----PMDESSWIEYEPFAHTMRSIAPHIFD 249
            +NC+     ++  W S+  +A  +LR+M        ES  +++E F+  + ++ P+IF 
Sbjct: 200 TSNCQFPEDVVYAEWGSFKLAATNLLRTMNNNIVTNLESYSVKFEQFSKAISTVMPNIFR 259

Query: 250 PLTRVMEHLLFKDDELVDPLSENRGEIXXXXXXXXXXXXXXXXXXXXXXPIYHLQRLYLG 309
            L  VMEHLL++D +LV   S + G I                           Q LY+G
Sbjct: 260 ALQNVMEHLLYQDSDLVSFPSNSAGPILTSKPTTQAVLAQLITALSNEMTFAKFQNLYVG 319

Query: 310 RDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSVKNTRFRKFLHEYPKLKPSDMDT 369
           R+ GFSMRS QAKVFKW APT+MLL GK +LDDE++S KN+R+R FL +YPKLK  D D 
Sbjct: 320 RESGFSMRSLQAKVFKWMAPTVMLLSGKCVLDDEDFSKKNSRYRDFLSKYPKLK--DRDQ 377

Query: 370 EVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENALYFNTX 429
            + ++   K+K++ AVY+ +PWK TNK++FGG  TTIVQLSP Q+VF ++    +YFNT 
Sbjct: 378 HLSDLQKNKTKVVFAVYIPEPWKTTNKDYFGGSGTTIVQLSPTQDVFKAASNEVMYFNTL 437

Query: 430 XXXXXXXNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVG-----D 484
                  N QP IK+  KSYSPGNVSLT+DS LEFA  RH G GG   PGL++      D
Sbjct: 438 GGGIGIGNNQPHIKNGVKSYSPGNVSLTIDSTLEFAAFRHVGYGGTFNPGLLLTQFNRED 497

Query: 485 KDFEVKMLLQDVEVWGCGGXXXXXXXXXXXXXXXSEAKRRQQINLRSIGEDRALLEMAGL 544
             FE+K L+QDVEVWGCGG               +EAKRRQ INLRS GEDRALLEMAGL
Sbjct: 498 DPFEIKFLIQDVEVWGCGGKEELEEQYKKWQWEEAEAKRRQNINLRSFGEDRALLEMAGL 557

Query: 545 VGQAQSGGSV 554
           VG +Q+GGS+
Sbjct: 558 VGHSQNGGSM 567

>Suva_8.171 Chr8 (304635..306338) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  461 bits (1187), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 244/550 (44%), Positives = 343/550 (62%), Gaps = 14/550 (2%)

Query: 16  FTSNSDILKSFNDRALKQFTVTELVSFKNKLG-KDLNERLTNEELTKWLSVPQDEILLRE 74
           FT+N D+L  FN +A +Q TV ELVS K  L  +D+N  ++++ L   L  PQ   LL  
Sbjct: 21  FTNNGDVLAYFNHKAQQQVTVPELVSLKGNLQIEDMNTPISHKSLCSVLHFPQKHTLLSG 80

Query: 75  LLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWFIALSI 134
           ++ N ++VL NFPLM +SYE +TG G+LK I+L N  RC KY+K ++YDQLKL FI+LS+
Sbjct: 81  IVTNMLRVLSNFPLMNSSYEPITGYGLLKCILLLNKGRCGKYLKFKSYDQLKLLFISLSL 140

Query: 135 RKTVKEDPNLXXXXXXXXXFDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILTTYCPI 194
           +KT KE+ +           ++ +I+  FD +    L VP  +M+ F+SWLLIL+  CP 
Sbjct: 141 QKTDKEELSEENENNVKKERNIKQIIANFDDVDSEVLYVPADFMLQFLSWLLILSVECPT 200

Query: 195 NNCKLENVAMFDNWNSYIKSAHTILRSMRP----MDESSWIEYEPFAHTMRSIAPHIFDP 250
           +N K+ N  ++D W+S+  SA  +LR+M P      ES  I ++ F+ ++R++ P++  P
Sbjct: 201 SNSKMGNSKIYDQWDSFKISAMNLLRTMNPDVVSNTESHLITFDQFSTSIRTVMPNLLKP 260

Query: 251 LTRVMEHLLFKDDELVDPLSENRGEIXXXXXXXXXXXXXXXXXXXXXXPIYHLQRLYLGR 310
           L  +MEH  + +++LV+    +   +                       I  LQ LY+GR
Sbjct: 261 LENLMEHFFYLENDLVN-YDTSLSSVRDSRIMTPALLTQLSTVLPRELFIQKLQSLYIGR 319

Query: 311 DHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSV-KNTRFRKFLHEYPKLKPSDMDT 369
             GFSMRS QAKVFKW AP+I+++ G RI + +EY+  KN R+R FL E+PKLK  D D 
Sbjct: 320 KSGFSMRSLQAKVFKWMAPSILIVSGTRITNSDEYAAQKNPRYRHFLEEFPKLK--DSDQ 377

Query: 370 EVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENALYFNTX 429
           +++  Y  K K   AVY+ DPWK+TNK++FG  +T I+Q+SP Q+++  +R+  +YFNT 
Sbjct: 378 KMDASYTNKKKTTFAVYIDDPWKVTNKDYFGDMNTRIIQISPRQDIYKVNRKGTIYFNTI 437

Query: 430 XXXXXXXNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPG-LVVGDKD-- 486
                  +KQP+IK  +K + PGNVSLT DS LEFAV RH G GG L+PG L V  K+  
Sbjct: 438 GGGIGIGDKQPLIKPASKRFIPGNVSLTFDSTLEFAVFRHTGYGGSLEPGSLSVERKEED 497

Query: 487 --FEVKMLLQDVEVWGCGGXXXXXXXXXXXXXXXSEAKRRQQINLRSIGEDRALLEMAGL 544
             FE+  L+QDVEVWGCGG               +E+KRRQQINLRS+GEDRALLEMAGL
Sbjct: 498 SFFELHFLIQDVEVWGCGGEKELEEQMKQMAWEEAESKRRQQINLRSLGEDRALLEMAGL 557

Query: 545 VGQAQSGGSV 554
           VGQ + GGS+
Sbjct: 558 VGQNRGGGSM 567

>YOR118W Chr15 (546857..548560) [1704 bp, 567 aa] {ON}  RTC5Protein
           of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm; null
           mutation suppresses cdc13-1 temperature sensitivity
          Length = 567

 Score =  461 bits (1185), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 241/550 (43%), Positives = 339/550 (61%), Gaps = 14/550 (2%)

Query: 16  FTSNSDILKSFNDRALKQFTVTELVSFKNKLG-KDLNERLTNEELTKWLSVPQDEILLRE 74
           FT++ DIL  FN++A +Q T+ ELVSFK  L  +DLN  ++++ L   L  PQ+  ++  
Sbjct: 21  FTNSKDILAYFNNKAQQQVTIPELVSFKGNLQIEDLNTPISHKALCNSLYFPQNHAMIVG 80

Query: 75  LLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWFIALSI 134
           ++ N ++VL NFPLMK+SYE +TG G+LK I+L N  RC K++K+++YDQLKL FI+LS+
Sbjct: 81  IVTNMLRVLSNFPLMKSSYEPITGYGLLKCILLLNRARCAKFLKTKSYDQLKLLFISLSL 140

Query: 135 RKTVKEDPNLXXXXXXXXXFDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILTTYCPI 194
           +KT KE+ +            + +I+  FD +    L +P  +M+ F++WLLILT  CP 
Sbjct: 141 QKTDKEELSEESENDGNKELTIKQIITGFDDVDTEMLCIPADFMLQFLTWLLILTVDCPT 200

Query: 195 NNCKLENVAMFDNWNSYIKSAHTILRSMRP----MDESSWIEYEPFAHTMRSIAPHIFDP 250
            N KL+N    D W ++  SA  +LR+M P      ES  I ++ F+  +R++ P++  P
Sbjct: 201 TNSKLDNTETHDQWGNFKVSALNLLRTMNPDVVGDIESHSITFQQFSTAIRTVMPNLLKP 260

Query: 251 LTRVMEHLLFKDDELVDPLSENRGEIXXXXXXXXXXXXXXXXXXXXXXPIYHLQRLYLGR 310
           L  +MEH  +   +LVD    N   I                       I+ LQ LY+GR
Sbjct: 261 LENLMEHFFYLQHDLVDH-DTNLSSIQDSKVMTPALLAQLSTGLPKELFIHKLQSLYIGR 319

Query: 311 DHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSV-KNTRFRKFLHEYPKLKPSDMDT 369
             GFSMRS QAKVFKW AP+I+++ G RI + EEY+  KN R+R FL E+PKLK SD   
Sbjct: 320 KSGFSMRSLQAKVFKWMAPSILVVSGMRITNSEEYAAEKNPRYRHFLEEFPKLKESDQMM 379

Query: 370 EVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENALYFNTX 429
           +   +   K K   AVY+ DPWK+TNK++FG  +T I+++SP Q+++  +++  +YFNT 
Sbjct: 380 DASHL--NKRKTTFAVYIDDPWKVTNKDYFGDLNTRIIEISPRQDIYKVNQKGTIYFNTI 437

