Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F09944g5.430ON61159722110.0
KAFR0E039105.430ON62562013790.0
TDEL0E019505.430ON61761313730.0
NDAI0B056405.430ON66964313750.0
CAGL0L11638g5.430ON60860913580.0
NCAS0F033505.430ON63963113580.0
Smik_4.6325.430ON62762913411e-178
SAKL0G02442g5.430ON62358213321e-177
Suva_2.5385.430ON62962413211e-175
YDR365C (ESF1)5.430ON62861513111e-174
Kpol_1016.85.430ON63759413111e-174
KNAG0C049405.430ON64263412841e-169
KLLA0E21165g5.430ON62760512761e-168
TPHA0H017805.430ON62262112651e-167
KLTH0F16148g5.430ON64660112571e-165
TBLA0A065405.430ON65964012461e-163
Ecym_47905.430ON63058812381e-163
Skud_4.6355.430ON62961112341e-162
Kwal_55.214445.430ON64460512261e-161
AER259W5.430ON61941510211e-130
Skud_7.4674.77ON70863707.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F09944g
         (611 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {...   856   0.0  
KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {O...   535   0.0  
TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.4...   533   0.0  
NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa] ...   534   0.0  
CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON} sim...   527   0.0  
NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {O...   527   0.0  
Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {...   521   e-178
SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {...   517   e-177
Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON...   513   e-175
YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}...   509   e-174
Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON} (16620.....   509   e-174
KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.4...   499   e-169
KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} simi...   496   e-168
TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {O...   491   e-167
KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} simi...   488   e-165
TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON} Anc_5...   484   e-163
Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {O...   481   e-163
Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {...   479   e-162
Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365...   476   e-161
AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic ...   397   e-130
Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W ...    32   7.4  

>ZYRO0F09944g Chr6 complement(807207..809042) [1836 bp, 611 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 611

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 444/597 (74%), Positives = 444/597 (74%)

Query: 1   MVEDRGSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI 60
           MVEDRGSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI
Sbjct: 1   MVEDRGSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI 60

Query: 61  TGESKDLKDFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXVVDRARGELPEAYTXXXXXX 120
           TGESKDLKDFDKYF                          VVDRARGELPEAYT      
Sbjct: 61  TGESKDLKDFDKYFEKEGKEGKEDESSSSSEDEEEETESKVVDRARGELPEAYTSSESED 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXKPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGK 180
                                KPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGK
Sbjct: 121 SESDLSEEESEADVAEAVEEAKPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGK 180

Query: 181 IEKICIYPSEFGKERMQREEKEGPPREIFNXXXXXXXXXXXXXVDIRDLYEEGDADKEVD 240
           IEKICIYPSEFGKERMQREEKEGPPREIFN             VDIRDLYEEGDADKEVD
Sbjct: 181 IEKICIYPSEFGKERMQREEKEGPPREIFNKKKKHHDEDSDSDVDIRDLYEEGDADKEVD 240

Query: 241 NXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEFDDE 300
           N                IVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEFDDE
Sbjct: 241 NAALRQYQLERLRYYYAIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEFDDE 300

Query: 301 PKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQAYL 360
           PKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQAYL
Sbjct: 301 PKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQAYL 360

Query: 361 ASGTDESDGXXXXXXXXXXXLKSLVGQSLAYGKQQEEEPDMEITFTPGLDDSKPQADEDH 420
           ASGTDESDG           LKSLVGQSLAYGKQQEEEPDMEITFTPGLDDSKPQADEDH
Sbjct: 361 ASGTDESDGEENNNEEAKNKLKSLVGQSLAYGKQQEEEPDMEITFTPGLDDSKPQADEDH 420

Query: 421 EETTIEKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGKNKKQVEDESDAKSKAXXX 480
           EETTIEKV                               SGKNKKQVEDESDAKSKA   
Sbjct: 421 EETTIEKVKRKEQERRKARKQRLKELKQQAEQEKKEKLRSGKNKKQVEDESDAKSKAELE 480

Query: 481 XXXXXXXXXTEKSLNKKAHFNMNEILXXXXXXXXXXXXXXXXXIMEDEFKPDLNDPRFNE 540
                    TEKSLNKKAHFNMNEIL                 IMEDEFKPDLNDPRFNE
Sbjct: 481 LLMMEDEDDTEKSLNKKAHFNMNEILKSEKEKKKKGKYQDKGKIMEDEFKPDLNDPRFNE 540

Query: 541 VFENQDFAIDPSQPEYKSTKAMKEILEERSKRAHKKRKPLADDGDSKDNKHDISNIV 597
           VFENQDFAIDPSQPEYKSTKAMKEILEERSKRAHKKRKPLADDGDSKDNKHDISNIV
Sbjct: 541 VFENQDFAIDPSQPEYKSTKAMKEILEERSKRAHKKRKPLADDGDSKDNKHDISNIV 597

>KAFR0E03910 Chr5 complement(773170..775047) [1878 bp, 625 aa] {ON}
           Anc_5.430 YDR365C
          Length = 625

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/620 (50%), Positives = 376/620 (60%), Gaps = 41/620 (6%)

Query: 6   GSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRIT--GE 63
           G K S DPRF+ I NDPKF+N K K LK++LD RFSK+DL++R KAKVDKYGR+    G 
Sbjct: 4   GGKKSDDPRFSRIYNDPKFKNAKTKHLKIRLDSRFSKRDLEIRNKAKVDKYGRKTKDEGS 63

Query: 64  SKDLKDFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXVVDRARGELPEAYTXXX-----X 118
            K+L DF+KYF                           VDRARGE+P  Y          
Sbjct: 64  KKELDDFEKYFEKEDEEEKKDTEETEEKPK--------VDRARGEVPSDYVSSSDEYTSS 115

Query: 119 XXXXXXXXXXXXXXXXXXXXXXXKPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSG 178
                                  KPE+GD SKTLAVVNLDWDHV++ADLM+TFSSF+P G
Sbjct: 116 ESEDSEEEELDSDVESEVEIENTKPETGDASKTLAVVNLDWDHVKSADLMVTFSSFVPKG 175

Query: 179 GKIEKICIYPSEFGKERMQREEKEGPPREIFNXXXXXXXXXXX-----XXVDIRDLYEEG 233
           GKI +ICIYPSEFGKER+QREE EGPP+E+F                   VDI+DLYEEG
Sbjct: 176 GKISRICIYPSEFGKERLQREEVEGPPKELFQKKNKKKASHKEDFDSDSDVDIKDLYEEG 235

Query: 234 DADKEVDNXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPE 293
           DA+K+VD+                +VYCNN++T  +IY NCDGTEYESTAN+FDLRYVP+
Sbjct: 236 DAEKDVDSKALRQYQLERLRYYYAVVYCNNIDTARAIYENCDGTEYESTANMFDLRYVPD 295

Query: 294 GMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELED 353
           GM FDDEP+DEC  LPKNYKP++FSTDALQHSNVKLTWDETP DR+EV+KRAFSQKE+ED
Sbjct: 296 GMTFDDEPRDECNSLPKNYKPMQFSTDALQHSNVKLTWDETPADRVEVAKRAFSQKEIED 355

Query: 354 MDFQAYLASGTDESDGXXXXXXXXXXXLKSLVGQSLAYGKQ----QEEEPDMEITFTPGL 409
           MDF+AYLAS +DES             LK+LVG+SL +G       E E DMEITFTPGL
Sbjct: 356 MDFKAYLASDSDES--EEEVNENSKNKLKALVGESLDFGTNGASDGESEVDMEITFTPGL 413

Query: 410 DDSKPQADEDHEETTIEKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGKNKK---- 465
            D   +++E+ EE+TIEKV                               S  +KK    
Sbjct: 414 -DEAKESEEEKEESTIEKVRRKEKERRKARKDKLKQLKKDAENEKKEKMRSLHDKKSRKA 472

Query: 466 QVEDESDAKSKAXXXXXXXXXXXXTEKSLNKKAHFNMNEILXXXXXXXXXXXXXXXXXIM 525
           + E+E  AK+KA            TE+SLNKKAHFN+NEI+                 I+
Sbjct: 473 ETENEEAAKAKAELELLMIEDEDDTEQSLNKKAHFNLNEIIRSEKEKGKKGKYQRKEKIV 532

Query: 526 EDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRA--------HKKR 577
           ED+FKPDL+DPRF EVFE+ DFAIDPSQPE+K T AMK+IL ERSKR+        +KKR
Sbjct: 533 EDDFKPDLSDPRFKEVFEDHDFAIDPSQPEFKQTNAMKQILNERSKRSKERSKGGKNKKR 592

Query: 578 KPLADDGDSKDNKHDISNIV 597
           K   D   SK+ K+ ISNIV
Sbjct: 593 K--LDTSTSKNGKNAISNIV 610

>TDEL0E01950 Chr5 (367743..369596) [1854 bp, 617 aa] {ON} Anc_5.430
           YDR365C
          Length = 617

 Score =  533 bits (1373), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/613 (50%), Positives = 367/613 (59%), Gaps = 36/613 (5%)

Query: 8   KGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI--TGESK 65
           K S DPRF+ I +DPKF N K KG KVKLDDRFSKKDL+++RK KVDKYGRR+    +SK
Sbjct: 4   KRSKDPRFSKIYDDPKFNNVKTKGFKVKLDDRFSKKDLEIKRKTKVDKYGRRMRDVEDSK 63

Query: 66  DLKDFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXVVDRARGELPEAYTXXX----XXXX 121
           + KDFDKYF                           VDRARGE+P  Y            
Sbjct: 64  ESKDFDKYFEQSDEEKKKDKDTEIL----------TVDRARGEVPSDYVSSSDEFTSSDS 113

Query: 122 XXXXXXXXXXXXXXXXXXXXKPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGKI 181
                               +P SGD SKTLAVVNLDWD+VR++DLMITFSSFLP+GG+I
Sbjct: 114 EVSDNEVESESESEVELEKTEPSSGDSSKTLAVVNLDWDNVRSSDLMITFSSFLPAGGRI 173

