Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F09856g5.426ON1458145876590.0
TDEL0E019905.426ON1460146068600.0
NDAI0C016205.426ON1460146066930.0
NCAS0H020405.426ON1460146066920.0
Skud_15.2795.426ON1460146066730.0
SAKL0G02354g5.426ON1458145866710.0
YOR116C (RPO31)5.426ON1460146066680.0
Smik_15.2945.426ON1460146066630.0
KLTH0F16236g5.426ON1460146066310.0
Suva_8.1695.426ON1460146066270.0
KAFR0D050305.426ON1462146266040.0
Kpol_1016.95.426ON1460146065600.0
CAGL0L11660g5.426ON1459145864870.0
KLLA0E21253g5.426ON1457145864840.0
AER252C5.426ON1459145964770.0
TBLA0A037205.426ON1458145964770.0
Ecym_55255.426ON1459145964480.0
KNAG0B042405.426ON1455146064300.0
TPHA0H017605.426ON1459145363550.0
Kwal_55.214595.426ON1148114451750.0
ZYRO0F05918g7.314ON1744151118780.0
Ecym_80657.314ON1743149918680.0
KAFR0B010607.314ON1685151718480.0
SAKL0F10472g7.314ON1730149618430.0
KLLA0F05071g7.314ON1720149918350.0
KNAG0C039707.314ON1721151318350.0
YDL140C (RPO21)7.314ON1733152018300.0
Suva_4.1047.314ON1733151518300.0
Kwal_56.244897.314ON1728152618290.0
Smik_4.957.314ON1719152018280.0
KLTH0H02046g7.314ON1740151818240.0
NDAI0A021307.314ON1729150818150.0
CAGL0I03828g7.314ON1715151318120.0
NCAS0A139007.314ON1716151818130.0
Skud_4.1147.314ON1726152018100.0
TDEL0C023207.314ON1727149917790.0
TPHA0A030707.314ON1719152017410.0
Kpol_162.1singletonON1311117316150.0
Kwal_55.21464singletonOFF32031714150.0
ADR086C7.314ON174592814371e-170
TBLA0F021707.314ON172692414131e-167
YOR341W (RPA190)7.51ON166497411401e-130
Skud_15.5067.51ON166597411371e-129
CAGL0E05500g7.51ON164397811361e-129
KNAG0D049707.51ON167196111361e-129
Smik_15.5197.51ON166597711261e-128
Kwal_26.69797.51ON165497411251e-128
ZYRO0D04532g7.51ON166797511241e-128
KLTH0D01628g7.51ON165497411231e-127
NDAI0H012007.51ON166990711181e-127
Suva_8.3917.51ON166597311141e-126
TDEL0H040007.51ON166597411131e-126
NCAS0F007307.51ON167490611111e-126
KAFR0K005407.51ON166296211011e-124
TPHA0H028007.51ON1648105710991e-124
KLLA0F23243g7.51ON165398510941e-124
TBLA0E019307.51ON165997510911e-123
SAKL0B10736g7.51ON165097710711e-120
ADR374C7.51ON164097110571e-119
Kpol_1040.37.51ON16567279441e-104
Kpol_1019.277.314ON3641162029e-16
TPHA0N011606.144ON445192820.65
TPHA0H014405.359ON875128830.65
KLLA0E14477gsingletonON716167782.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F09856g
         (1458 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] ...  2954   0.0  
TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5....  2647   0.0  
NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5....  2582   0.0  
NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {...  2582   0.0  
Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] ...  2575   0.0  
SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] ...  2574   0.0  
YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}...  2573   0.0  
Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] ...  2571   0.0  
KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} hig...  2558   0.0  
Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {O...  2557   0.0  
KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {...  2548   0.0  
Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON} (19972....  2531   0.0  
CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} hi...  2503   0.0  
KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} hig...  2502   0.0  
AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON...  2499   0.0  
TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {...  2499   0.0  
Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {...  2488   0.0  
KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5....  2481   0.0  
TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {...  2452   0.0  
Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR11...  1998   0.0  
ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highl...   728   0.0  
Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar ...   724   0.0  
KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {...   716   0.0  
SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highl...   714   0.0  
KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] ...   711   0.0  
KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {...   711   0.0  
YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON} ...   709   0.0  
Suva_4.104 Chr4 complement(193257..193711,193754..193782,194161....   709   0.0  
Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL...   709   0.0  
Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON...   708   0.0  
KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] ...   707   0.0  
NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {...   703   0.0  
CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] ...   702   0.0  
NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_...   702   0.0  
Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {O...   701   0.0  
TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {...   689   0.0  
TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {...   675   0.0  
Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON} co...   626   0.0  
Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116...   549   0.0  
ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON} ...   558   e-170
TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7....   548   e-167
YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RN...   443   e-130
Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR34...   442   e-129
CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highl...   442   e-129
KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7....   442   e-129
Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR34...   438   e-128
Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {...   437   e-128
ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highl...   437   e-128
KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] ...   437   e-127
NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {...   435   e-127
Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W...   433   e-126
TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7....   433   e-126
NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {...   432   e-126
KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] ...   428   e-124
TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7....   427   e-124
KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} hig...   426   e-124
TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7....   424   e-123
SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highl...   417   e-120
ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON...   411   e-119
Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON...   368   e-104
Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {O...    82   9e-16
TPHA0N01160 Chr14 complement(245187..246524) [1338 bp, 445 aa] {...    36   0.65 
TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {O...    37   0.65 
KLLA0E14477g Chr5 complement(1281791..1283941) [2151 bp, 716 aa]...    35   2.3  