Query: 430 XXXXXXXNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVGDKD--- 486
                  +KQP+IK  +K Y PGNVSLT DS LEFAV R+ G GG L PGL+  ++    
Sbjct: 438 GGGIGIGDKQPLIKPASKRYIPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERKEEN 497

Query: 487 --FEVKMLLQDVEVWGCGGXXXXXXXXXXXXXXXSEAKRRQQINLRSIGEDRALLEMAGL 544
             +E+  L+QDVEVWGCGG               +E+KRRQQINLRS+GEDRALLEMAGL
Sbjct: 498 SPYELHFLIQDVEVWGCGGEKELEEQIKQLEWEEAESKRRQQINLRSLGEDRALLEMAGL 557

Query: 545 VGQAQSGGSV 554
           VGQ Q GGS+
Sbjct: 558 VGQHQGGGSM 567

>Smik_15.296 Chr15 (507990..509690) [1701 bp, 566 aa] {ON} YOR118W
           (REAL)
          Length = 566

 Score =  446 bits (1148), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 238/553 (43%), Positives = 336/553 (60%), Gaps = 15/553 (2%)

Query: 13  STHFTSNSDILKSFNDRALKQFTVTELVSFKNKLG-KDLNERLTNEELTKWLSVPQDEIL 71
           S  F ++ D+L  FN +A +Q TV ELVS K  L  ++LN  ++++ L  +L  PQ+  +
Sbjct: 18  SRKFANDRDVLTYFNTKAQRQITVPELVSLKGNLQIENLNTPISHKRLCNFLYFPQNHTI 77

Query: 72  LRELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWFIA 131
           +  ++ N ++VL NFPL+ +SYE +TG G+LK I+L N  RC+K++K ++YDQLKL FI+
Sbjct: 78  IVGIVTNMLRVLSNFPLVNSSYEPITGYGLLKCIVLLNKSRCEKFLKIKSYDQLKLLFIS 137

Query: 132 LSIRKTVKEDPNLXXXXXXXXXFDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILTTY 191
           LS++KT KE+ +           ++ +I+  FD +    L +P  +M+ F++WLLIL+  
Sbjct: 138 LSLQKTDKEELSEDNENNGVKEKNIKQIITGFDDVDTEVLYLPADFMLQFLTWLLILSVE 197

Query: 192 CPINNCKLENVAMFDNWNSYIKSAHTILRSMRP----MDESSWIEYEPFAHTMRSIAPHI 247
           CP  N  + N      W+ +   A  +LR+M P      ES +I Y+ F+  +R++ P++
Sbjct: 198 CPTTNSTINNETNVQ-WDKFKIPAMNLLRTMNPDVVNNIESHFITYQQFSTAIRTVMPNL 256

Query: 248 FDPLTRVMEHLLFKDDELVDPLSENRGEIXXXXXXXXXXXXXXXXXXXXXXPIYHLQRLY 307
             PL  +MEH L+   +LVD    N   I                       I  LQ LY
Sbjct: 257 LKPLENLMEHFLYLQHDLVD-YDTNLSSIQDSKIMTPALLAQLSTGLPKELFIQKLQSLY 315

Query: 308 LGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSV-KNTRFRKFLHEYPKLKPSD 366
           +GR  GFSMRS QAKVFKW AP+I+++ G RI + EEY+  KN R+R FL E+P LK SD
Sbjct: 316 IGRKSGFSMRSLQAKVFKWMAPSILVVSGVRITNSEEYAANKNPRYRHFLEEFPILKDSD 375

Query: 367 MDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENALYF 426
              +   M   K K   AVY+ DPWK+TNK++FG  +T I+Q+SP Q+++  +++  +YF
Sbjct: 376 QKMDASLM--NKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQISPRQDIYKVNKKGTVYF 433

Query: 427 NTXXXXXXXXNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVGDK- 485
           NT        NKQP+IKS +K Y PGNVSLT DS LEFAV R+ G GG L PGL+  ++ 
Sbjct: 434 NTIGGGIGIGNKQPLIKSASKRYVPGNVSLTFDSTLEFAVFRNTGYGGSLDPGLLSMERK 493

Query: 486 ----DFEVKMLLQDVEVWGCGGXXXXXXXXXXXXXXXSEAKRRQQINLRSIGEDRALLEM 541
                FE+ +L+QDVEVWGCGG               +E+KRRQQINLRS+GEDRALLEM
Sbjct: 494 EENSSFELHILIQDVEVWGCGGEKELEEQIKQLAWEEAESKRRQQINLRSLGEDRALLEM 553

Query: 542 AGLVGQAQSGGSV 554
           AGLVGQ Q GGS+
Sbjct: 554 AGLVGQHQGGGSM 566

>SAKL0G02464g Chr7 (204358..206049) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q12108 YOR118W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 563

 Score =  442 bits (1137), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 246/570 (43%), Positives = 350/570 (61%), Gaps = 23/570 (4%)

Query: 1   MGQRTSQATLQSST--HFTSNSDILKSFNDRALKQFTVTELVSFKNKL-GKDLNERLTNE 57
           MGQ  S  T  +     F S  D+L  F  RA KQFT  ELV+FK+ L GKD N++++ E
Sbjct: 1   MGQTASSGTGTTGNVLQFESQHDLLGYFAARATKQFTTPELVAFKSNLKGKDQNDKVSVE 60

Query: 58  ELTKWLSVPQDEILLRELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYV 117
           E+ + L +P    LL +LL+N ++ L NFPL++ SY+++T  G+LK+ IL + +RC KYV
Sbjct: 61  EMLQLLKIPLGNELLADLLHNCIKTLSNFPLIRESYDDITVAGLLKSCILLSHDRCIKYV 120

Query: 118 KSRNYDQLKLWFIALSIRKTVKEDPNLXXXXXXXXXFDVTRILKTFDGLHVNELSVPFAY 177
             +NYDQLKL +IAL++RKTVKE P+          +D   I++ ++ + +++L VP   
Sbjct: 121 GFKNYDQLKLIYIALALRKTVKELPS---SPDPAKPWDAKSIIRNYNSVDIDDLYVPADS 177

Query: 178 MVPFISWLLILTTYCPINNCKLENVAMFDNWNSYIKSAHTILRSMRP-----MDE-SSWI 231
           M+  ++  L+L+ +C +NN K+   ++F +W+ Y  +A  +LR+M P      D     I
Sbjct: 178 MLQLLTLSLVLSRHCTVNNAKIRE-SVFQHWDDYKANAMNLLRTMNPDIVNTQDTVQCVI 236

Query: 232 EYEPFAHTMRSIAPHIFDPLTRVMEHLLFKDDELVDPLSENRGEIXXXXXXXXXXXXXXX 291
            +E F++ + ++ P +  PL  ++EH+L+ D +L D L  N   +               
Sbjct: 237 SFEQFSNAIAAVFPQVLKPLEILVEHMLYLDRDLTDEL--NSTSMPSTSKLVTEPLLAQL 294

Query: 292 XXXXXXXPIY-HLQRLYLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSV-KN 349
                   +Y  L++LY+GR+ GFSMRSFQ+K FKW AP+I+L+ G RI DD+EY+  KN
Sbjct: 295 STMLPKELVYSKLRKLYVGRESGFSMRSFQSKAFKWMAPSILLIGGMRITDDQEYATTKN 354

Query: 350 TRFRKFLHEYPKLKPSDMDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQL 409
            R++KFL EYP+LK  D    ++     + K++ AVYV++PWK+TNKE FG   TT+VQL
Sbjct: 355 PRYKKFLEEYPRLKDKDQHI-IDPCSLNRRKLLFAVYVNEPWKVTNKELFGDLKTTVVQL 413

Query: 410 SPFQEVFGSSRENALYFNTXXXXXXXXNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRH 469
           SP QE+F + R   +YFNT          QPVIK   K Y PGNVSLT+DS+LEFA  RH
Sbjct: 414 SPKQELFKAVRTGNVYFNTLGGGIGVGCAQPVIKPNGKKYFPGNVSLTIDSSLEFASFRH 473

Query: 470 AGQGGVLKPGLVVGDKD-----FEVKMLLQDVEVWGCGGXXXXXXXXXXXXXXXSEAKRR 524
            G GG + PG ++   +     FE K ++QDVEVWGCGG               +EAKRR
Sbjct: 474 VGYGGAISPGTLMTKLEEEKTTFEYKFIVQDVEVWGCGGEKELQEQIKQWEWEEAEAKRR 533

Query: 525 QQINLRSIGEDRALLEMAGLVGQAQSGGSV 554
           Q+INL+SIGEDRALLEMAGLVGQ QSGGS+
Sbjct: 534 QRINLQSIGEDRALLEMAGLVGQHQSGGSM 563

>Skud_15.281 Chr15 (503290..504993) [1704 bp, 567 aa] {ON} YOR118W
           (REAL)
          Length = 567

 Score =  437 bits (1124), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 235/558 (42%), Positives = 339/558 (60%), Gaps = 19/558 (3%)

Query: 1   MGQRTSQATLQ-----SSTHFTSNSDILKSFNDRALKQFTVTELVSFKNKLG-KDLNERL 54
           MGQ +S ++       SS  FT+N D+L  FN++A +Q T+ ELVSFK  L  ++LN  +
Sbjct: 1   MGQSSSVSSRNEEGSSSSKKFTNNRDVLSYFNNKAQQQVTIPELVSFKGNLQIENLNTPI 60