Query: 182 EKICIYPSEFGKERMQREEKEGPPREIFNXXXXX----XXXXXXXXVDIRDLYEEGDADK 237
           EKI IYPSEFGKERMQREE EGPP+E+F                  +D++DLYEEGDADK
Sbjct: 174 EKIAIYPSEFGKERMQREEVEGPPKELFQKKKKKSKKGQQEDSDSDIDVKDLYEEGDADK 233

Query: 238 EVDNXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEF 297
            VDN                +VYCNNV   ESIY+NCDGTEYESTANIFD+RYVP+GM+F
Sbjct: 234 NVDNKALRQYQLDRLRYYYAVVYCNNVAAAESIYNNCDGTEYESTANIFDIRYVPDGMDF 293

Query: 298 DDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQ 357
           D +PKD C ELPKNYKPL+FSTDALQHSNVKLTWDETP DRL+V+KRAF+QKE+EDMDF+
Sbjct: 294 DGKPKDSCTELPKNYKPLQFSTDALQHSNVKLTWDETPADRLDVAKRAFTQKEIEDMDFK 353

Query: 358 AYLASGTDESDGXXXXXXXXXXXLKSLVGQSLAYGKQQ---------EEEPDMEITFTPG 408
           AYLAS +D+S             LKSLV  S A+   +         +EE DMEITFTPG
Sbjct: 354 AYLASDSDDS--EDEVDAQSKSKLKSLVTGSSAFDFTRKNADEVDGNDEEVDMEITFTPG 411

Query: 409 LDDSKPQADEDH-EETTIEKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGKNKKQV 467
           LD++     E   EE+TI+KV                                G+ K+  
Sbjct: 412 LDEANKDGQEGQEEESTIDKVRRKEKERRKARKAKVKELKHQAEQDKKVKLKKGRGKQTS 471

Query: 468 EDESDAKSKAXXXXXXXXXXXXTEKSLNKKAHFNMNEILXXXXXXXXXXXXXXXXXIMED 527
           + E D KSKA            TEKS+NKKAHFNM EIL                 I+ D
Sbjct: 472 DIEQDPKSKAELELLMMDDEDDTEKSINKKAHFNMKEILKSEKEKKKKNKYQDKNKIVVD 531

Query: 528 EFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRAHK---KRKPLADDG 584
           +FKPDL DPRF E+FE  DFAIDP+Q E++ TKAMKE+L +RSK+AH+   KRK    + 
Sbjct: 532 DFKPDLEDPRFKEMFEGHDFAIDPTQSEFRGTKAMKEMLNKRSKQAHRVNSKRKIATQEN 591

Query: 585 DSKDNKHDISNIV 597
           D+ +N  DI+NIV
Sbjct: 592 DTNEN-GDIANIV 603

>NDAI0B05640 Chr2 complement(1377917..1379926) [2010 bp, 669 aa]
           {ON} Anc_5.430 YDR365C
          Length = 669

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/643 (47%), Positives = 372/643 (57%), Gaps = 54/643 (8%)

Query: 7   SKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRIT---GE 63
           +K S+DPRFA I NDPKFR  K K LK+KLDDRFSKKDL++RRK+KVDKYGR++    G 
Sbjct: 8   NKESTDPRFAKIYNDPKFRKTKNKDLKIKLDDRFSKKDLEIRRKSKVDKYGRKLADSKGN 67

Query: 64  SKDLKDFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXV-------------VDRARGELP 110
            K++ DFDKYF                                        +DRARG++P
Sbjct: 68  EKEMNDFDKYFEKDDEKKESEEIATEKSVSVEEKEDEEEERKETELEDDTNIDRARGDVP 127

Query: 111 EAYTXXXXXXXXXXXXXXX-----XXXXXXXXXXXXKPESGDPSKTLAVVNLDWDHVRAA 165
             Y                                 +PESG+PSKTLAVVNLDWDHV+++
Sbjct: 128 ADYVSSSDEYTSSESEASDEEELDSDVESGEEVTTQEPESGEPSKTLAVVNLDWDHVKSS 187

Query: 166 DLMITFSSFLPSGGKIEKICIYPSEFGKERMQREEKEGPPREIFNXXXX----------X 215
           DLMITFSSFLP GG+IE I IYPSEFGKERMQRE+ EGPP+E+F                
Sbjct: 188 DLMITFSSFLPEGGRIENIAIYPSEFGKERMQREDVEGPPKELFQKRKKKTSKSKKISDE 247

Query: 216 XXXXXXXXVDIRDLYEEGDADKEVDNXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCD 275
                   VDI+DLYEEGDADK+VD                 +VYCNN+ET  +IY NCD
Sbjct: 248 ANDSDVSDVDIKDLYEEGDADKDVDTKALRQYQLERLRYYYAVVYCNNIETATAIYQNCD 307

Query: 276 GTEYESTANIFDLRYVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETP 335
           GTEYESTAN+FDLRYVP+GM+F DEP+D+C  LPKNYKP +FSTDALQHSNVKLTWDETP
Sbjct: 308 GTEYESTANMFDLRYVPDGMDFTDEPRDQCDSLPKNYKPHQFSTDALQHSNVKLTWDETP 367

Query: 336 TDRLEVSKRAFSQKELEDMDFQAYLASGTDESDGXXXXXXXXXXXLKSLVG------QSL 389
            +R EV+KRAF+QKE++DMDF+AYLAS +D S+            LK+LVG      + +
Sbjct: 368 VERQEVAKRAFTQKEIDDMDFKAYLASDSDGSE--DELNEDAKNKLKALVGGGGFGSREI 425

Query: 390 AYGK-----QQEEEPDMEITFTPGLDDSKPQADEDHEETTIEKVXXXXXXXXXXXXXXXX 444
             GK     + E+E DMEITF P LD++ P+ D +HEETTIEKV                
Sbjct: 426 FGGKGAKAGEDEDEVDMEITFNPALDENSPKEDGEHEETTIEKVARKEKERRKARKQKLK 485

Query: 445 XXXXXXXXXXXXXXXSGKNKKQVEDESDA------KSKAXXXXXXXXXXXXTEKSLNKKA 498
                            KNKK    E DA      KS+A            T  ++N KA
Sbjct: 486 ELKTKAQQEKKDKLKLSKNKKNHTKEDDAEAKKNQKSRAELELLMMDDDEETGSTINNKA 545

Query: 499 HFNMNEILXXXXXXXXXXXXXXXXXIMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKS 558
           HFNMNEIL                 I+EDEFKPDLNDPRF EVFE+ DFAIDPS+PE+K 
Sbjct: 546 HFNMNEILRSEKEKGKRGKYQNKDKIVEDEFKPDLNDPRFKEVFEDHDFAIDPSRPEFKE 605

Query: 559 TKAMKEILEERSKRAHK----KRKPLADDGDSKDNKHDISNIV 597
           TKAMKEIL+ERSKR HK    K++ L+   ++     DI+NIV
Sbjct: 606 TKAMKEILKERSKRIHKKGSNKKRRLSITENAGAESSDITNIV 648

>CAGL0L11638g Chr12 (1243194..1245020) [1827 bp, 608 aa] {ON}
           similar to uniprot|Q06344 Saccharomyces cerevisiae
           YDR365c
          Length = 608

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/609 (49%), Positives = 360/609 (59%), Gaps = 37/609 (6%)

Query: 10  SSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRIT-GESKDLK 68
           S+DPRF+ I NDPKF+    K LK+KLDDRF KKDL+V R+AKVDKYGR+I  G SKD++
Sbjct: 6   SNDPRFSRIYNDPKFKKSNSKQLKIKLDDRFGKKDLEVARRAKVDKYGRKIKEGSSKDIE 65

Query: 69  DFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXVVDRARGELPEAY-------TXXXXXXX 121
           DFDKYF                          +VDRARGE+P  Y       T       
Sbjct: 66  DFDKYFEKDEKSAEEESADEGDVAKSKK----IVDRARGEVPSDYVSSEDEFTSSDSDTS 121

Query: 122 XXXXXXXXXXXXXXXXXXXXKPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGKI 181
                               K E+GD +KTLA VNLDWDHVR+ D+M+TFSSFLP GGKI
Sbjct: 122 GDSDYDSEIESGDEAQEEQTKVETGDATKTLAAVNLDWDHVRSVDMMVTFSSFLPKGGKI 181

Query: 182 EKICIYPSEFGKERMQREEKEGPPREIFNXXXX-----XXXXXXXXXVDIRDLYEEGDAD 236
           EKICIYPSEFGKERM+REE EGPPRE+F                   VDI+DLYEEG+AD
Sbjct: 182 EKICIYPSEFGKERMKREEVEGPPRELFQKNKKKKKKNSSEDEEESDVDIKDLYEEGNAD 241

Query: 237 KEVDNXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGME 296
            +VD                 ++YCNNVE+ ++IY NCDGTEYESTANI DLRYVP+GM+
Sbjct: 242 DQVDKRALRQYQLDRLRYYYAVIYCNNVESAKAIYENCDGTEYESTANIIDLRYVPDGMD 301

Query: 297 FDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDF 356
           FDDEPKD+C+ELPKNYKP +FSTDALQHSNVKLTWDETP DR+EV+KRAF+QKE+EDMDF
Sbjct: 302 FDDEPKDQCEELPKNYKPHQFSTDALQHSNVKLTWDETPVDRVEVAKRAFTQKEIEDMDF 361

Query: 357 QAYLASGTDESDGXXXXXXXXXXXLKSLVGQSLAY----GKQQEEEPDMEITFTPGLDDS 412
           +AYLAS +DES             LKSLVG+SL      G  ++E  DMEITFTPGLD++
Sbjct: 362 KAYLASDSDES--EEEVNEEAKNKLKSLVGESLKIDGKDGSDEDEGMDMEITFTPGLDEA 419

Query: 413 KPQAD----EDHEETTIEKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGKNKKQVE 468
             + +    ED+EETTIEKV                               S        
Sbjct: 420 NAEGEDKDGEDNEETTIEKVRRKEKERRKARKQKLKELKQKSEEEKKQKLKSK------H 473

Query: 469 DESDAKSKAXXXXXXXXXXXXTEKSLNKKAHFNMNEILXXXXXXXXXXXXXXXXXIMEDE 528
           DE  +  K             +   +N KAHFNMNEIL                 I+ED+
Sbjct: 474 DEPLSDKKKAELELLMMDENESNSGINSKAHFNMNEILRSEKEKSKKGKFQKKQRIVEDD 533