>ZYRO0F09856g Chr6 complement(798821..803197) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2954 bits (7659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1430/1458 (98%), Positives = 1430/1458 (98%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV
Sbjct: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK
Sbjct: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQC                   KIIH
Sbjct: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE
Sbjct: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK
Sbjct: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQG 360
            AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQG
Sbjct: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQG 360

Query: 361  RFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVN 420
            RFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVN
Sbjct: 361  RFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVN 420

Query: 421  GPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHR 480
            GPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHR
Sbjct: 421  GPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHR 480

Query: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLL 540
            LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLL
Sbjct: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLL 540

Query: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKPCY 600
            TPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKPCY
Sbjct: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKPCY 600

Query: 601  LWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILSG 660
            LWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILSG
Sbjct: 601  LWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILSG 660

Query: 661  VMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAXX 720
            VMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA  
Sbjct: 661  VMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAEE 720

Query: 721  XXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
                   MVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI
Sbjct: 721  LKEKKEEMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780

Query: 781  NELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTP 840
            NELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTP
Sbjct: 781  NELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTP 840

Query: 841  QSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDN 900
            QSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDN
Sbjct: 841  QSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDN 900

Query: 901  TVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQV 960
            TVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQV
Sbjct: 901  TVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQV 960

Query: 961  TEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKF 1020
            TEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKF
Sbjct: 961  TEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKF 1020

Query: 1021 RGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAK 1080
            RGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAK
Sbjct: 1021 RGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAK 1080

Query: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140
            VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN
Sbjct: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140

Query: 1141 AVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELTI 1200
            AVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELTI
Sbjct: 1141 AVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELTI 1200

Query: 1201 EDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQQ 1260
            EDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQQ
Sbjct: 1201 EDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQQ 1260

Query: 1261 LRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHILEV 1320
            LRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHILEV
Sbjct: 1261 LRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHILEV 1320

Query: 1321 YSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDS 1380
            YSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDS
Sbjct: 1321 YSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDS 1380

Query: 1381 VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQLK 1440
            VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQLK
Sbjct: 1381 VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQLK 1440

Query: 1441 PKPTLFESLVNETSVKVN 1458
            PKPTLFESLVNETSVKVN
Sbjct: 1441 PKPTLFESLVNETSVKVN 1458

>TDEL0E01990 Chr5 (373218..377600) [4383 bp, 1460 aa] {ON} Anc_5.426
            YOR116C
          Length = 1460