Query: 55  TNEELTKWLSVPQDEILLRELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCK 114
           +++ L   L  P +  ++  ++ N ++VL NFPL+ +SYE +TG G+LK I+L N  RC+
Sbjct: 61  SHKPLFNVLHFPPNHTIVVGIVTNMLRVLSNFPLINSSYEPITGFGLLKCILLLNRTRCE 120

Query: 115 KYVKSRNYDQLKLWFIALSIRKTVKEDPNLXXXXXXXXXFDVTRILKTFDGLHVNELSVP 174
           K++K ++YDQLKL FI+LS++KT KE+ +            V +I+  FD +    L +P
Sbjct: 121 KFLKIKSYDQLKLLFISLSLQKTDKEELSEENEENINRERHVKQIITDFDDVDTEMLCLP 180

Query: 175 FAYMVPFISWLLILTTYCPINNCKLENVAMFDNWNSYIKSAHTILRSMRP----MDESSW 230
             +M+ F+SWLLIL+   P  N K +N   ++ W+++  SA  +LR+M P      ES +
Sbjct: 181 ADFMLQFLSWLLILSVKFPTTNSKTDNDKTYEQWDTFKISAMNLLRTMNPDVVSNVESHF 240

Query: 231 IEYEPFAHTMRSIAPHIFDPLTRVMEHLLFKDDELVDPLSENRGEIXXXXXXXXXXXXXX 290
           I +E F+  +R++ P++F PL  +MEH  + D++LV     N   I              
Sbjct: 241 ITFEQFSTAIRTVMPNLFKPLENLMEHFFYLDNDLVSR-DANLSSIQDSRIMTPALLAQL 299

Query: 291 XXXXXXXXPIYHLQRLYLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSV-KN 349
                    I  LQ LY+GR  GFSMRS QAKVFKW AP+I+++ G RI + +EY+  KN
Sbjct: 300 STGLPKELFIQKLQSLYIGRKSGFSMRSLQAKVFKWMAPSILVVSGMRITNSDEYAAEKN 359

Query: 350 TRFRKFLHEYPKLKPSDMDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQL 409
            R+R FL E+PKLK SD   +   +  +K K   AVY+ DPWK+TNK++FG  +T I+Q+
Sbjct: 360 PRYRHFLDEFPKLKDSDQKMDASHL--SKKKTTFAVYIDDPWKVTNKDYFGDLNTRIIQI 417

Query: 410 SPFQEVFGSSRENALYFNTXXXXXXXXNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRH 469
           SP Q+++  +++  +YFNT        +KQP IK+ +K Y PGNVSLT DS LEFAV RH
Sbjct: 418 SPRQDIYKVNQKGTIYFNTIGGGIGIGDKQPFIKAASKRYIPGNVSLTFDSTLEFAVFRH 477

Query: 470 AGQGGVLKPGLVVGDKD-----FEVKMLLQDVEVWGCGGXXXXXXXXXXXXXXXSEAKRR 524
            G GG+L PGL+  ++      FE+  L+QDVEVWGCGG               +E+KRR
Sbjct: 478 TGYGGLLDPGLLSMERKEENSFFELHFLIQDVEVWGCGGEKELEEQIKQMAWEEAESKRR 537

Query: 525 QQINLRSIGEDRALLEMA 542
           QQIN RS+GEDRALLEMA
Sbjct: 538 QQINFRSLGEDRALLEMA 555

>NCAS0H02050 Chr8 (398606..400327) [1722 bp, 573 aa] {ON} Anc_5.431
           YOR118W
          Length = 573

 Score =  427 bits (1099), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 233/563 (41%), Positives = 331/563 (58%), Gaps = 40/563 (7%)

Query: 16  FTSNSDILKSFNDRALKQFTVTELVSFKNKLGKDLN------ERLTNEELTKWLSVPQDE 69
           F S  ++ +SF  R L  FT  ELV+FK K+G +        E ++  ELT  L +P++ 
Sbjct: 27  FNSEEELRESFKRRILCHFTPLELVAFKKKIGHEQTDSEAGVEYISKNELTNLLHLPREN 86

Query: 70  ILLRELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWF 129
           +LL +L Y  + +L NFPL++     VT IG+L  IIL + ERC +++ S  YDQL L F
Sbjct: 87  VLLVDLTYKLIAILSNFPLLREPQTEVTEIGLLMCIILLSKERCHRFIGSNTYDQLGLIF 146

Query: 130 IALSIRKTVKEDPNLXXXXXXXXXFDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILT 189
           IA+S+    K    L          +V  +L+TFD + ++EL +P   ++ F+SW L+L 
Sbjct: 147 IAMSLDYADK----LLPYARTPKKLNVEELLRTFDNIPIDELEIPAPVLLQFLSWGLLLL 202

Query: 190 TYCPINNCKLENVAMF-DNWNSYIKSAHTILRSMRPMDES-------SWIEYEPFAHTMR 241
             CP +NC+L+ +  F  NW+SY K+A  I+RSM   D+S         I Y  F+   +
Sbjct: 203 IKCPTSNCQLKPINEFYQNWSSYEKAAKNIIRSM---DQSIIRNLTDVRINYTQFSDVFK 259

Query: 242 SIAPHIFDPLTRVMEHLLFKDDELVD----PLSENRGEIXXXXXXXXXXXXXXXXXXXXX 297
           ++ P+   PL  +M HLL+ D +L+D    P++ ++                        
Sbjct: 260 AVLPNFTTPLESLMGHLLYMDSDLIDHETMPMNNSK-------LMSEPLLAQLATVLPKE 312

Query: 298 XPIYHLQRLYLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSV-KNTRFRKFL 356
             +  LQ+LY+GR+ GFSMRS Q+K F W AP+I+L+ G  I DD +Y+  KN R+ KFL
Sbjct: 313 LFLSKLQKLYVGRESGFSMRSLQSKCFNWEAPSILLVSGMLISDDLQYAKEKNPRYGKFL 372

Query: 357 HEYPKLKPSDMDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVF 416
            +YPKLK  +    ++  +  + K   AVY+ DPW++TNKEFFG  ++ I+QL+P Q+VF
Sbjct: 373 EQYPKLK--EEQQHLDACHSQRKKATFAVYIDDPWRVTNKEFFGSMNSMIIQLAPRQDVF 430

Query: 417 GSSRENALYFNTXXXXXXXXNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVL 476
            +S+ N +YFNT        NKQP+I +  K Y PGNVSLT+DS LEFAV RH G GG  
Sbjct: 431 HASKPNMIYFNTVGGGIGFGNKQPLISNAHKKYIPGNVSLTIDSTLEFAVFRHIGYGGAF 490

Query: 477 KPGLVVG-----DKDFEVKMLLQDVEVWGCGGXXXXXXXXXXXXXXXSEAKRRQQINLRS 531
           KP  ++      D+ FE+K ++QDVEVWGCGG               +EAKRRQ INL+S
Sbjct: 491 KPSALLTKRGKEDESFEIKFIIQDVEVWGCGGEKELQEQIKKLEWEEAEAKRRQHINLKS 550

Query: 532 IGEDRALLEMAGLVGQAQSGGSV 554
           +GEDRALLEMAGLVGQ+QSGGS+
Sbjct: 551 LGEDRALLEMAGLVGQSQSGGSM 573

>Kwal_55.21437 s55 complement(836842..838506) [1665 bp, 554 aa] {ON}
           YOR118W - Hypothetical ORF [contig 130] FULL
          Length = 554

 Score =  409 bits (1052), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 231/549 (42%), Positives = 327/549 (59%), Gaps = 20/549 (3%)

Query: 15  HFTSNSDILKSFNDRALKQFTVTELVSFKNKL-GKDLNERLTNEELTKWLSVPQDEILLR 73
            F S  D++  F+ +A+K  T  ELVSFK  + GKDL++ +T++EL K L +      + 
Sbjct: 17  QFNSEKDVIIWFDKKAIKSLTSPELVSFKANINGKDLSDVVTSDELLKVLRLDGVNETVS 76

Query: 74  ELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWFIALS 133
            L++N VQ L NFP +++ YEN+T  G+LK+ +L N  RC  YVK++ YD  KL +I+L+
Sbjct: 77  SLIFNCVQTLSNFPFIRDCYENITYSGLLKSCVLLNKARCLSYVKNKRYDHTKLVYISLA 136

Query: 134 IRKTVKEDPNLXXXXXXXXXFDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILTTYCP 193
           + KTVKE   +          D  RI+ TF+ + V EL+VP   M+ FI+ +L ++    
Sbjct: 137 LNKTVKE---VSSSSNSQESLDAPRIIATFNSVCVEELTVPSEVMLEFITLMLKMSKSTI 193

Query: 194 INNCKLE-NVAMFDNWNSYIKSAHTILRSMRPMDESS------WIEYEPFAHTMRSIAPH 246
           I N KL+ NV+  + W S+   A +ILR+M     +        I +  F  T+ ++ P+
Sbjct: 194 IKNSKLDPNVS--EGWESFRPFALSILRTMNTNIATQNDLLKYGITFSQFQSTISTVCPN 251

Query: 247 IFDPLTRVMEHLLFKDDELVDPLSENRGEIXXXXXXXXXXXXXXXXXXXXXXPIYHLQRL 306
           +  P   +MEH+LF   +LVD +  ++  +                          LQ+L
Sbjct: 252 LLLPFESLMEHVLFLGRDLVD-IDASQPPLLESKLVSEPLLAQLATVWPRELVFSRLQKL 310