Query: 529 FKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRAHKKRKPLADDGDSKD 588
           FKP+L+D RF EVFE+ DFAIDPSQPE+K TKAMKEIL+ER KR+   +    +  D   
Sbjct: 534 FKPNLDDDRFKEVFEDHDFAIDPSQPEFKETKAMKEILKERRKRSRDSKHGKEEHTD--- 590

Query: 589 NKHDISNIV 597
            K+DI+ IV
Sbjct: 591 -KNDINKIV 598

>NCAS0F03350 Chr6 complement(677168..679087) [1920 bp, 639 aa] {ON}
           Anc_5.430 YDR365C
          Length = 639

 Score =  527 bits (1358), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/631 (50%), Positives = 371/631 (58%), Gaps = 44/631 (6%)

Query: 1   MVEDRGSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI 60
           M ED  +KG+ D RF+GI NDPKFR  K K LK+KLD+RFSKKDL++RRKAKVDKYGR+I
Sbjct: 1   MSEDNSTKGTDDSRFSGIYNDPKFRKTKNKNLKIKLDERFSKKDLEIRRKAKVDKYGRKI 60

Query: 61  TGE----SKDLKDFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXVVDRARGELPEAYTXX 116
             +    +K+LKDFDKYF                           VDRARGE+P  Y   
Sbjct: 61  HEDNDMNNKELKDFDKYF-------EKEGESADEKKEEEEIETVTVDRARGEVPADYVSS 113

Query: 117 XXXXXXXXXXXXXXXXXXXXXXX-----XXKPESGDPSKTLAVVNLDWDHVRAADLMITF 171
                                          PE+GD +KTLAVVNLDWDHVR++DLMITF
Sbjct: 114 SDEYTSSESEDSGESDLESEGESEIEVDEATPETGDATKTLAVVNLDWDHVRSSDLMITF 173

Query: 172 SSFLPSGGKIEKICIYPSEFGKERMQREEKEGPPREIFN------XXXXXXXXXXXXXVD 225
           S FLP GGKIEKI + PSEFGKERMQREE EGPPRE+F                    VD
Sbjct: 174 SGFLPKGGKIEKIVVLPSEFGKERMQREETEGPPRELFQKKKKKGKRASVESDSDDSDVD 233

Query: 226 IRDLYEEGDADKEVDNXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYESTANI 285
           I+DLYEEGDADK+VD                 +VYCN+VE   +IY NCDGTEYESTAN+
Sbjct: 234 IKDLYEEGDADKDVDTRALRQYQLERLRYYYAVVYCNSVEAARAIYENCDGTEYESTANM 293

Query: 286 FDLRYVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRA 345
           FDLRYVP+GM+FDDEP+D+C  LPKNYKP +FSTDALQHSNVKLTWDETP +R+EV+KRA
Sbjct: 294 FDLRYVPDGMDFDDEPRDQCSSLPKNYKPHQFSTDALQHSNVKLTWDETPAERVEVAKRA 353

Query: 346 FSQKELEDMDFQAYLASGTDESDGXXXXXXXXXXXLKSLVGQSLAYGKQ----------- 394
           F+QKE+EDMDF+AYLAS +D S+            LKSLVG SL  G Q           
Sbjct: 354 FTQKEIEDMDFKAYLASDSDGSE--DEVNQDAKNKLKSLVGDSLRIGNQPIFGSKDTLEG 411

Query: 395 QEEEPDMEITFTPGLDDSKPQADEDHEETTIEKVXXXXXXXXXXXXXXXXXXXXXXXXXX 454
           ++EE DMEITF PGL +   +  E+HEETTIEKV                          
Sbjct: 412 EDEEVDMEITFDPGLSEG-VEKTEEHEETTIEKVARKEKERRKARKQKLKELKNNAQKEK 470

Query: 455 XXXXXSGKNKKQVE----DESDAKSKAXXXXXXXXXXXXTEKSLNKKAHFNMNEILXXXX 510
                S K KK  +    D S AKSKA            TE  +NKKAHFNM EIL    
Sbjct: 471 KDKLKSLKGKKHNDSTEGDASTAKSKAELELLMMDDEDDTETGINKKAHFNMKEILRSEK 530

Query: 511 XXXXXXXXXXXXXIMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERS 570
                        I+ED FKPDLNDPRF EVFE+ DFAIDPS+PE+K T AMKEIL+ERS
Sbjct: 531 EKSKKGKYQDKRRIVEDNFKPDLNDPRFKEVFEDHDFAIDPSRPEFKETPAMKEILKERS 590

Query: 571 KR----AHKKRKPLADDGDSKDNKHDISNIV 597
           KR    A KK++  +   +  +   DISNIV
Sbjct: 591 KRSSKNAQKKKRSHSLMDNQANETSDISNIV 621

>Smik_4.632 Chr4 complement(1130422..1132305) [1884 bp, 627 aa] {ON}
           YDR365C (REAL)
          Length = 627

 Score =  521 bits (1341), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 303/629 (48%), Positives = 365/629 (58%), Gaps = 49/629 (7%)

Query: 1   MVEDRGSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI 60
           M E++  K  +D RFAGI +DPKF+N + K  K+KLD RFSKKDL+V+ K+KVDKYGR+I
Sbjct: 1   MAEEKPQKEGADTRFAGIYSDPKFKNTRTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60

Query: 61  --TGESKDLKDFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXVVDRARGELPEAYTXXXX 118
             T  +K+L+DFDKYF                          VVDRARGE+   Y     
Sbjct: 61  KNTQNNKELEDFDKYF----------QKEAENDEDTEASVKTVVDRARGEISGDYVSSSD 110

Query: 119 XXXXXXXXXXXXXXXXXXXXXXX-----KPESGDPSKTLAVVNLDWDHVRAADLMITFSS 173
                                       KPE GD SKTLAVVNLDWDHV++ DLMITFSS
Sbjct: 111 EFTSSDSESSEQSEVESEVESEVEIEDPKPECGDVSKTLAVVNLDWDHVKSEDLMITFSS 170

Query: 174 FLPSGGKIEKICIYPSEFGKERMQREEKEGPPREIFNXXXXXXXXXXXXX--------VD 225
           F+P GGK+E++ IYPSEFGKERMQREE EGPP+E+F                      + 
Sbjct: 171 FVPKGGKLERVAIYPSEFGKERMQREEVEGPPKELFQKKNKNKVSRKKKSDESDSDIDIG 230

Query: 226 IRDLYEEGDADKEVDNXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYESTANI 285
           I DLYEEGDADK+VD+                IVYC+++ T ++IY NCDGTEYESTAN+
Sbjct: 231 INDLYEEGDADKDVDSRALRQYQLDRLRYYYAIVYCSDITTSKAIYDNCDGTEYESTANM 290

Query: 286 FDLRYVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRA 345
           FDLRYVP+GM FDD  +DEC  LPKNY+P +FSTDALQHSNVKLTWDETP DRLEV+KRA
Sbjct: 291 FDLRYVPDGMTFDDAVRDECTLLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRA 350

Query: 346 FSQKELEDMDFQAYLASGTDESDGXXXXXXXXXXXLKSLVGQSLAYGKQQE------EEP 399
           F+QKE++DMDF+AYLAS +DESD            LKSLVG  + +  ++E      EE 
Sbjct: 351 FTQKEIDDMDFKAYLASDSDESD--EQIDEDAKNKLKSLVG-GINFNSKKENVKDSDEEV 407

Query: 400 DMEITFTPGLDDSKPQADEDHEETTIEKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 459
           DMEITFTP L+    Q  E+ EETTIEK+                               
Sbjct: 408 DMEITFTPALEGGNEQPSEEQEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKTKLK 467

Query: 460 SGKNKKQVEDESD----AKSKAXXXXXXXXXXXXTEKSLNKKAHFNMNEILXXXXXXXXX 515
           S  NKK  E E D    AK+KA             + ++N KAHFNMNEIL         
Sbjct: 468 SI-NKKYAEGEEDIKNNAKAKAELELLMDDDDAEAQGTINNKAHFNMNEILRSEKEKNKK 526

Query: 516 XXXXXXXXIMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRAH- 574
                   I+ED F PDLNDPRF EVFE+ DFAIDP+QPEYKST+AM +IL+ER KR   
Sbjct: 527 SRYQNKERIVEDNFTPDLNDPRFKEVFEDHDFAIDPTQPEYKSTQAMNKILKERGKRVKD 586

Query: 575 KKRKP------LADDGDSKDNKHDISNIV 597
           KKRK       +  +GDSK N   I N+V
Sbjct: 587 KKRKHDGSENDIIKNGDSKGN---IGNLV 612

>SAKL0G02442g Chr7 complement(201924..203795) [1872 bp, 623 aa] {ON}
           similar to uniprot|Q06344 YDR365C Saccharomyces
           cerevisiae ESF1 Nucleolar protein involved in pre-rRNA
           processing
          Length = 623

 Score =  517 bits (1332), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 284/582 (48%), Positives = 354/582 (60%), Gaps = 26/582 (4%)

Query: 10  SSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRITG-ESKDLK 68
           ++DPRF+GI +DPKF++ K K LK+KLDDRFSKKDL++++KAKVDKYGRR+   ++K+ K
Sbjct: 11  TNDPRFSGIHSDPKFKDAKPKNLKIKLDDRFSKKDLEIKKKAKVDKYGRRLKDVDNKETK 70

Query: 69  DFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXVVDRARGELPEAYTXXXXXXXXXXXXXX 128
           DF++YF                           +DRARGE+P  Y               
Sbjct: 71  DFERYFEKEEESSSPSDEEGESTKVTS------LDRARGEVPSDYLSSSEEESSSESEEE 124

Query: 129 XXXXXXXXXX-----XXXKPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGKIEK 183
                             KP +GD ++ LAVVNLDWDHV++ DLM+TFSSF+P GGKI K
Sbjct: 125 SENSELESEESDLEIEESKPPTGDATRMLAVVNLDWDHVKSTDLMVTFSSFVPKGGKILK 184