 Score = 2647 bits (6860), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1260/1460 (86%), Positives = 1358/1460 (93%), Gaps = 2/1460 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV S  PK+ISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAP+ GGALDPKMGV
Sbjct: 1    MKEVVVSATPKRISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPRAGGALDPKMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSSS+EC TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQGICK CS++LL+D D+
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSAVLLDDHDR 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            +HFLSELRRPGVDNLRRMGIL KVLDQCKKQRRCLQC                   KIIH
Sbjct: 121  RHFLSELRRPGVDNLRRMGILSKVLDQCKKQRRCLQCGALNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRWAGKKSVPEK+KW+GDWD VL+H+PELERYVKRCMDDLNPLKTLNLFKQ+KPEDCE
Sbjct: 181  DTFRWAGKKSVPEKDKWVGDWDEVLSHNPELERYVKRCMDDLNPLKTLNLFKQLKPEDCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGIDS+ KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSSNKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKGK 358
            +GLEKGISINNMMEHWDYLQL+VAMYINSDSVNPA++ G +  GGKVKPIRGFCQRLKGK
Sbjct: 301  SGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPAMMPGASSGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLTYPE+VTRYN+ KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRQKLQQLL 420

Query: 419  VNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSL 478
            +NGPN +PGANYLLKKDEDARRNLR+GDRVKLAKNLR+GD+VERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKDEDARRNLRYGDRVKLAKNLRVGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+N
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD+  +TQLLSMMSDG LQFDIP P I KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRGSLTQLLSMMSDGNLQFDIPAPAIMKP 600

Query: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658
            CYLWTGKQ+FSLLI+PNKKSPVV+NLDAKNKV+IPPKSKSLP+EMSQNDG+V+IRGS+IL
Sbjct: 601  CYLWTGKQVFSLLIKPNKKSPVVINLDAKNKVFIPPKSKSLPSEMSQNDGYVIIRGSEIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718
            SGVMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRMAKLCARY+GNRGFSIGISDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 719  XXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
                     MVE AYAKCDELID ++KGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKKKKEDMVEFAYAKCDELIDSYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838
            CINELDN+NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898
            TPQSKGFVRNSFFSGLTPPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958
            DNTVRTSSNGIVQFTYGGDGLDP+EMEGNAQPVNF R+W+HA NVTFNN +RGL PYQI 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAQPVNFVRSWNHAFNVTFNNTERGLFPYQIE 960

Query: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018
            + T++IL PL NRL+RYDN+G  + KE    IEYIDQNDAER FY SL+ F+  KA+LLA
Sbjct: 961  EETDKILAPLMNRLIRYDNVGKLVPKEKDALIEYIDQNDAERNFYLSLKSFMRGKAELLA 1020

Query: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078
              R  + MKEL+DEP  E +++D DE+VPE+IRHSVDQ+ RIT   VREFL++AI KYRR
Sbjct: 1021 SVRKQRGMKELLDEPGPEFKNIDFDEDVPENIRHSVDQLCRITGDSVREFLKIAISKYRR 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198
            INAVLVN++DERAARVVKGRIEKTLLSDVAFYIQDVY+DNLS++QVR+DL+TIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRIEKTLLSDVAFYIQDVYQDNLSFMQVRIDLNTIDKLQLEL 1200

Query: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258
            TIEDIAVA+TRAPKLKIQASDV I+ KDKIAINVFP+G KAKSIST AKEP EN+VF+RM
Sbjct: 1201 TIEDIAVAITRAPKLKIQASDVTILDKDKIAINVFPEGYKAKSISTSAKEPHENDVFFRM 1260

Query: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318
            QQLRR+LPGIVVKGL DISRAVIN+RDD KRELLVEGYGLRDVMSTDGVVGHKT TNHIL
Sbjct: 1261 QQLRRSLPGIVVKGLPDISRAVINVRDDTKRELLVEGYGLRDVMSTDGVVGHKTATNHIL 1320

Query: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378
            EV+SVLGIEAARASI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438
            DSVLQLASFEKTTDHLFDAAFYMK+DAVEGVSECIILGQTM+IGTGAFKV+KGT++ E+ 
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKRDAVEGVSECIILGQTMSIGTGAFKVIKGTDLHEQD 1440

Query: 1439 LKPKPTLFESLVNETSVKVN 1458
            L+PKPTLFESL  ET++K N
Sbjct: 1441 LRPKPTLFESLSKETAIKAN 1460

>NDAI0C01620 Chr3 (346478..350860) [4383 bp, 1460 aa] {ON} Anc_5.426
          Length = 1460