Query: 307 YLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYS-VKNTRFRKFLHEYPKLKPS 365
           Y+GRD GFSMRSFQAK FKW AP+I+L+ G RI +DEEY+  KN R++ FL EYP+LK  
Sbjct: 311 YVGRDSGFSMRSFQAKAFKWMAPSILLIHGVRIPNDEEYAKSKNHRYKNFLEEYPRLK-- 368

Query: 366 DMDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENALY 425
           + D  +   +  K K++ AVYV+ PWK+TN E FG   TTI+QLSP QEV+ +SR   +Y
Sbjct: 369 EEDQVLLPPFSGKKKLLFAVYVNVPWKVTNSELFGDLKTTIIQLSPIQEVYKASRPGNIY 428

Query: 426 FNTXXXXXXXXNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVGDK 485
           FNT        + QP++K T++ Y PGNVSLT+D  LEFAV R AG GG +KP   + + 
Sbjct: 429 FNTLGGGIGVGSPQPIVKPTSRKYLPGNVSLTIDPNLEFAVFRSAGFGGSIKPSSTIVN- 487

Query: 486 DFEVKMLLQDVEVWGCGGXXXXXXXXXXXXXXXSEAKRRQQINLRSIGEDRALLEMAGLV 545
             E K L+QD+E WGCGG               +EA+RRQ+INL+SI +DRALLEMAGLV
Sbjct: 488 --EHKFLIQDIEAWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSINDDRALLEMAGLV 545

Query: 546 GQAQSGGSV 554
           GQ QSGGS+
Sbjct: 546 GQNQSGGSI 554

>Kpol_1016.7 s1016 complement(14315..16003) [1689 bp, 562 aa] {ON}
           complement(14315..16003) [1689 nt, 563 aa]
          Length = 562

 Score =  408 bits (1049), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 224/573 (39%), Positives = 331/573 (57%), Gaps = 30/573 (5%)

Query: 1   MGQ------RTSQATLQSSTHFTSNSDILKSFNDRALKQFTVTELVSFKNKLG-KDLNER 53
           MGQ      + S+ T        S  DIL  FN+R+L      E+  FK++LG KDL++ 
Sbjct: 1   MGQTPSVESQESKETKNEMPELKSREDILDFFNNRSLSILLPMEIECFKSRLGDKDLSDP 60

Query: 54  LTNEELTKWLSVPQDEILLRELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERC 113
           LT +E    L +      L+ LL+NF   +  FP + N  E++TG G+LK IIL   ER 
Sbjct: 61  LTKDEFNTLLRIADSNSQLQILLWNFFLKISAFPFLSNRSESMTGFGILKGIILLTRERI 120

Query: 114 KKYVKSRNYDQLKLWFIALSIRKTVKEDPNLXXXXXXXXXFDVTRILKTFDGLHVNELSV 173
           KKY+   N   +KL FI L+ ++ V               F +  +L T DG+ +   +V
Sbjct: 121 KKYLGWSNAKLIKLIFIGLTSQEKV-------GVKTEASVFKIQHVLDTLDGIDLASSTV 173

Query: 174 PFAYMVPFISWLLILTTYCPINNCKLENVAMFDNWNSYIKSAHTILRSMRPMDESSW--- 230
               M+ FI+WLL+L+ +CP +NCKL   +++D W  Y   A +++RSM     ++    
Sbjct: 174 KDTDMLSFITWLLLLSVHCPTSNCKLNEKSLYDKWKDYEIVASSMVRSMNKKITTTGKGI 233

Query: 231 -IEYEPFAHTMRSIAPHIFDPLTRVMEHLLFKDDELVD-PLSENRGEIXXXXXXXXXXXX 288
            I Y  F+HT+ +++ ++  PL  ++EH+L+K D+L++ P  +    +            
Sbjct: 234 GISYSDFSHTIVAVSKNVMSPLENIVEHMLYKQDDLLEFPCLDTF--LKETKLMTYPLVA 291

Query: 289 XXXXXXXXXXPIYHLQRLYLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSV- 347
                      +  LQ+LY+GR+ G+SMRS Q+KVF W A TI+L+ G RI+DD EYS  
Sbjct: 292 QLCTVLPNEIVMSQLQKLYVGRESGYSMRSLQSKVFNWKAATILLVSGTRIVDDIEYSEN 351

Query: 348 KNTRFRKFLHEYPKLKPSDMDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIV 407
           KN R+++FL EYPKLK  D D E+++ +  K K+  AVY+ +PW++TNK +FG   T+I+
Sbjct: 352 KNPRYKRFLEEYPKLK--DEDQEMDDCHNLKKKVTFAVYIDEPWRVTNKNYFGEKRTSII 409

Query: 408 QLSPFQEVFGSSRENALYFNTXXXXXXXXNKQPVIKSTAKSYSPGNVSLTMDSALEFAVL 467
           +LSP Q+ F S +  ++YFNT        N QPV K  +  Y+PGNVSLT+D+ LEF V 
Sbjct: 410 ELSPRQDKFNSLKVGSVYFNTIGGGIGIGNNQPVTKLNSVRYAPGNVSLTLDNTLEFGVF 469

Query: 468 RHAGQGGVLKPGLVVG-----DKDFEVKMLLQDVEVWGCGGXXXXXXXXXXXXXXXSEAK 522
           RH G GG + P  ++      +K FE++ L++DVEVWGCGG               +EAK
Sbjct: 470 RHTGYGGTIGPSELLKKNNEENKAFEIRFLIRDVEVWGCGGEKELEEQLREWKWEEAEAK 529

Query: 523 RRQQINLRSIGEDRALLEMAGLVGQ-AQSGGSV 554
           RRQ+INL+++GEDRALLEMAG++GQ  QSGGS+
Sbjct: 530 RRQEINLKTMGEDRALLEMAGIIGQHGQSGGSI 562

>NDAI0C01610 Chr3 complement(343850..345604) [1755 bp, 584 aa] {ON}
           Anc_5.431 YOR118W
          Length = 584

 Score =  405 bits (1040), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 229/592 (38%), Positives = 338/592 (57%), Gaps = 46/592 (7%)

Query: 1   MGQRTSQATL-QSSTH------FTSNSDILKSFNDRALKQFTVTELVSFKNKLGKD-LNE 52
           MGQ  S A    + TH      F +  ++ K F  R +  FT  EL+S+KNKL  D L++
Sbjct: 1   MGQHISSAEKPNTKTHNEKEIQFGNALEVQKYFQKRTIGHFTPLELISYKNKLNHDHLDD 60

Query: 53  RLTNEELTKWLSVPQDEILLRELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPER 112
            +T EE+ + L +P D ++L  +++N V  L NFP +     ++T   +L  IIL + +R
Sbjct: 61  MITKEEIIQLLHLPDDNVILSNMIFNMVHSLCNFPFLGERIWDITAGNLLTCIILLDNDR 120

Query: 113 CKKYVKSRNYDQLKLWFIALSIR----------------KTVKEDPNLXXXXXXXXXFDV 156
           C++++ S++YDQ+KL FI L +                 +   E+ +          +++
Sbjct: 121 CQRFIGSKSYDQIKLLFILLCLSTNNSSGKPLSASNSKLREKSENISTTSIYSQEIGYNL 180

Query: 157 TRILKTFDGLHVNELSVPFAYMVPFISWLLILTTYCPINNCK-LENVAMFDNWNSYIKSA 215
           T IL++++G+ +++LSVP   +    +W LI++  CP  NCK L N  ++++WN Y K++
Sbjct: 181 TDILQSYNGISIDDLSVPALSLSECFTWTLIMSIKCPTANCKILPNETIYNSWNEYQKAS 240

Query: 216 HTILRSMRPMDESSW----IEYEPFAHTMRSIAPHIFDPLTRVMEHLLFKDDELVD-PLS 270
             ILRSM     S+     I +  F +   S+ P+   PL  +M HLL+ D +L++ P+ 
Sbjct: 241 LNILRSMDSSIVSNLDDYRISFTQFENVFTSVVPNFTHPLENIMNHLLYMDKDLINHPVM 300

Query: 271 ENRGEIXXXXXXXXXXXXXXXXXXXXXXPIYHLQRLYLGRDHGFSMRSFQAKVFKWSAPT 330
           E    I                       I  LQ+LY+GR  GFSMRS Q+K FKW APT
Sbjct: 301 E----IPKSKLMSESLLAQLSTTLPKELFISKLQKLYIGRQSGFSMRSLQSKCFKWLAPT 356

Query: 331 IMLLRGKRILDDEEYSVKNTRFRKFLHEYPKLKPSDMDTEVEEMYPAKSKIILAVYVSDP 390
           I+L+ G  I +DEEY+  N RF++FL E+PKL  +D +  +E  +  K KI  AVY+ +P
Sbjct: 357 ILLVSGLIIPNDEEYN--NPRFKRFLQEFPKL--NDNEQSLEPCHSYKKKISFAVYIDEP 412

Query: 391 WKITNKEFFGGPHTTIVQLSPFQEVFGSSRENAL-YFNTXXXXXXXXNKQPVIKSTAKS- 448
           W++TNKEFFG  ++ I++LSP Q++F S + + L YFNT        +KQP + + A S 
Sbjct: 413 WRVTNKEFFGDLNSRIIELSPRQDIFKSLKSHELIYFNTIGCGIGIGDKQPHVSNGANSR 472