Query: 184 ICIYPSEFGKERMQREEKEGPPREIFNXXXXXXXXX--XXXXVDIRDLYEEGDADKEVDN 241
           I IYPSEFGKERMQREE EGPPRE+F                VDI+DLYEEGDA+K+ D+
Sbjct: 185 IAIYPSEFGKERMQREEVEGPPRELFQGKKKKSQRKDGDDSDVDIKDLYEEGDAEKDYDS 244

Query: 242 XXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEFDDEP 301
                           +V+CNNVET E+IY NCDGTEYESTAN+FDLRYVPEGM+F DEP
Sbjct: 245 KALRRYQLDRLRYYYAVVFCNNVETAEAIYQNCDGTEYESTANMFDLRYVPEGMDFSDEP 304

Query: 302 KDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQAYLA 361
           KDEC+++PKNYKP +FSTDALQHSNVKLTWDETP +R+E+SKRAF+QKE+EDMDF+AYLA
Sbjct: 305 KDECEDVPKNYKPAQFSTDALQHSNVKLTWDETPAERVEMSKRAFTQKEIEDMDFKAYLA 364

Query: 362 SGTDESDGXXXXXXXXXXXLKSLVGQSLAYGKQ--------QEEEPDMEITFTPGLDDSK 413
           S ++ S+            LKSLV +S+  G +        +  + DMEITFTPGLD++K
Sbjct: 365 SDSEGSE--EEINEDSRNKLKSLVSESIRIGDKSLFDKSDNEGGDVDMEITFTPGLDEAK 422

Query: 414 PQADEDHEETTIEKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGKNKKQVED--ES 471
              ++  +ETTIEK+                                  ++ +  D  E 
Sbjct: 423 KDDEDGKDETTIEKIRRKEKERRKMRKERVKELKKKAEEKKREKLNKSDSQSKTADEVEK 482

Query: 472 DAKSKAXXXXXXXXXXXXTEKSLNKKAHFNMNEILXXXXXXXXXXXXXXXXXIMEDEFKP 531
           + KSKA            TE  LNKKAHFNM EIL                 I+EDEFKP
Sbjct: 483 EKKSKAELELLMMDDDNDTESKLNKKAHFNMTEILRSEKEKGKRTKYQNREKIVEDEFKP 542

Query: 532 DLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRA 573
           DLNDPRF EVFE+ DFAIDPSQPE+K T AMKEIL+ER++R 
Sbjct: 543 DLNDPRFREVFEDHDFAIDPSQPEFKGTTAMKEILKERNQRV 584

>Suva_2.538 Chr2 complement(960917..962806) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  513 bits (1321), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 298/624 (47%), Positives = 359/624 (57%), Gaps = 42/624 (6%)

Query: 1   MVEDRGSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI 60
           M  D+  K S D RFAGI NDPKF+N + +  K+KLD RFSKKDL+V+ K+KVDKYGR+I
Sbjct: 1   MAVDKLEKESVDARFAGIYNDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60

Query: 61  --TGESKDLKDFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXVVDRARGELPEAYTXX-- 116
                +K+L+DFDKYF                           VDRARGE+P  Y     
Sbjct: 61  KDAHNTKELEDFDKYF----------EKEAENEEDTEADVKATVDRARGEVPNDYVSSGD 110

Query: 117 ---XXXXXXXXXXXXXXXXXXXXXXXXXKPESGDPSKTLAVVNLDWDHVRAADLMITFSS 173
                                       KPESGD SKTLAVVNLDWDHV++ DLMITFS 
Sbjct: 111 EFTSSDSESSGESEIESEEESEVEAEDAKPESGDASKTLAVVNLDWDHVKSEDLMITFSG 170

Query: 174 FLPSGGKIEKICIYPSEFGKERMQREEKEGPPREIFNXXXXXXXXXXXXXVD-------- 225
           F+P GGKIE+I +YPSEFGKERMQREE EGPP+E+F               D        
Sbjct: 171 FVPKGGKIERISVYPSEFGKERMQREEIEGPPKELFQRKKQVKASKKENADDSDSDIDIG 230

Query: 226 IRDLYEEGDADKEVDNXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYESTANI 285
           I+DLYEEGDADK+VD+                IV C+++ T  +IY NCDGTEYESTAN+
Sbjct: 231 IKDLYEEGDADKDVDSRALRQYQLDRLRYYYAIVDCSDISTARAIYENCDGTEYESTANM 290

Query: 286 FDLRYVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRA 345
           FDLRYVP+GM FDD  +D C  LPKNY+P +FSTDALQHSNVKLTWDETP DR+EV+KRA
Sbjct: 291 FDLRYVPDGMTFDDTARDACSTLPKNYRPHQFSTDALQHSNVKLTWDETPADRVEVAKRA 350

Query: 346 FSQKELEDMDFQAYLASGTDESDGXXXXXXXXXXXLKSLVGQSLAYGKQQ-------EEE 398
           F+QKE++DMDF+AYLAS +DESD            LKSLVG  L +  ++       EEE
Sbjct: 351 FTQKEIDDMDFKAYLASDSDESD--EEVNEDAKSKLKSLVG-GLGFNSKKENANDGDEEE 407

Query: 399 PDMEITFTPGLDDSKPQADEDHEETTIEKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 458
            DMEITFTP L+    +  E  EET+IEK+                              
Sbjct: 408 VDMEITFTPALEGGDEKPIEGQEETSIEKIRRKEKERRKARKQKVKELKQQSEKEKRGKF 467

Query: 459 XSGKNKKQVEDE----SDAKSKAX-XXXXXXXXXXXTEKSLNKKAHFNMNEILXXXXXXX 513
            S  NKK V DE    ++AKSKA              E S+N KAHFNMNEIL       
Sbjct: 468 KSA-NKKHVADEEEIKNNAKSKAELELLMDDDGDAEAESSINSKAHFNMNEILRSEKEKH 526

Query: 514 XXXXXXXXXXIMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRA 573
                     I+ED F PDL DPRF EVFE+ DFAIDP+QPEYK T+AM +IL+ER KR 
Sbjct: 527 KKSRYQKKERIVEDNFTPDLEDPRFKEVFEDHDFAIDPTQPEYKGTQAMNKILKERGKRV 586

Query: 574 H-KKRKPLADDGDSKDNKHDISNI 596
           H +KRK   ++ D  ++ +D  NI
Sbjct: 587 HDRKRKHGKNENDVTEDGNDNKNI 610

>YDR365C Chr4 complement(1204497..1206383) [1887 bp, 628 aa] {ON}
           ESF1Nucleolar protein involved in pre-rRNA processing;
           depletion causes severely decreased 18S rRNA levels
          Length = 628

 Score =  509 bits (1311), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 293/615 (47%), Positives = 358/615 (58%), Gaps = 43/615 (6%)

Query: 1   MVEDRGSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI 60
           M  +   K   D RFAGI +DPKF+N K K  K+KLD RFSKKDL+V+ K+KVDKYGR+I
Sbjct: 1   MAGENPKKEGVDARFAGIYSDPKFKNTKTKDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60

Query: 61  TG--ESKDLKDFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXVVDRARGELPEAYTXXX- 117
                +++L+DFDKYF                          VVDRARGE+P+ Y     
Sbjct: 61  KNAQNNRELEDFDKYF----------EKEAENDEDSEVNAKTVVDRARGEVPDDYVSSSD 110

Query: 118 ----XXXXXXXXXXXXXXXXXXXXXXXXKPESGDPSKTLAVVNLDWDHVRAADLMITFSS 173
                                       KPESGD SK LAVVNLDWDHV++ DLMITFSS
Sbjct: 111 EFTSSDSESSGESEVESEEENEVEIENAKPESGDISKNLAVVNLDWDHVKSEDLMITFSS 170

Query: 174 FLPSGGKIEKICIYPSEFGKERMQREEKEGPPREIFNXXXXXXXXXXXXX--------VD 225
           F+P GGKIE++ IYPSEFGKERMQREE EGPP+E+F                      + 
Sbjct: 171 FVPKGGKIERVAIYPSEFGKERMQREEVEGPPKELFQKKNKNKTSKKKKTDDSDSDMDIG 230

Query: 226 IRDLYEEGDADKEVDNXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYESTANI 285
           I+DLYEEGDADK+VD+                IVYC++  T ++IY NCDGTEYESTAN+
Sbjct: 231 IKDLYEEGDADKDVDSRALRQYQLDRLRYYYAIVYCSDTTTSKAIYDNCDGTEYESTANM 290

Query: 286 FDLRYVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRA 345
           FDLRYVP+GM FDD+ +DEC  LPKNY+P +FSTDALQHS+VKLTWDETP DR+EV+KRA
Sbjct: 291 FDLRYVPDGMTFDDDVRDECSILPKNYRPHQFSTDALQHSSVKLTWDETPADRVEVAKRA 350

Query: 346 FSQKELEDMDFQAYLASGTDESDGXXXXXXXXXXXLKSLVGQSLAYGKQQE------EEP 399
           F+QKE++DMDF+AYLAS +DESDG           LKSLVG    +  ++E      EE 
Sbjct: 351 FTQKEIDDMDFKAYLASDSDESDG--QVDEEAKNKLKSLVG-DFGFNSKKETPNDEDEEV 407

Query: 400 DMEITFTPGLDDSKPQADEDHEETTIEKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 459
           DMEITFTP L+    ++ ED EETTIEK+                               
Sbjct: 408 DMEITFTPALEGGNEKSSEDKEETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKLK 467

Query: 460 SGKNKKQVED----ESDAKSKAXXXXXXXXXXXXTEK-SLNKKAHFNMNEILXXXXXXXX 514
           S  NKK   D    E +AKSKA              + ++N KAHFNMNEIL        
Sbjct: 468 SV-NKKHTNDEEEIEKNAKSKAELELLMDDDDDTETQGTINNKAHFNMNEILRSEKEKHK 526

Query: 515 XXXXXXXXXIMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRAH 574
                    I+ED F PDL DPRF EVFE+ DFAIDP+QPE+K T+AM +IL+ERSKR  
Sbjct: 527 KGRYQKKERIVEDTFTPDLEDPRFKEVFEDHDFAIDPTQPEFKGTQAMSKILKERSKRVK 586

Query: 575 KKRKPLADDGDSKDN 589
            K++ L   G S++N
Sbjct: 587 NKKRKL---GGSENN 598

>Kpol_1016.8 s1016 (16620..18533) [1914 bp, 637 aa] {ON}
           (16620..18533) [1914 nt, 638 aa]
          Length = 637

 Score =  509 bits (1311), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 288/594 (48%), Positives = 349/594 (58%), Gaps = 42/594 (7%)

Query: 8   KGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI--TGESK 65
           K SSDPRF+GI +DPKF+N K+K +K+KLDDRF K DL ++ K+KVDKYGR++    ++K
Sbjct: 8   KQSSDPRFSGIYSDPKFKNSKRKNIKIKLDDRFDKSDLQIKHKSKVDKYGRKLKDVKDNK 67

Query: 66  DLKDFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXVVDRARGELPEAY-----TXXXXXX 120
           +L+DFDKYF                          V+DRARGE+P  Y            
Sbjct: 68  ELEDFDKYF-------EKEDEEDKEEEIGTEAKVKVLDRARGEVPSDYESSSEEFTSSDS 120

Query: 121 XXXXXXXXXXXXXXXXXXXXXKPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGK 180
                                KPESGD SKTLAVVNLDWD+V++ DLMITFSSFLP GGK
Sbjct: 121 ESSGESEVDSDEESEDEVETSKPESGDSSKTLAVVNLDWDYVKSQDLMITFSSFLPKGGK 180

Query: 181 IEKICIYPSEFGKERMQREEKEGPPREIF-----------NXXXXXXXXXXXXXVDIRDL 229
           IEKICIYPSEFGKERM REE EGPPRE+F           +             VDIR+L
Sbjct: 181 IEKICIYPSEFGKERMAREEVEGPPRELFNKKKNKKSSKKSSKDDDEDDESDSDVDIREL 240

Query: 230 YEEGDADKEVDNXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYESTANIFDLR 289
           YEEGDA+K+VD+                +VYCNN+ + ESIY NCDGTEYES+ANIFDLR
Sbjct: 241 YEEGDAEKDVDSKALRQYQLERLRYYYAVVYCNNIASAESIYENCDGTEYESSANIFDLR 300

Query: 290 YVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQK 349
           YVP+G EFDDEP+DEC +LPKNYK  +F+TDALQHSNVKLTWDETP DR+E++KRAF+QK
Sbjct: 301 YVPDGTEFDDEPRDECLQLPKNYKVRQFTTDALQHSNVKLTWDETPADRVEIAKRAFTQK 360

Query: 350 ELEDMDFQAYLASGTDESDGXXXXXXXXXXXLKSLVGQSLAYG----------KQQEEEP 399
           E+E+MDF+AYLAS +DES+            LKSLV QS   G            +E++ 
Sbjct: 361 EIEEMDFKAYLASDSDESE--EEPNDDVKNKLKSLVSQSTTIGDKSIFDDKGDNNEEDDV 418

Query: 400 DMEITFTPGL--DDSKPQADEDHEETTIEKVXXXXXXXXXXXX---XXXXXXXXXXXXXX 454
           DMEITFTPGL         D+D+EETTIEKV                             
Sbjct: 419 DMEITFTPGLGEGGEDGDEDKDNEETTIEKVRRKEKERRKARKDKLKQLKQQSENEKKEK 478

Query: 455 XXXXXSGKNKKQVEDESDAKSKAXXXXXXXXXXXXTEKSLNKKAHFNMNEILXXXXXXXX 514
                  +N        DAK+KA            +  +LNKKAHFNMNEI+        
Sbjct: 479 LKELKKERNGNGKNTNVDAKAKAELELLMMDDETESTSTLNKKAHFNMNEIVRSEKEKGK 538

Query: 515 XXXXXXXXXIMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEE 568
                    I+ED+FKPDLNDPRF E+FE+ DFAIDP+Q E+K T AMKEIL+E
Sbjct: 539 KSKYQDKNKIVEDDFKPDLNDPRFKEIFEDHDFAIDPTQSEFKETTAMKEILKE 592

>KNAG0C04940 Chr3 (953539..955467) [1929 bp, 642 aa] {ON} Anc_5.430
           YDR365C
          Length = 642

 Score =  499 bits (1284), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 304/634 (47%), Positives = 370/634 (58%), Gaps = 52/634 (8%)

Query: 8   KGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRIT---GES 64
           K SSDPRF+G+ NDPKFR+ K+K LKVKLD RFSKKDL+V++KAKVDKYGR+I       
Sbjct: 4   KMSSDPRFSGVYNDPKFRSTKEKKLKVKLDSRFSKKDLEVKKKAKVDKYGRKIKNGDANK 63

Query: 65  KDLKDFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXVVDRARGELPEAYTXXXXXXXXXX 124
           K+L+DFDKYF                          VVDRARGE+P+ Y           
Sbjct: 64  KELEDFDKYFEKEDEAKESEDAEAPEAPVKV-----VVDRARGEVPDDYVSSADEFTSSD 118

Query: 125 XXXXXXXXXXXX----------XXXXXKPESGDPSKTLAVVNLDWDHVRAADLMITFSSF 174
                                      KPESGDPSKTLAVVNLDWDHV++ DLMITF+ F
Sbjct: 119 SESSGSSESESESEQSDVEDEIEANSGKPESGDPSKTLAVVNLDWDHVKSVDLMITFTGF 178

Query: 175 LPSGGKIEKICIYPSEFGKERMQREEKEGPPREIFNX-------------XXXXXXXXXX 221
           +P GGKIE+ICIYPSEFGKER+ REEKEGPP+E+F+                        
Sbjct: 179 IPKGGKIERICIYPSEFGKERLNREEKEGPPKELFHKKKSKKNSAAKSKGAESGKSDDDV 238

Query: 222 XXVDIRDLYEEGDADKEVDNXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYES 281
             VDI+DLYEEGDA+K++D+                +VYCNNVET ++IY NCD TEYES
Sbjct: 239 SDVDIKDLYEEGDAEKDIDSKALRQYQLERLRYFYAVVYCNNVETAKAIYDNCDATEYES 298

Query: 282 TANIFDLRYVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEV 341
           TAN+FDLRYVPEGM FDD+P+DEC+ LPKNYKPL F+TDALQHSNVKLTWDETP DR+E+
Sbjct: 299 TANMFDLRYVPEGMTFDDDPRDECEALPKNYKPLNFATDALQHSNVKLTWDETPADRVEI 358

Query: 342 SKRAFSQKELEDMDFQAYLASGTDESDGXXXXXXXXXXXLKSLVGQSLAYGK-------- 393
           +KRAFSQKE++DMDF+AYLAS +++SD            LK+LVG +L   +        
Sbjct: 359 AKRAFSQKEIDDMDFKAYLASDSEDSDA--KVDETMKNRLKALVGGTLKASRPKGGAEED 416

Query: 394 -QQEEEPDMEITFTPGLD--DSKPQADEDHEETTIEKVXXXXXXXXXXXXXXXXXXXXXX 450
              EE  DMEITFTPGLD      Q     EE+TI+K+                      
Sbjct: 417 EDDEEGMDMEITFTPGLDEAQVAEQEAAAEEESTIDKIRRKEKERRKNRKQKLKELKKNA 476

Query: 451 XXXXXXXXXS-GKNKKQVEDE---SDAKSKAXXXXXXXXXXXXTEKSLNKKAHFNMNEIL 506
                    S  K +K  E+E     AK++             ++ +LNKK HFNMNEI+
Sbjct: 477 EKEKRDKLKSLKKGRKNGEEEPVDDKAKAELELLMMDEDEERDSKSTLNKKMHFNMNEIM 536

Query: 507 XXXXXXXXXXXXXXXXXIMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEIL 566
                            I+EDEFKPDL+D RF EVFE+ DFAIDPS+PE+K T AM++IL
Sbjct: 537 RSEKEKKKKSKFQDKNRIVEDEFKPDLSDDRFKEVFEDHDFAIDPSRPEFKETPAMQKIL 596

Query: 567 EERSKRAH---KKRKPLADDGDSKDNKHDISNIV 597
           +ERS RA    KKRK      D+ D K DIS IV
Sbjct: 597 QERSNRARSKGKKRKSAEQSTDTSD-KTDISQIV 629

>KLLA0E21165g Chr5 (1890314..1892197) [1884 bp, 627 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 627

 Score =  496 bits (1276), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 276/605 (45%), Positives = 352/605 (58%), Gaps = 30/605 (4%)

Query: 8   KGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRITGESKDL 67
           K + DPRF+GI NDPKFR+ K K  K+KLDDRFSK+DL+VRRKAKVDKYGR+I   +KD+
Sbjct: 10  KITEDPRFSGIHNDPKFRSTKSKNFKIKLDDRFSKQDLEVRRKAKVDKYGRKIVDANKDV 69

Query: 68  KDFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXV----VDRARGELPEAYTXXXXXXXXX 123
           KDFD+YF                          V    VDRARGE P  Y          
Sbjct: 70  KDFDRYFTKEKPEDKEDESNSSESSDDQEAEAAVHAKSVDRARGEPPADYVSSSDEESSS 129

Query: 124 XXXXXXXXXXXXXXXXXX---KPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGK 180
                                KP SG+ + TLAVVNLDWDHV++ADL +TF SF+P GG+
Sbjct: 130 ESEEESGDSDIESEEIELEESKPASGNATNTLAVVNLDWDHVKSADLFVTFKSFVPKGGE 189

Query: 181 IEKICIYPSEFGKERMQREEKEGPPREIFNXXXXXXXXXXXXXVDIRDLYEEGDADKEVD 240
           I+KI IYPSEFGKERMQREE EGPP+E+F              +++  +YEEGDA+ + D
Sbjct: 190 IQKIAIYPSEFGKERMQREEIEGPPKELFQSKKSKKNDKDDDEINVESIYEEGDAE-DYD 248

Query: 241 NXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEFDDE 300
           +                +VYC+++ T ESIY NCDGTEYESTAN+FDLRYVP+GME DD+
Sbjct: 249 SKALRRYQLERLRYYYAVVYCSDIRTAESIYQNCDGTEYESTANVFDLRYVPDGMEMDDD 308