Query: 449 -YSPGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVG-----DKDFEVKMLLQDVEVWGCG 502
            Y PGNVSLT++S LEFAV RH G GG   P  ++      ++ FE+K ++QDVEVWGCG
Sbjct: 473 KYQPGNVSLTLESTLEFAVFRHVGHGGAFSPSELLTKRGTEEESFEIKFIIQDVEVWGCG 532

Query: 503 GXXXXXXXXXXXXXXXSEAKRRQQINLRSIGEDRALLEMAGLVGQAQSGGSV 554
           G               +EAKRRQQ+NL+SI EDRALLEM GLVGQ QSGGS+
Sbjct: 533 GEKELEEQMKQLAWEEAEAKRRQQVNLKSISEDRALLEMVGLVGQHQSGGSM 584

>KLTH0F16126g Chr6 complement(1308133..1309797) [1665 bp, 554 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 554

 Score =  403 bits (1036), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 225/548 (41%), Positives = 324/548 (59%), Gaps = 18/548 (3%)

Query: 15  HFTSNSDILKSFNDRALKQFTVTELVSFKNKL-GKDLNERLTNEELTKWLSVPQDEILLR 73
           HF S +D+L  ++ +ALK  +  ELVS+K  + GK L+  L  +EL + L +      + 
Sbjct: 17  HFESENDLLSWYDKKALKLVSTPELVSYKGNIDGKPLDAALNRKELMRVLRLQNANEAVE 76

Query: 74  ELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWFIALS 133
            LL+N VQ L NFPL+K+ YENVT +GVLK+ +L N  RC +YV+ + Y+  KL +I+L+
Sbjct: 77  GLLFNCVQTLANFPLIKDCYENVTYMGVLKSCVLLNKNRCLEYVQDKRYNHTKLVYISLA 136

Query: 134 IRKTVKEDPNLXXXXXXXXXFDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILTTYCP 193
           + K VKE  +L          D  +++ TF+ +   EL VP   M+ F++ +L ++    
Sbjct: 137 LNKAVKEMSSLPNSNDS---LDAPKVIATFNNVAEEELVVPAETMLEFLTLMLTMSKATV 193

Query: 194 INNCKLENVAMFDNWNSYIKSAHTILRSMRPMDESSW------IEYEPFAHTMRSIAPHI 247
           I N +L+ V + + W+S+   A +ILR+M     +S       I Y  F + + S+ P++
Sbjct: 194 IKNSRLD-VNISEKWDSFKTCALSILRTMNTDILTSQDALKNVISYTQFQNVISSVCPNL 252

Query: 248 FDPLTRVMEHLLFKDDELVDPLSENRGEIXXXXXXXXXXXXXXXXXXXXXXPIYHLQRLY 307
             PL  +MEH+LF + +LVD L  ++  I                          LQ+LY
Sbjct: 253 LVPLECLMEHVLFLNRDLVD-LEASKPLIPQSKLVTEPLLAQLATVWPRELVFSRLQKLY 311

Query: 308 LGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSV-KNTRFRKFLHEYPKLKPSD 366
           +GRD GFSMRSFQAK FKW AP+I+L++G RI DD++Y+  KN R++KFL EYP+LK  D
Sbjct: 312 VGRDSGFSMRSFQAKAFKWMAPSILLVQGSRIPDDQDYAKNKNQRYKKFLDEYPRLK--D 369

Query: 367 MDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENALYF 426
            D  +      K K++ A+ +++PWK+TN E FG   TTIVQLSP QEV+ +S+   +YF
Sbjct: 370 EDQHILPALSGKRKLLFAILINEPWKVTNSELFGDIKTTIVQLSPIQEVYKASKPGNVYF 429

Query: 427 NTXXXXXXXXNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVGDKD 486
           NT        + QP+IKS+   + PGNVSLT+D  LEFA  R+ G GG + P        
Sbjct: 430 NTLGGGIGIGSPQPIIKSSGVKFVPGNVSLTIDPNLEFAAFRNVGFGGSIAPS---NTPT 486

Query: 487 FEVKMLLQDVEVWGCGGXXXXXXXXXXXXXXXSEAKRRQQINLRSIGEDRALLEMAGLVG 546
            E K L+QD+E WGCGG               +EA+RRQ+INL+S+ +DRALLE+AGLVG
Sbjct: 487 SEHKFLIQDIETWGCGGEKELEEQMKNWEWEEAEAQRRQRINLKSVNDDRALLELAGLVG 546

Query: 547 QAQSGGSV 554
           Q QSGGSV
Sbjct: 547 QNQSGGSV 554

>KLLA0E21143g Chr5 complement(1888085..1889803) [1719 bp, 572 aa]
           {ON} similar to uniprot|Q12108 YOR118W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 572

 Score =  401 bits (1030), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 228/586 (38%), Positives = 335/586 (57%), Gaps = 46/586 (7%)

Query: 1   MGQRTSQATLQSSTHFTS--NSDILKSFNDRALKQFTVTELVSFKNKL--GKDLNERLTN 56
           MGQ TS+    + T+ +      ++  FNDR LKQ T  EL+SFKN +  GK+LN+ +  
Sbjct: 1   MGQSTSKEHENARTNESKLKGESLMDFFNDRCLKQLTTAELISFKNNIPEGKELNDYVEV 60

Query: 57  EELTKWLSVPQDEILLRELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKY 116
            ++++   +P+D  ++  +  N    L NFPL+++SYE VT   +LKA +L   ER  KY
Sbjct: 61  SDISRMYYIPKDSAVMLSVFMNMFHTLANFPLLQDSYEKVTFKTLLKATLLLVKERAIKY 120

Query: 117 VKSRNYDQLKLWFIALSIRKTVKEDPNLXXXXXXXXXFDVTRILKTFDGLHVNELSVPFA 176
              + Y+ LK+ FI LS+ K +K +P L          D   ++++++G   +EL V   
Sbjct: 121 TDWKKYNDLKMLFITLSLEKNIKAEP-LMDSSALSDCKDWKGVIRSYNGTDFDELKVNAN 179

Query: 177 YMVPFISWLLILTTYCPINNCKLENVAMFDNWNSYIKSAHTILRSMRP----MDES--SW 230
            ++ F++ +L L+  C +NNCK++N  +  +   +   A  I+R+M P    M +   S 
Sbjct: 180 NLLHFLALILALSRCCILNNCKIDNDVLAKSLEDFKHQALNIVRTMNPEIISMSDCLDSS 239

Query: 231 IEYEPFAHTMRSIAPHIFDPLTRVMEHLLFKDDELVD-----PLSE-----NRGEIXXXX 280
           I Y  F+  +  +AP++ +PL  +MEH+L+ D +LVD     P+S      N  E+    
Sbjct: 240 ITYTQFSMAVNDVAPNLLNPLKMLMEHVLYMDRDLVDADVLQPISNPTKIVNESELSQLA 299

Query: 281 XXXXXXXXXXXXXXXXXXPIYHLQRLYLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRIL 340
                                  Q+LY+GR+ GFSMRSFQ+KVFKW APTI+ + G RI 
Sbjct: 300 TFLPKEIV-----------FSRFQKLYVGRESGFSMRSFQSKVFKWMAPTILFVEGMRIR 348

Query: 341 DDEE-----YSVKNTRFRKFLHEYPKLKPSDMDTEVEEMYPAKSKIILAVYVSDPWKITN 395
           D+++     Y+VKN R+R FL EY KLK  D    ++ +   K K++ AV + DPWK++N
Sbjct: 349 DEDDEDGDAYAVKNPRYRNFLQEYGKLKSEDQ--HLDTLSKKKRKLLFAVCIRDPWKVSN 406

Query: 396 KEFFGGPHTTIVQLSPFQEVFGSS--RENALYFNTXXXXXXXXNKQPVIKSTAKSYSPGN 453
           K+ FG   T I+QL P QE+F +   +   +YFNT        + QP+IK+  K Y PGN
Sbjct: 407 KDLFGDSSTKIIQLHPRQEIFDADPFKTGNVYFNTVGGGIGIGSSQPIIKANGKKYFPGN 466

Query: 454 VSLTMDSALEFAVLRHAGQGGVLKPGLVVGDK-----DFEVKMLLQDVEVWGCGGXXXXX 508
           VSLT+DS+LEF + RH G GG  KPG ++  +      FE + ++QDVEVWGCGG     
Sbjct: 467 VSLTIDSSLEFGIFRHLGAGGSFKPGRLISGRGEERNSFEYRFIIQDVEVWGCGGEKELE 526

Query: 509 XXXXXXXXXXSEAKRRQQINLRSIGEDRALLEMAGLVGQAQSGGSV 554
                     +EAKRRQ+INL+S+GEDRALLEMAGLVGQ QSGGS+
Sbjct: 527 EQVKQWQWEEAEAKRRQKINLQSMGEDRALLEMAGLVGQHQSGGSI 572

>TPHA0H01790 Chr8 (412229..413926) [1698 bp, 565 aa] {ON} Anc_5.431
           YOR118W
          Length = 565

 Score =  382 bits (982), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 207/556 (37%), Positives = 316/556 (56%), Gaps = 19/556 (3%)