Query: 301 PKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQAYL 360
           P+DEC  LPKNYKP +FSTDALQHS VKLTWDETP DR+E+SKRAF+QKE+E+MDF+AYL
Sbjct: 309 PRDECTSLPKNYKPAQFSTDALQHSKVKLTWDETPADRVEISKRAFTQKEIEEMDFKAYL 368

Query: 361 ASGTDESDGXXXXXXXXXXXLKSLVGQSLAYGKQQ---------EEEPDMEITFTPGLDD 411
           AS ++ES+            LK+LV  S+  G++          + E DMEITFTPGLD+
Sbjct: 369 ASDSEESE--VEHDDQVKNKLKALVMDSVKVGQKSLFDQKEDEDDNEADMEITFTPGLDE 426

Query: 412 SKPQ-ADEDHEETTIEKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGKNKKQVEDE 470
           S  Q  +++ EE+TI+K+                                 K+     D+
Sbjct: 427 SGQQDTNDNEEESTIDKIRRKEKERRKKRKDRVKELKKESEAKLKENLKKKKDTSHSIDD 486

Query: 471 SDAKSKAXXXXXXXXXXXXTEKSLNKKAHFNMNEILXXXXXXXXXXXXXXXXXIMEDEFK 530
              K +              E ++N KAHFNMNEIL                 I++DEF 
Sbjct: 487 DKKKGEL---ELLMLDENEGESTINNKAHFNMNEILKSEKEKSKKAKYQNKEKIVDDEFT 543

Query: 531 PDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRAHKKRKPLADDGDSKDNK 590
           PD+NDPRF EVFE+ DFAIDP+QPE+K T AM++IL+ER+ R+ KK +        K   
Sbjct: 544 PDVNDPRFKEVFEDHDFAIDPTQPEFKKTPAMEKILKERTVRSSKKSR-------GKKRN 596

Query: 591 HDISN 595
           H+I+N
Sbjct: 597 HEIAN 601

>TPHA0H01780 Chr8 complement(409713..411581) [1869 bp, 622 aa] {ON}
           Anc_5.430 YDR365C
          Length = 622

 Score =  491 bits (1265), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 287/621 (46%), Positives = 361/621 (58%), Gaps = 51/621 (8%)

Query: 10  SSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRITG-ESKDLK 68
           ++D RF+G+ NDPKF+N +KK LK+KLD RFSK DL+V RKA+VDKYGR+I+   +++ K
Sbjct: 8   NTDERFSGVFNDPKFKNARKKNLKIKLDSRFSKSDLEVNRKARVDKYGRKISNLNNQEAK 67

Query: 69  DFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXVVDRARGELPEAYTX-----XXXXXXXX 123
           DFDKYF                          ++DRARGE+P  Y               
Sbjct: 68  DFDKYF-----------EKEEDGKGEEIAVKPLIDRARGEVPSDYQSSLDDYTSSESEDS 116

Query: 124 XXXXXXXXXXXXXXXXXXKPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGKIEK 183
                             KPESGD SKT+AVVNLDWDHV+A DL++TFSSF+P GGKIE+
Sbjct: 117 EDEDLESEGESEAEIEETKPESGDSSKTIAVVNLDWDHVKATDLLVTFSSFVPKGGKIER 176

Query: 184 ICIYPSEFGKERMQREEKEGPPREIFNXXXXXXXXXXXXX------VDIRDLYEEGDADK 237
           I I+PSEFGK+RM+REE EGPP+E+F                    VDI DLYEEGD DK
Sbjct: 177 IAIFPSEFGKQRMEREELEGPPKELFQKKKKKNSKKSNAEFNDDSDVDINDLYEEGDVDK 236

Query: 238 EVDNXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEF 297
           EVD+                +V+CNN+ T E+IY+NCDGTEYESTAN+FDLRYVP+GM+F
Sbjct: 237 EVDSKSLRQYQLDRLRYYYAVVFCNNISTAEAIYNNCDGTEYESTANVFDLRYVPDGMDF 296

Query: 298 DDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQ 357
           +D+P DEC ELPKNY PL F+TDALQHSNVKLTWDETP DR+E++KRAF+QKE+++MDF+
Sbjct: 297 EDQPYDECTELPKNYTPLNFTTDALQHSNVKLTWDETPADRVEIAKRAFTQKEIDEMDFK 356

Query: 358 AYLASGTDESDGXXXXXXXXXXXLKSLVGQSLAYGKQ---------QEEEPDMEITFTPG 408
           AYLAS ++ES             LKSLVG S+  G +         ++ E DMEITFTPG
Sbjct: 357 AYLASDSEES---EGENEEVKNKLKSLVGLSMKIGDKSIMDNKSDNEDGEVDMEITFTPG 413

Query: 409 L----DDSKPQADEDHEETTIEKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGKNK 464
           L    ++ K + +E+     + +                                + ++K
Sbjct: 414 LAENDNNDKEEENEETTIEKVRRKEKERRKARKQKLKEIKQNSEQEKREKLKSLKTERSK 473

Query: 465 KQVEDESDAKSKAXXXXXXXXXXXXTEKS-LNKKAHFNMNEILXXXXXXXXXXXXXXXXX 523
           K  + ESD  +KA               S +NKKAHFNM EIL                 
Sbjct: 474 KSEDTESDKNAKAELELLMMDEDEINGTSTINKKAHFNMKEILRSEKEKTKKSKFQNKEK 533

Query: 524 IMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRA-------HKK 576
           I+ED FK DLNDPRFNE+FE+ DFAIDP+Q EYK T AMKEIL+ERSKR+        +K
Sbjct: 534 IVEDNFKADLNDPRFNEMFEDHDFAIDPTQSEYKETAAMKEILKERSKRSTMKKANRSEK 593

Query: 577 RKPLADDGDSKDNKHDISNIV 597
           RK    DG  K    DISNIV
Sbjct: 594 RKISPSDGSQK----DISNIV 610

>KLTH0F16148g Chr6 (1310041..1311981) [1941 bp, 646 aa] {ON} similar
           to uniprot|Q06344 YDR365C Saccharomyces cerevisiae ESF1
           Nucleolar protein involved in pre-rRNA processing
          Length = 646

 Score =  488 bits (1257), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 281/601 (46%), Positives = 339/601 (56%), Gaps = 38/601 (6%)

Query: 9   GSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRITG-ESKDL 67
           GSSDPRFAG++NDPKFR  + K  K+KLDDRFSKKDL+ +RKA+VDKYGRR+ G ESKD 
Sbjct: 11  GSSDPRFAGVENDPKFRETRAKKFKIKLDDRFSKKDLEFKRKARVDKYGRRLKGQESKDK 70

Query: 68  KDFDKYFXXXXXXXXX-------------XXXXXXXXXXXXXXXXXVVDRARGELPEAYT 114
           +DFDKY+                                        +DRARGE+   Y 
Sbjct: 71  RDFDKYYEKEKSGKTAPDSELVGKPSEEDSEGGSSDEEGAASAKTVSLDRARGEVHSDYV 130

Query: 115 XXXXXXXXXXXXXXXXXXXXXXXXXXXKPE-----SGDPSKTLAVVNLDWDHVRAADLMI 169
                                      + E     SGD SKTLAVVNLDWDHV++ DLM+
Sbjct: 131 SSSDEESSSESEEDSADSDLESEESEVQIEEGEVKSGDSSKTLAVVNLDWDHVKSTDLMV 190

Query: 170 TFSSFLPSGGKIEKICIYPSEFGKERMQREEKEGPPREIFNXXXXXXXXX---XXXXVDI 226
           TFSSF+P GGKI ++ IYPSEFGKER+ +EE EGPPREIF                 + +
Sbjct: 191 TFSSFVPKGGKINRVAIYPSEFGKERLAKEETEGPPREIFKSKEKGKKSHGDDSDEELTV 250

Query: 227 RDLYEEGDADKEVDNXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYESTANIF 286
           +DLYEEGDAD + D                 +VYCNN +T ESIY NCDGTEYESTAN+F
Sbjct: 251 KDLYEEGDAD-DFDAKSLRRYQLERLRYYYAVVYCNNKQTAESIYKNCDGTEYESTANMF 309

Query: 287 DLRYVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAF 346
           DLRYVP+GM+FDDE +DEC  +PKNY+P EFSTDALQHS VK TWDETP DR  ++KRAF
Sbjct: 310 DLRYVPDGMDFDDEARDECDSVPKNYRPSEFSTDALQHSKVKFTWDETPADRTAMAKRAF 369

Query: 347 SQKELEDMDFQAYLASGTDESDGXXXXXXXXXXXLKSLVGQSLAYG---------KQQEE 397
           +Q+E+EDMDF+AYLAS  D  D            LKSLV QS+  G         K  E 
Sbjct: 370 TQREIEDMDFKAYLAS--DSEDSEPENNQELKNKLKSLVNQSVQVGEKSIFDQDPKDGES 427

Query: 398 EPDMEITFTPGL-DDSKPQAD--EDHEETTIEKVXXXXXXXXXXXXXXXXXXXXXXXXXX 454
           + DM+ITF P L +     AD  E  EETT+EKV                          
Sbjct: 428 DVDMQITFAPALAEGGSGDADDGEKTEETTLEKVRRKEKERKKMRKERIKELKKQAEDDK 487

Query: 455 XXXXXSGKNKKQVEDESDAKSKAXXXXXXXXXXXXTEKSLNKKAHFNMNEILXXXXXXXX 514
                  + K +    +D+KS+A                LNKKAHFNMNEI+        
Sbjct: 488 KQKLKEARRKPEPS-ATDSKSQAELELLMMDDSEEANSKLNKKAHFNMNEIVRSEKEKGK 546

Query: 515 XXXXXXXXXIMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRAH 574
                    I+EDEFKPDLNDPRF+EVFE+ DFAIDPSQPE+K T AMK+IL+ER+KR+ 
Sbjct: 547 KAKFQDKNRIVEDEFKPDLNDPRFSEVFEDHDFAIDPSQPEFKGTAAMKQILQERNKRSQ 606

Query: 575 K 575
           K
Sbjct: 607 K 607

>TBLA0A06540 Chr1 (1602559..1604538) [1980 bp, 659 aa] {ON}
           Anc_5.430 YDR365C
          Length = 659

 Score =  484 bits (1246), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 296/640 (46%), Positives = 355/640 (55%), Gaps = 57/640 (8%)