Query: 11  QSSTHFTSNSDILKSFNDRALKQFTVTELVSFKNKLGKDLNERLTNEELT-KWLSVPQDE 69
           +S    TS  +I+  FN R + QF+  EL+ FK+ L  D    + ++ +  K L +    
Sbjct: 17  ESIKDLTSELEIVDYFNKRVISQFSNIELLCFKHLLEIDDYSTIIDDAVVYKLLQIQDVS 76

Query: 70  ILLRELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWF 129
             LR L+ NF++ L NFP +    +NVT  G+LK I++   ++  KY  +   + LK+ F
Sbjct: 77  DRLRNLILNFIKRLTNFPFISTVADNVTAYGLLKTIVILQKQKFIKYTNNNQLNMLKILF 136

Query: 130 IALSIRKTVKEDPNLXXXXXXXXXFDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILT 189
           IAL      +++  +           ++ IL T+DG+ ++++SV  + M+ F++W+L L+
Sbjct: 137 IALGDYDREEDNKKILDCHN----ISISTILTTYDGIPIHDISVSSSNMISFLTWILALS 192

Query: 190 TYCPINNCKLENVAMFDNWNSYIKSAHTILRSMRP----MDESSWIEYEPFAHTMRSIAP 245
             CP NN  ++   MF  W  Y  SA +++RSM P     D++  I +  F   + +I P
Sbjct: 193 NVCPTNNSIVDTKHMFKYWEKYETSAISLVRSMNPDIIKPDDNQNILFIQFKTALETIMP 252

Query: 246 HIFDPLTRVMEHLLFKDDELVDPLSENRGEIXXXXXXXXXXXXXXXXXXXXXXPIYHLQR 305
           H++ PL  ++ HLLF +  L+    E                            I  L +
Sbjct: 253 HVYLPLEHLLNHLLFMESSLIKS-QEIEISFQESKLMTFAVASQLSTLLRNDVVISKLHK 311

Query: 306 LYLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSVK-NTRFRKFLHEYPKLKP 364
           LY GR+ GFSMRSFQ+K FKW+APTI+L+ G R+ DD EY+ K N R++KF+ +YP+L+ 
Sbjct: 312 LYSGRESGFSMRSFQSKAFKWNAPTILLISGMRVTDDVEYATKKNPRYKKFIDQYPRLR- 370

Query: 365 SDMDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENAL 424
            D+D  +E  +    K+  AVYV +PWK++NK  FGG  T IV+LSP Q+ F +++   +
Sbjct: 371 -DLDQNLEPCHSKLRKVTFAVYVDEPWKVSNKLQFGGLKTLIVELSPRQDCFRAAKPGVI 429

Query: 425 YFNTXXXXXXXXNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVGD 484
           YFNT        + QPV K  + SY+PGNVSLT+D++LEF   RH G GG ++P  ++  
Sbjct: 430 YFNTVGGGIGIGSSQPVQKKNSLSYTPGNVSLTIDNSLEFGAFRHTGYGGSIEPSSILQK 489

Query: 485 KD-----FEVKMLLQDVEVWGCGGXXXXXXXXXXXXXXXSEAKRRQQINLRSIGEDRALL 539
           K+     FE++ L+QD+EVWGCGG                EAK+RQ++NL+S+GEDRALL
Sbjct: 490 KEDATRTFEIRFLIQDIEVWGCGGEKEIDEQLKQWAWEEEEAKKRQRVNLKSMGEDRALL 549

Query: 540 EMAGLVG-QAQSGGSV 554
           EMAG++G  A SGGS+
Sbjct: 550 EMAGIIGNHAHSGGSL 565

>KNAG0B04230 Chr2 complement(803845..805578) [1734 bp, 577 aa] {ON}
           Anc_5.431 YOR118W
          Length = 577

 Score =  378 bits (971), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 204/557 (36%), Positives = 318/557 (57%), Gaps = 23/557 (4%)

Query: 18  SNSDILKSFNDRALKQFTVTELVSFKNKLG--KDLNERLTNEELTKWLSVPQDEILLR-- 73
           +  +I + +NDR L+QF  +EL +FK ++G  + LN+ +  +EL +WL +P +  L +  
Sbjct: 24  TTEEIEQEYNDRVLRQFNASELYTFKCRVGMTRQLNDVVLEQELLEWLCLPLEGHLQQPS 83

Query: 74  ELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWFIALS 133
           +LL   ++VLG FP + N+  N+T + +LKA+IL N  +C KY+ +++Y+ L+L F+AL 
Sbjct: 84  KLLVGVIKVLGQFPFISNTGGNLTAVSLLKAVILINRGKCLKYIGNKSYNHLELIFMALY 143

Query: 134 IRKTVKEDPNLXXXXXXXXXFDVTRILKTFDGLH--VNELSVPFAYMVPFISWLLILTTY 191
           + +    D             ++ +++ ++DG    V+E++V    ++ F + LL+L+  
Sbjct: 144 LAQD-SHDSTKKESYDPKEPHNIEKVISSYDGNSDCVSEITVQADNLLQFTTMLLLLSAR 202

Query: 192 CPINNCKLENVAMFDNWNSYIKSAHTILRSMRPMDESSW----IEYEPFAHTMRSIAPHI 247
            P  N +++     ++W  Y KSA+ ++R+M     SS     I +  F   +  + P I
Sbjct: 203 IPRPNSQIDLKTADNDWAKYEKSAYNVIRTMNSSIISSCQTHTISFHQFYDVISILLPTI 262

Query: 248 FDPLTRVMEHLLFKDDELVDPLSENRGEIXXXXXXXXXXXXXXXXXXXXXXPIYHLQRLY 307
              L  +++HLL+  D+LVD  +                            PI  LQ+LY
Sbjct: 263 LTTLDNLLQHLLYTPDQLVDHTALGPTFTETKVMNHGSFALLQFALADKGYPISKLQKLY 322

Query: 308 LGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEYSV-KNTRFRKFLHEYPKLKPSD 366
           +GRD GFSMRSFQ KVF W APT++ + G RI DD++YS  KN R+ KFL ++ KL+  D
Sbjct: 323 VGRDSGFSMRSFQGKVFHWHAPTLLFVSGSRIQDDDDYSKNKNPRYSKFLEDFRKLR--D 380

Query: 367 MDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENALYF 426
            D ++      K K++  +Y+  PW++TNK++F    TTI QLSP  ++F ++R++ +YF
Sbjct: 381 TDQQLSPCLLKKRKVMFVIYIESPWRVTNKDYFSAGRTTIFQLSPELDIFKANRDDVVYF 440

Query: 427 NTXXXXXXXXNKQPVIKSTAKSYSPGNVSLTMDSALEFAVLRHAGQGGVLKPGL------ 480
           NT        + QP  K   + Y PGN+SLT+DS+LEF   R+ G GG+ +PG       
Sbjct: 441 NTMGGGIGIGDTQPYTKVNYREYRPGNISLTLDSSLEFGAFRNVGPGGMFEPGALFTRRN 500

Query: 481 ---VVGDKDFEVKMLLQDVEVWGCGGXXXXXXXXXXXXXXXSEAKRRQQINLRSIGEDRA 537
              VV    +E++ L+QDVEVWGCGG               +EAKRRQ +NL+S+ EDRA
Sbjct: 501 GDGVVTSNSYELRFLIQDVEVWGCGGEKELSEQMKQLQWEETEAKRRQHVNLKSLSEDRA 560

Query: 538 LLEMAGLVGQAQSGGSV 554
           LLEMAGLVGQ QSGGS+
Sbjct: 561 LLEMAGLVGQHQSGGSI 577

>Ecym_4764 Chr4 complement(1484832..1486532) [1701 bp, 566 aa] {ON}
           similar to Ashbya gossypii AER258C
          Length = 566

 Score =  353 bits (907), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/574 (35%), Positives = 319/574 (55%), Gaps = 28/574 (4%)

Query: 1   MGQRTSQATLQSSTH---FTSNSDILKSFNDRALKQFTVTELVSFKNKLG--KDLNERLT 55
           MGQ  S  + +S      F    +IL+ F+++A++Q    ELV+F+N +G   DL + L+
Sbjct: 1   MGQNASSRSAESVEGRLIFRDEKEILEFFDNQAVRQLHGLELVAFQNNIGLDADLKDYLS 60

Query: 56  NEELTKWLSVPQDEILLRELLYNFVQVLGNFPLMKN-SYENV-TGIGVLKAIILTNPERC 113
            E L +   +P+ +    ++ Y  +     FPLM   + E+V T +G++KA +L + ++ 
Sbjct: 61  CEFLVQLCKLPRHKYGFVKVFYQMIGNASKFPLMGGGAGEDVPTFVGLVKACLLFDYKKL 120

Query: 114 KKYVKSRNYDQLKLWFIALSIRKTVKEDPNLXXXXXXXXXFDVTRILKTFDGLHVNELSV 173
            KY + + YDQ+ L FI L++    K              +D  +I+++F+ +++  + V
Sbjct: 121 LKYAQCKTYDQVSLIFILLALEPHAKVSKK--ELGRPPSSYDARKIMESFNDINLETIEV 178