Query: 12  DPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRITGES-KDLKDF 70
           D RFAG+  DPKFR  KK  LKVKLD+RFSKKDL V  K+KVD+YGR+I   + KD KDF
Sbjct: 9   DARFAGVFTDPKFRRSKKDSLKVKLDNRFSKKDLQVNYKSKVDRYGRKIIDRNEKDKKDF 68

Query: 71  DKYFXXXXXXXXXXXXXXXXXXXXXXXXXXV----------------VDRARGELPEAYT 114
           DKY+                          V                +DRARG++P  Y 
Sbjct: 69  DKYYTKDEDEENKDEEQDKSDQEEESEEEDVDEKADDDEDVLAELARLDRARGDVPSDYV 128

Query: 115 XXXXXXXXXXXXXXXXX-----XXXXXXXXXXKPESGDPSKTLAVVNLDWDHVRAADLMI 169
                                           KPE+GDPSKT+AVVNLDWDHV++ DLMI
Sbjct: 129 SSSDDYSSSESESSGESEVDSDEESDAEIESAKPETGDPSKTVAVVNLDWDHVKSTDLMI 188

Query: 170 TFSSFLPSGGKIEKICIYPSEFGKERMQREEKEGPPREIFNXXXXXXXXXXX-------X 222
           TFS F+P GGKI KI IYPSEFGKERMQREE EGPP+E+F                    
Sbjct: 189 TFSGFIPKGGKINKIAIYPSEFGKERMQREEIEGPPKELFKKKNKKGKKSTAEDNEDDVS 248

Query: 223 XVDIRDLYEEGDADKEVDNXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYEST 282
            VDI DLYEEGDADK +D+                +VYCNN+ T ESIY NCDGTEYEST
Sbjct: 249 DVDINDLYEEGDADKNIDSKSLRQYQLERLRYYYAVVYCNNIGTAESIYKNCDGTEYEST 308

Query: 283 ANIFDLRYVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVS 342
           AN+FD+RYVP+ M FDD P+DEC +LPKNYKPL+FSTDALQHSNVKLTWDETP DR+E+S
Sbjct: 309 ANVFDIRYVPDEMTFDDTPRDECDQLPKNYKPLQFSTDALQHSNVKLTWDETPADRVEIS 368

Query: 343 KRAFSQKELEDMDFQAYLASGTDESDGXXXXXXXXXXXLKSLVGQSL---AYGKQQEEE- 398
           KRAFSQKE+++MDF+AYLAS +DES+            LKSLVG       +GK  E + 
Sbjct: 369 KRAFSQKEIDEMDFKAYLASDSDESES--ELNNDSKNKLKSLVGGGAFGNVFGKDTEYDL 426

Query: 399 --------PDMEITFTPGLDDSKPQADED--HEETTIEKVXXXXXXXXXXXXXXXXXXXX 448
                    DMEITFTPGLD+ K  +D +   EE+TIEK+                    
Sbjct: 427 DGSDDEDGVDMEITFTPGLDEKKEASDNETKKEESTIEKLQRKEKERRKLRKQKVKDLKE 486

Query: 449 XXXXXXXXXXXSGKNKKQV--------EDESDAKSKAXXXXXXXXXXXXTEKSLNKKAHF 500
                      S +N+ +         E E   KSKA                +N KAHF
Sbjct: 487 KSVQERKEKLNSNRNRNKKNNNELLKDEKEKQDKSKAELELLMMDEDDRI-SGVNNKAHF 545

Query: 501 NMNEILXXXXXXXXXXXXXXXXXIMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTK 560
           NMNEIL                 I++DEFKP+LND RF+E+FE+  FAIDP+QPE+K T 
Sbjct: 546 NMNEILRSEKEKGKKSKYQDKNKIVQDEFKPNLNDSRFDEIFEDHAFAIDPTQPEFKQTS 605

Query: 561 AMKEILEERSKRAH---KKRKPLADDGDSKDNKHDISNIV 597
           AMKEIL ER+KRA     K K      ++ ++K DISNIV
Sbjct: 606 AMKEILNERTKRASKKQNKDKDNKKRKNTNEDKSDISNIV 645

>Ecym_4790 Chr4 complement(1534067..1535959) [1893 bp, 630 aa] {ON}
           similar to Ashbya gossypii AER259W + AER260C
          Length = 630

 Score =  481 bits (1238), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 266/588 (45%), Positives = 340/588 (57%), Gaps = 21/588 (3%)

Query: 10  SSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI-TGESKDLK 68
           ++D RFAGI NDPKFR  K   LK+ LDDRFSKKDL+ +RKAKVDKYGRRI + + K+ K
Sbjct: 12  TNDSRFAGIHNDPKFRKPKVNKLKITLDDRFSKKDLEFKRKAKVDKYGRRIGSYDEKEAK 71

Query: 69  DFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXVVDRARGELPEAYTXXXXXXXXXXXXXX 128
           DFD+YF                           +DRARGE+P  Y               
Sbjct: 72  DFDRYF--SKNESVEKIQSDDEEGETEDIAVSALDRARGEVPLDYESSSDENSSSESEEE 129

Query: 129 XXXXX----XXXXXXXXKPESGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGKIEKI 184
                            KPE+GDP+K  AVVNLDWDHVR+ DL+ TF+SF+P+GG I+K+
Sbjct: 130 SEDSALDPDSELEIEESKPETGDPTKVFAVVNLDWDHVRSVDLLATFNSFVPNGGSIKKV 189

Query: 185 CIYPSEFGKERMQREEKEGPPREIFNXXXXXXXXXX---XXXVDIRDLYEEGDADKEVDN 241
            IYPSEFGKERM+REE EGPPRE+F                 +DI DLYE  DA+K+ D+
Sbjct: 190 AIYPSEFGKERMKREEVEGPPRELFKRKQSKKEKDSDDENSDIDINDLYEVDDAEKDYDS 249

Query: 242 XXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEFDDEP 301
                           +VYC++V T ++IY NCDGTE+ESTAN+FDLRYVP+ M+F+D+P
Sbjct: 250 KALRRYQLDRLRYYYAVVYCSDVLTAKAIYQNCDGTEFESTANMFDLRYVPDNMKFEDDP 309

Query: 302 KDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQAYLA 361
           +D+C  +PK+YKP +FST ALQHS VKLTWDETP DR+E+SKRAF+QKE+E+MDF+AYLA
Sbjct: 310 RDQCVSVPKDYKPTQFSTSALQHSQVKLTWDETPADRVEISKRAFNQKEIEEMDFKAYLA 369

Query: 362 SGTDESDGXXXXXXXXXXXLKSLVGQSLAYGKQ-------QEEEPDMEITFTPGLDDSKP 414
           S +D S+G           L+SLV  S+    +        EEE D+EITFTPGL++   
Sbjct: 370 SDSDSSEG--ETNEKTKNALRSLVNDSIQVAHKSVFDKHGSEEEADVEITFTPGLENGDA 427

Query: 415 QADEDHEETTIEKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGKNKKQVEDESDAK 474
             +E+ EET ++K+                                G +    E E + +
Sbjct: 428 PKEENEEETALDKIKRKEKERRKKRKERVKELKMQAIDEKKARRRKGDDGAVTEAEKELR 487

Query: 475 SKAXXXXXXXXXXXXTEK--SLNKKAHFNMNEILXXXXXXXXXXXXXXXXXIMEDEFKPD 532
            K             T K  +LN  AHFNMNEI+                 I++D FKPD
Sbjct: 488 KKKQAELELLMLEDETGKKSTLNNNAHFNMNEIIKSQKEKTKKSRYQNKNVIVDDNFKPD 547

Query: 533 LNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRAHKKRKPL 580
           LNDPRF EVFE+ DFAIDPSQPE+K T AMKEILEER++R+ K +K  
Sbjct: 548 LNDPRFKEVFEDHDFAIDPSQPEFKKTPAMKEILEERTRRSSKMKKAF 595

>Skud_4.635 Chr4 complement(1133271..1135160) [1890 bp, 629 aa] {ON}
           YDR365C (REAL)
          Length = 629

 Score =  479 bits (1234), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 288/611 (47%), Positives = 352/611 (57%), Gaps = 39/611 (6%)

Query: 1   MVEDRGSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI 60
           M  D+  K S D RFAGI +DPKF+N + +  K+KLD RFSKKDL+V+ K+KVDKYGR+I
Sbjct: 1   MAGDKSEKESIDARFAGISSDPKFKNTRTRDHKIKLDSRFSKKDLEVQHKSKVDKYGRKI 60

Query: 61  --TGESKDLKDFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXVVDRARGELPEAYTXXX- 117
                +K+L+DFDKYF                          VVDRARGE+P  Y     
Sbjct: 61  KDARNNKELEDFDKYF----------EKEAEHDEDSEVAAKIVVDRARGEVPSDYVSSSD 110

Query: 118 ----XXXXXXXXXXXXXXXXXXXXXXXXKPESGDPSKTLAVVNLDWDHVRAADLMITFSS 173
                                         ESGD SKTLAVVNLDWDHV++ DLMITFSS
Sbjct: 111 EFTSSDSESSGESEVESEVEGEVETEDVAAESGDVSKTLAVVNLDWDHVKSEDLMITFSS 170

Query: 174 FLPSGGKIEKICIYPSEFGKERMQREEKEGPPREIFNXXXXXXXXXXXXXV--------D 225
           F+P GGKIE+I I+PSEFG+ERM+REE EGPP+E+F              V         
Sbjct: 171 FVPRGGKIERIAIFPSEFGRERMEREEVEGPPKELFQKKNKNKHAKEKNSVGTDSDGDIG 230

Query: 226 IRDLYEEGDADKEVDNXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYESTANI 285
           I DLYEEGDADK+VD+                +V C++  + ++IY NCDGTEYESTAN+
Sbjct: 231 INDLYEEGDADKDVDSRALRQYQLDRLRYYYAVVCCSDTTSAKAIYDNCDGTEYESTANM 290

Query: 286 FDLRYVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRA 345
           FDLRYVP+GM FDD  +DEC  LPKNY+P +FSTDALQHSNVKLTWDETP DRLEV+KRA
Sbjct: 291 FDLRYVPDGMTFDDAARDECTSLPKNYRPHQFSTDALQHSNVKLTWDETPADRLEVAKRA 350