Query: 174 PFAYMVPFISWLLILTTYCPINNCKLENVAMFDNWNSYIKSAHTILRSMRPMDES----- 228
               ++ F+++LL++T YC   N ++ N ++++NW  Y   A  ILR+M P   S     
Sbjct: 179 SADDLLQFMTFLLVITKYCIFENVEV-NPSIYENWKDYESQALNILRTMNPCIVSYSDAA 237

Query: 229 -SWIEYEPFAHTMRSIAPHIFDPLTRVMEHLLFKDDELVDPLSENRGEIXXXXXXXXXXX 287
            + +    F   + ++ P++  PL   M+H+L+K + LV   S++   I           
Sbjct: 238 KNVVTLAQFKDCITAVCPNLLTPLGVFMKHVLYKSEHLV---SDSGATINDRSSTVMTDP 294

Query: 288 XXXXXXXXXXXPIYH--LQRLYLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEEY 345
                       I +  L++L++ +  GFS+RSFQAKV  W AP+I+L+ G +I+DD + 
Sbjct: 295 LLAQLCTLWPKHIIYQNLKKLFIAKQSGFSIRSFQAKVVNWMAPSILLVSGMKIMDDSKL 354

Query: 346 SVKNTRFRKFLHEYPKLKPSDMDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHTT 405
             KN R++ FL EYPKLK  D D + + +   K K+  AV+V + WK+TNKE FG   T 
Sbjct: 355 LAKNQRYKSFLQEYPKLK--DEDQKADSIVGGKRKVTFAVFVHEAWKVTNKEQFGNLKTL 412

Query: 406 IVQLSPFQEVFGSSRENALYFNTXXXXXXXXNKQPVIKSTAKSYSPGNVSLTMDSALEFA 465
           I+QLSP QEVF +S+   +YFNT        N QPVIKS+ K Y PGNVSLT+D + EF 
Sbjct: 413 ILQLSPRQEVFQASKNGNIYFNTVGGGIGIGNSQPVIKSSGKKYFPGNVSLTIDPSFEFG 472

Query: 466 VLRHAGQGGVLKPGLVVGDK-----DFEVKMLLQDVEVWGCGGXXXXXXXXXXXXXXXSE 520
           V R+ G GG + PG +  ++       E + ++QDVEVWGCGG               +E
Sbjct: 473 VFRNVGHGGSISPGKLFLERPDVEQSLECRFIIQDVEVWGCGGDKEFEAQLKQWEWEEAE 532

Query: 521 AKRRQQINLRSIGEDRALLEMAGLVGQAQSGGSV 554
           ++RRQ INL SIGED+ALLEM GLVG  QSGGS+
Sbjct: 533 SERRQYINLSSIGEDKALLEMVGLVGHHQSGGSL 566

>CAGL0L11616g Chr12 complement(1240790..1242457) [1668 bp, 555 aa]
           {ON} similar to uniprot|Q12108 Saccharomyces cerevisiae
           YOR118w
          Length = 555

 Score =  353 bits (906), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 213/585 (36%), Positives = 317/585 (54%), Gaps = 61/585 (10%)

Query: 1   MGQRTS--QATLQSSTH--FTSNSDILKSFNDRALKQFTVTELVSFKNKLGK-DLNERLT 55
           MGQ  S  Q   +S +H  F +  +IL+ FN R +K FTVTE+ +FK +    DLNE   
Sbjct: 1   MGQTASSPQDNKESKSHPQFKTRDEILQYFNTRVVKLFTVTEIAAFKKRFNAIDLNE--- 57

Query: 56  NEELTKWLSVPQDEILLRELLY------------NFVQVLGNFPLMKNSY-ENVTGIGVL 102
                     P D+ L++E LY              +++L NFPL      +++TG G+L
Sbjct: 58  ----------PIDDTLIKEALYLDAQPNVWSAVSETIRLLQNFPLFHQPIADSITGFGLL 107

Query: 103 KAIILTNPERCKKYVKSR--NYDQLKLWFIALSIRKTVKEDPNLXXXXXXXXXFDVTRIL 160
           K I + N +R +K V +    YD      + L +    KE  N           ++  IL
Sbjct: 108 KVIAIINVKRFEKLVNTTITRYDIT----VTLGLCGQAKESEN------KIKSTNLGDIL 157

Query: 161 KTFDGLHVNELSVPFAYMVPFISWLLILTTYCPINNCKLENVAMFDNWNSYIKSAHTILR 220
           KT+D + +  + +P+  ++  ++WLL L T     NCK+E      NWN++  SA +I  
Sbjct: 158 KTYDHIEIESIHIPYDKLILLVAWLLTLVTGVATTNCKVELSDTIANWNNFKSSAISIAN 217

Query: 221 --SMRPMDESSWIE------YEPFAHTMRSIAPHIFDPLTRVMEHLLFKDDELVDPLSEN 272
             S   +  ++ I          F   M S+ P+    ++ + EHLLF  D+L+D +++ 
Sbjct: 218 TISTSALGNANDIGIPATDILNAFNTIMISLVPY----MSNLFEHLLFGVDDLIDHVND- 272

Query: 273 RGEIXXXXXXXXXXXXXXXXXXXXXXPIYHLQRLYLGRDHGFSMRSFQAKVFKWSAPTIM 332
              +                       I  LQ+LY+G++ GFSMRS Q+KVF+W APT+M
Sbjct: 273 LANLSHQDVLTPSLYAQVIIGLPNSITITKLQKLYVGKESGFSMRSLQSKVFRWKAPTLM 332

Query: 333 LLRGKRILDDEEYS-VKNTRFRKFLHEYPKLKPSDMDTEVEEMYPAKSKIILAVYVSDPW 391
           ++ G RI DDE Y+  KN R+R FL+ +PKL+ +D +  ++ ++  K K+  AVY+ +PW
Sbjct: 333 IVSGTRISDDESYADSKNPRYRSFLYSFPKLRENDQN--LDAIHLTKKKVTYAVYIDEPW 390

Query: 392 KITNKEFFGGPHTTIVQLSPFQEVFGSSRENALYFNTXXXXXXXXNKQPVIKSTAKSYSP 451
           K++NKE FG  + TI++L+P Q+ + S  E  +YFNT        ++QP++K     + P
Sbjct: 391 KVSNKEKFGATNMTIMELTPQQKTYQSCMERTMYFNTIGGGIGVGSEQPIVKQNDIKFIP 450

Query: 452 GNVSLTMDSALEFAVLRHAGQGGVLKPGLVVGD--KDFEVKMLLQDVEVWGCGGXXXXXX 509
           GN+SLTMDS+LEF V RH G GG  K  L+  D  K FE++ ++Q+VEVWGCGG      
Sbjct: 451 GNISLTMDSSLEFGVFRHVGAGGGFKTSLLDNDDSKSFEIRFIIQNVEVWGCGGEKELAE 510

Query: 510 XXXXXXXXXSEAKRRQQINLRSIGEDRALLEMAGLVGQAQSGGSV 554
                    +EAKRRQ INL+S+ ED+ALLEM GLVGQ QSGGSV
Sbjct: 511 QLKQLEWEEAEAKRRQTINLQSLSEDKALLEMVGLVGQHQSGGSV 555

>AER258C Chr5 complement(1111936..1113609) [1674 bp, 557 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR118W
          Length = 557

 Score =  306 bits (783), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 198/575 (34%), Positives = 282/575 (49%), Gaps = 39/575 (6%)

Query: 1   MGQRTSQATLQSSTH---FTSNSDILKSFNDRALKQFTVTELVSFKNKLGKDL--NERLT 55
           MGQR S    +++T    FT    ++  FN RAL+Q +  E  +F   +GK++   E L 
Sbjct: 1   MGQRASSHVTETTTSRWTFTDRDALIAFFNARALRQLSAVEQWAFHQNIGKNIEPTEELD 60

Query: 56  NEELTKWLSVPQDEILLRELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKK 115
            + L     VP D     E+ Y FV  L +FPLM N     T +G+LK  +L N +R  +
Sbjct: 61  LQALATLYGVPADVPWFTEVFYTFVCRLTSFPLM-NDCSPPTYMGLLKVCLLFNKKRAAR 119

Query: 116 YVKSRNYDQLKLWFIALSIRKTVKEDPNLXXXXXXXXXFDVTRILKTFDGLHVNELSVPF 175
           Y   ++YD   L    L+        P           FD  +++ T DG  + EL V  
Sbjct: 120 YTARKSYDVASLVLALLA--------PPRDACDENVDQFDGDKLIDTLDGTFIAELEVRP 171

Query: 176 AYMVPFISWLLILTTYCPINNCKLENVAMFDNWNSYIKSAHTILRSM------RPMDESS 229
             +V +  ++  ++  C  +N  L   +MF  WN   +    +LRS+      R    S 
Sbjct: 172 NKLVRYSPFIAQISQVCNGSNEPLSR-SMFPAWNRNNQIPLALLRSLDSTIVSRSDARSR 230

Query: 230 WIEYEPFAHTMRSIAPHIFDPLTRVMEHLLF-KDDE----LVDPLSENRGEIXXXXXXXX 284
            I Y+ FA  +RS+ P++FD L   +E L + K D     L  P  E    +        
Sbjct: 231 SITYQQFAGGLRSVFPNVFDALGLFLERLFYVKRDTTNKLLYTPTKETSTIVTNLLLTQL 290