Query: 346 FSQKELEDMDFQAYLASGTDESDGXXXXXXXXXXXLKSLVG-------QSLAYGKQQEEE 398
           F+QKE++DMDF+AYLAS +DESD            LKSLVG       +  A   ++E E
Sbjct: 351 FTQKEIDDMDFKAYLASDSDESD--EQVDEDAKNKLKSLVGGLDFNMKKKGANDGKEEGE 408

Query: 399 PDMEITFTPGLDDSKPQADEDHEETTIEKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 458
            DMEITFTP L+    +  E  +ETTIEK+                              
Sbjct: 409 VDMEITFTPALEGENEKPIEGQDETTIEKIRRKEKERRKARKQKVKELKQQSEKDKKSKL 468

Query: 459 XSGKNKKQVEDE----SDAKSKAXXXXXXXXXXXXTEKSLNKKAHFNMNEILXXXXXXXX 514
            S  NKK V DE    ++AKSKA            TE S+N KAHF+M EIL        
Sbjct: 469 KSV-NKKHVADEEEIKNNAKSKAELELLMDEDDAETEGSMNSKAHFSMKEILRSEKEKHK 527

Query: 515 XXXXXXXXXIMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRAH 574
                    I+ED F PDL DPRF EVFE+ DFAIDP+QPEYK+T+AM  IL+ER KR  
Sbjct: 528 RGRYQKKERIVEDTFAPDLEDPRFKEVFEDHDFAIDPTQPEYKNTQAMSTILKERGKRVK 587

Query: 575 KKRKPLADDGD 585
            K++  +D+G+
Sbjct: 588 DKKRKHSDNGN 598

>Kwal_55.21444 s55 (839767..841701) [1935 bp, 644 aa] {ON} YDR365C -
           Protein required for cell viability [contig 130] FULL
          Length = 644

 Score =  476 bits (1226), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 287/605 (47%), Positives = 346/605 (57%), Gaps = 39/605 (6%)

Query: 6   GSKGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRITG-ES 64
           G + SSDPRFA + +DPKFR  K K  K+KLDDRFSKKDL  +RKA+VDKYGR + G E+
Sbjct: 8   GKEESSDPRFANVHSDPKFRETKAKKFKIKLDDRFSKKDLQFKRKARVDKYGRSLKGQEN 67

Query: 65  KDLKDFDKYF---------------XXXXXXXXXXXXXXXXXXXXXXXXXXVVDRARGEL 109
           KD KDFDKY+                                          +DRARGE+
Sbjct: 68  KDKKDFDKYYEKDDKKKEDKVKPDDEEKSDSEAESANEAKDIGDSAAVKPVSLDRARGEV 127

Query: 110 PEAYTXXXXXXXXXXXXXXXXXXXXXXXXXX-----XKPESGDPSKTLAVVNLDWDHVRA 164
           P  Y                                 KP+SGD SKTLAVVNLDWDHV++
Sbjct: 128 PSDYVSSSEDESSSESEAGSEDSDIESEESEVEIEDTKPQSGDSSKTLAVVNLDWDHVKS 187

Query: 165 ADLMITFSSFLPSGGKIEKICIYPSEFGKERMQREEKEGPPREIFNXXXXXXXXXXXXXV 224
            DLMITFSSF+PSGGKI KI +YPSEFGKER++REE EGPPREIF               
Sbjct: 188 TDLMITFSSFVPSGGKIIKIAVYPSEFGKERLKREEMEGPPREIFKSKNSKKKSHDDDSD 247

Query: 225 DIRD---LYEEGDADKEVDNXXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYES 281
              D   LYEEGDA+ + D                 +VYCNNV T E+IY NCDGTE+ES
Sbjct: 248 SDVDVRDLYEEGDAE-DYDAKSLRRYQLDRLRYFYAVVYCNNVATAEAIYKNCDGTEFES 306

Query: 282 TANIFDLRYVPEGMEFDDEPKDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEV 341
           TAN+FDLRYVP+GM FDDE +DEC  +PKNY+P +FSTDALQHS VKLTWDETP DR+ +
Sbjct: 307 TANMFDLRYVPDGMTFDDEARDECTSIPKNYQPSQFSTDALQHSKVKLTWDETPADRVAM 366

Query: 342 SKRAFSQKELEDMDFQAYLASGTDESDGXXXXXXXXXXXLKSLVGQSLAYG--------- 392
           SKRAF+QKE+EDMDF+AYLAS ++ES+            LKSLV QS+  G         
Sbjct: 367 SKRAFTQKEIEDMDFKAYLASDSEESE--PENNQDLKTKLKSLVSQSVKVGDKSIFDQAP 424

Query: 393 KQQEEEPDMEITFTPGL-DDSKPQADEDHEETTIEKVXXXXXXXXXXXXXXXXXXXXXXX 451
           ++ E + DM+ITF PGL + ++    E+ EETT+EK+                       
Sbjct: 425 EEGESDVDMQITFAPGLAEGAEDDKQENAEETTLEKLKRKEKERKKMRKERIKELKKQAE 484

Query: 452 XXXXXXXXSGKNKKQVEDESDAKSKAXXXXXXXXXXXXTEKS-LNKKAHFNMNEILXXXX 510
                     + K +   E DAKSKA               S LNKKAHFNMNEI+    
Sbjct: 485 EEKKQKRKESRYKPESTVE-DAKSKAELELLMMDDDENNSSSKLNKKAHFNMNEIVRSEK 543

Query: 511 XXXXXXXXXXXXXIMEDEFKPDLNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERS 570
                        I+EDEFKPDLNDPRF EVFE++DFAIDPSQPE+K T AMK+IL+ER+
Sbjct: 544 EKGKKSRYQNKDKIVEDEFKPDLNDPRFAEVFEDRDFAIDPSQPEFKGTAAMKQILQERT 603

Query: 571 KRAHK 575
           KR+HK
Sbjct: 604 KRSHK 608

>AER259W Chr5 (1113896..1115755) [1860 bp, 619 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR365C (ESF1)
          Length = 619

 Score =  397 bits (1021), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 213/415 (51%), Positives = 263/415 (63%), Gaps = 20/415 (4%)

Query: 8   KGSSDPRFAGIQNDPKFRNFKKKGLKVKLDDRFSKKDLDVRRKAKVDKYGRRI-TGESKD 66
           K S D RFA I++DPKFR  K+K LK+KLDDRFSK+DL+ +RKAKVDKYGRRI T   K+
Sbjct: 10  KDSIDKRFARIESDPKFRAPKQKNLKIKLDDRFSKQDLEYKRKAKVDKYGRRIGTAPGKE 69

Query: 67  LKDFDKYFXXXXXXXXXXXXXXXXXXXXXXXXXXVVDRARGELPEAYTXXXXXXXXXXXX 126
            KDF+KYF                           +DRARGE+P  Y             
Sbjct: 70  EKDFEKYFTKESSESAAEESDKEDSSVAK------LDRARGEVPADYVSSSDEESSSESE 123

Query: 127 XXXXXXXXXXXXXXXKPE----SGDPSKTLAVVNLDWDHVRAADLMITFSSFLPSGGKIE 182
                            E    SGDPSK LAVVNLDWDHV+ ADL++ F+SF+P GGKIE
Sbjct: 124 ADSDDATAESDEEVEIEEEKPESGDPSKVLAVVNLDWDHVKCADLLVAFNSFVPEGGKIE 183

Query: 183 KICIYPSEFGKERMQREEKEGPPREIFNXXXXXXXXXXXX-XVDIRDLYEEGDADKEVDN 241
           ++ IYPSEFGKERMQREE EGPPRE+F               + ++DLYE+GDA+K+ D+
Sbjct: 184 RVAIYPSEFGKERMQREEVEGPPREVFKSKKDKKAKQDDDDEIGLKDLYEQGDAEKDYDS 243

Query: 242 XXXXXXXXXXXXXXXXIVYCNNVETGESIYSNCDGTEYESTANIFDLRYVPEGMEFDDEP 301
                           +VYCNNV T E+IY NCDGTEYESTAN+FDLRYVPEG+ FDDEP
Sbjct: 244 KALRRYQLERLRYYYAVVYCNNVATAEAIYQNCDGTEYESTANMFDLRYVPEGVTFDDEP 303

Query: 302 KDECKELPKNYKPLEFSTDALQHSNVKLTWDETPTDRLEVSKRAFSQKELEDMDFQAYLA 361
           ++EC  +PK+YKP++FST ALQH  VKLTWDETP DR+E++KRAFSQKE+EDMDF+AYLA
Sbjct: 304 REECASVPKDYKPVQFSTSALQHLQVKLTWDETPADRVEMAKRAFSQKEIEDMDFKAYLA 363

Query: 362 SGTDESDGXXXXXXXXXXXLKSLVG------QSLAYGKQQEEEPDMEITFTPGLD 410
           S ++ES+            L+SLV       + L   +  EEE D++ITFTPGL+
Sbjct: 364 SDSEESEA--DDNSEAKNKLRSLVSSVKVADKPLFADESDEEEADVQITFTPGLE 416

>Skud_7.467 Chr7 (764555..766681) [2127 bp, 708 aa] {ON} YGR145W
           (REAL)
          Length = 708

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 34/63 (53%), Gaps = 1/63 (1%)

Query: 533 LNDPRFNEVFENQDFAIDPSQPEYKSTKAMKEILEERSKRAHKKRKPLADDGDSKDNKHD 592
           L D RF E+FEN++F +D +  ++K    +K  L E  + A K+ + L    DS + +  
Sbjct: 477 LTDDRFKEMFENEEFQVDETDYDFKQLNPVKS-LRETEEGAAKRIRALTAAEDSDEERIA 535

Query: 593 ISN 595
           + N
Sbjct: 536 MKN 538

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.131    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,459,628
Number of extensions: 2119104
Number of successful extensions: 5629
Number of sequences better than 10.0: 46
Number of HSP's gapped: 5650
Number of HSP's successfully gapped: 58
Length of query: 611
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 495
Effective length of database: 40,180,143
Effective search space: 19889170785
Effective search space used: 19889170785
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 69 (31.2 bits)