Query: 285 XXXXXXXXXXXXXXPIYHLQRLYLGRDHGFSMRSFQAKVFKWSAPTIMLLRGKRILDDEE 344
                             +QRL++  D GFSM  FQAKVFKW APTI+ + G RI DDE 
Sbjct: 291 STLYPRINL------FTSMQRLFVAGDAGFSMSVFQAKVFKWMAPTILFVSGTRIQDDEI 344

Query: 345 YSVKNTRFRKFLHEYPKLKPSDMDTEVEEMYPAKSKIILAVYVSDPWKITNKEFFGGPHT 404
              KN R++ FL +YP LK  D + ++      K  +I A++V DPWKITNK+ FG   T
Sbjct: 345 VCTKNKRYKAFLQDYPALK--DAEQQLALCDRKKRNLIYAIFVRDPWKITNKDLFGDMDT 402

Query: 405 TIVQLSPFQEVFGSSRENALYFNTXXXXXXXXNKQPVIKSTAKSYSPGNVSLTMDSALEF 464
           TI+QL+P Q++F +     +YFN         + QP +K   K Y PGNVS T+D ++EF
Sbjct: 403 TIIQLAPRQKIFKAQEAPNIYFNAVGGGIGFGSSQPSVKPAGKRYFPGNVSFTVDPSMEF 462

Query: 465 AVLRHAGQGGVLKPGLVVGDK-----DFEVKMLLQDVEVWGCGGXXXXXXXXXXXXXXXS 519
           AV R+ G GG+   G  V         +E +++++D+EVWG GG               +
Sbjct: 463 AVFRNVGDGGMFSHGSAVPAPAEQPLSYEHRLMIKDLEVWGYGGEEELQKQIQRWQWEEA 522

Query: 520 EAKRRQQINLRSIGEDRALLEMAGLVGQAQSGGSV 554
           EA +R+ I      EDRALLEMAG+VG  QSGGSV
Sbjct: 523 EATKRKYIKTNGGNEDRALLEMAGIVGHYQSGGSV 557

>TBLA0A06530 Chr1 complement(1600111..1601589) [1479 bp, 492 aa]
           {ON} Anc_5.431 YOR118W
          Length = 492

 Score =  277 bits (709), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 177/518 (34%), Positives = 277/518 (53%), Gaps = 57/518 (11%)

Query: 34  FTVTELVSFKNKLGKDLNERLTNEELTKWLSVPQDEILLRELLYNFVQVLGNFPLMKNSY 93
           FTV+EL++F+ ++ + L++ ++++E+ K+  +P  +  L+ L   F++ L  +P   N  
Sbjct: 25  FTVSELITFQKRINRSLDDIISDKEIIKFSYIPDSKPHLQHLYLRFIRNLNKYPSNDNI- 83

Query: 94  ENVTGIGVLKAIILTNPERCKKYVKSRNYDQLKLWFIALSIRKTVKEDPNLXXXXXXXXX 153
             +TG   LK I L N +R  K      +  +K+ F+ LS  +   + P           
Sbjct: 84  --ITGYSYLKIITLLNKKRRNKMFPKIEW--IKIIFMCLSDEEV--QFP----------- 126

Query: 154 FDVTRILKTFDGLHVNELSVPFAYMVPFISWLLILTTYCPINNCKLENVAMFDN--WNSY 211
                  +T   +HV E       ++ FIS LL L   C  + C +     F++  W++Y
Sbjct: 127 -----CWETTHDIHVLEND-----LIEFISLLLTLNMNCCTDYCLINQDLTFNDHDWDTY 176

Query: 212 I-KSAHTILRSMRPMDESSWIEYEPFAHTMRSIAPHIFDPLTRVMEHLLFKDDELVD-PL 269
             KSA  I+R M+  +       E F + +  I P+IFD L  ++EH L+  D+L + PL
Sbjct: 177 WRKSASCIVRDMKECN------VEEFENVLL-IVPNIFDCLKNLIEHSLYTKDQLKECPL 229

Query: 270 SENRGEIXXXXXXXXXXXXXXXXXXXXXXPIYHLQRLYLGRDHGFSMRSFQAKVFKWSAP 329
             ++                             + +LY+GR++G+SMRSFQ+KVFKW AP
Sbjct: 230 GPSQ-----FTKTKMNQAILCQILLSMRKRSMDISKLYIGRENGYSMRSFQSKVFKWKAP 284

Query: 330 TIMLLRGKRILDDEEYSVKNTRFRKFLHEYPKLKPSDMDTEVEEMYPAKSKIILAVYVSD 389
           TI+L+ GK+I++D+EYS KN R++ FL+ YP+LK      +    Y        A+Y+ +
Sbjct: 285 TILLITGKKIINDQEYSEKNNRYKSFLNSYPRLKDGKTTFQTPLHY------TFAIYIEE 338

Query: 390 PWKITNKEFFGGPHTTIVQLSPFQEVFGSSRENALYFNTXXXXXXXXNKQPVIKSTAKSY 449
           PWK+T K +FGG HT I+QLSP Q+VF  +  NA+YF+T               S+   Y
Sbjct: 339 PWKMT-KGYFGGLHTKIIQLSPRQDVFTCTDPNAVYFHTQNGIGIGNEHM----SSDNKY 393

Query: 450 SPGNVSLTMDSALEFAVLRHAGQGGVLKPGLVVGDKDFEVKMLLQDVEVWGCGGXXXXXX 509
            PGNVS+T+DS LEFAV RH+G  GV K G++   + FE+++ +Q VEVWGCGG      
Sbjct: 394 KPGNVSITIDSTLEFAVFRHSGP-GVFKTGIIANQEIFEIRLHIQSVEVWGCGGAKELAE 452

Query: 510 XXXXXXXXXSEAKRRQQINLRSIGEDRALLEMAGLVGQ 547
                     EA+RRQ +++  + EDRALLE+AG++G+
Sbjct: 453 QKHEWEWEEREAQRRQHVSMH-VTEDRALLELAGIIGE 489

>Kwal_33.13439 s33 complement(224508..228116) [3609 bp, 1202 aa]
           {ON} YGL140C - Hypothetical ORF [contig 117] FULL
          Length = 1202

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 52/143 (36%), Gaps = 29/143 (20%)

Query: 14  THFTSNSDILKSFNDRALKQFTVTELVSFKNKLGKDLNERLTNEELTKWLSVPQDEILLR 73
           T FTS  +ILK F+   +    V  LV F      DL  R     L + L  P DE+ L 
Sbjct: 397 TKFTSRKEILKDFDFEGIISDLVNGLVEF------DLKAREELIHLDENLLQPNDEMFL- 449

Query: 74  ELLYNFVQVLGNFPLMKNSYENVTGIGVLKAIILTNPERCKKYVKSR------------N 121
                F   L NF    NS      I V++        R  K  K R            N
Sbjct: 450 -----FSSFLMNFKETTNSV-----IMVMRETHKIYENRKIKEAKGRLRGKTLWVHFLSN 499

Query: 122 YDQLKLWFIALSIRKTVKEDPNL 144
           YD  K W +  +  K + E  +L
Sbjct: 500 YDTFKKWLLGSTSSKNITESQSL 522

>NCAS0A10450 Chr1 (2075423..2076802) [1380 bp, 459 aa] {ON}
          Anc_3.251
          Length = 459

 Score = 31.6 bits (70), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 31/67 (46%), Gaps = 2/67 (2%)

Query: 4  RTSQATLQSSTHFTSNSDILKSFNDRALKQFTVTELVSFKNKLGKDLNERLTNEELTKWL 63
          R SQ    +S       DI+  + D    +F + EL    NKL KD+  +  N+E  K L
Sbjct: 19 RQSQKARYASVELVD--DIIADYKDWVKTRFELDELNKKLNKLQKDIGLKFKNKEDPKEL 76

Query: 64 SVPQDEI 70
             +DEI
Sbjct: 77 LAEKDEI 83

>Kwal_56.24695 s56 (1108048..1109304) [1257 bp, 418 aa] {ON} YGR244C
           (LSC2) - Succinate-CoA Ligase (ADP-Forming) [contig 161]
           FULL
          Length = 418

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 3/59 (5%)

Query: 37  TELVSFKNKLGKDLNERLTNEELTKWLSVPQ---DEILLRELLYNFVQVLGNFPLMKNS 92
           T+++    K G D N     EE+  W  + Q   DE++ ++   NFV++ GN   + N 
Sbjct: 239 TKVMCMDAKFGFDDNAAFRQEEIYSWRDLSQEDADEVVAKKSDLNFVKLQGNIGCLVNG 297

>TDEL0G01060 Chr7 (218816..220090) [1275 bp, 424 aa] {ON} Anc_5.82
           YGR244C
          Length = 424

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 3/58 (5%)

Query: 38  ELVSFKNKLGKDLNERLTNEELTKWLSVPQ---DEILLRELLYNFVQVLGNFPLMKNS 92
           +++    K G D N     E + KW  + Q   DE++ +E   NFV++ GN   + N 
Sbjct: 240 KVMCMDAKFGFDSNASFKQEGIWKWRDLSQEDPDEVVAQEYNLNFVKLQGNIGCLVNG 297

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,271,373
Number of extensions: 2198615
Number of successful extensions: 5894
Number of sequences better than 10.0: 26
Number of HSP's gapped: 5955
Number of HSP's successfully gapped: 31
Length of query: 554
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 439
Effective length of database: 40,294,809
Effective search space: 17689421151
Effective search space used: 17689421151
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)