 Score = 2582 bits (6693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1226/1460 (83%), Positives = 1340/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV SE PK+ISGLEFSALSAADIVAQSEVEIS+RDLFDLE GR PKTGGALD +MGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEVEISSRDLFDLEKGREPKTGGALDKRMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSSS+EC+TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQGICK CS+ILL D D+
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSDKDR 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            + FL+ELRRPGVDNLRRMGILKKVLDQCKKQRRCLQC                   KIIH
Sbjct: 121  RQFLNELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGSASLKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            D FRW GKKS PEK+KW+GDW  VL+H PELER+VKRC DDLNPLKTLNLFKQ+KPEDCE
Sbjct: 181  DNFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFVKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLG++ST+KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGVNSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKGK 358
            AGLEKGISINNMMEHWDYLQL VAMYINSDSVNPA+L G +  GGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLT+PE+VTRYN+ KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNRQKLQQLI 420

Query: 419  VNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSL 478
            +NGPN +PGANYLLK +EDARRNLR+GDRVKLAKNL+ GD+VERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKNNEDARRNLRYGDRVKLAKNLQFGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+N
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD+  +TQLLSMM D  LQFDIPPP I KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMCDANLQFDIPPPAIMKP 600

Query: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658
             YLWTGKQ+FSLLI+PNK SPVV+NLDAKNKVYIPPK+K+ PNEMS+NDG+V+IRGSQIL
Sbjct: 601  HYLWTGKQLFSLLIKPNKDSPVVINLDAKNKVYIPPKTKAYPNEMSRNDGYVIIRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718
            SGVMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRMAKLCAR++GNRGFSIGISDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGISDVTPA 720

Query: 719  XXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
                     +VE AYAKCDELID F+KGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838
            CINELDN+NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898
            TPQSKGFVRNSFFSGLTPPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958
            DNTVRTSSNGIVQFTYGGDGLDP+EMEGNA+PVNFNR+WDHATN+TF+    GLLPYQIM
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHATNITFSPDQHGLLPYQIM 960

Query: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018
            + T  IL+PLE+RL+RYDNLG  +  E+  + EY+DQ DAER FY SLRD++  KA++L 
Sbjct: 961  ETTNAILKPLEDRLIRYDNLGEIVPNEDSTKAEYVDQFDAERDFYKSLRDYMDEKAKVLG 1020

Query: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078
              R S+ M  ++DEPA EL+ ++ DE VPE IR+SVDQ+Y+IT+ +V++FL +A+ KYR+
Sbjct: 1021 SVRKSRGMLPMVDEPAEELKKMNPDEQVPETIRYSVDQLYKITEDLVKKFLEIALYKYRK 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198
            INAVLVNE+DERAARVVKGRIEKTLLSDVA+YIQDVY+DNLS++QVR+DL+TI+KLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDVYKDNLSFIQVRIDLNTIEKLQLEL 1200

Query: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258
            TIEDIAVA+TRAPKLKI  SDV+I+GKDKIAINVFP+G KAKSIST AKEP+EN VFYRM
Sbjct: 1201 TIEDIAVALTRAPKLKILTSDVNIIGKDKIAINVFPEGYKAKSISTAAKEPTENAVFYRM 1260

Query: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318
            Q LRRALP IVVKGL +I+RAVINIRDDGKRELLVEGYGLRDVM TDGV+G KT TNHIL
Sbjct: 1261 QHLRRALPSIVVKGLPEIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378
            EV +VLGIEAAR+SIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVNTVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKVVKGT +++E 
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTEIAKES 1440

Query: 1439 LKPKPTLFESLVNETSVKVN 1458
            LKPKPTLFE+L +  S+K+N
Sbjct: 1441 LKPKPTLFENLTSSRSIKMN 1460

>NCAS0H02040 Chr8 complement(393711..398093) [4383 bp, 1460 aa] {ON}
            Anc_5.426
          Length = 1460

 Score = 2582 bits (6692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1225/1460 (83%), Positives = 1338/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV SE PK+ISGLEFSALSAADIVAQSE+E+S+RDLFDLE GR PK GGALD KMGV
Sbjct: 1    MKEVVVSENPKRISGLEFSALSAADIVAQSEIEVSSRDLFDLEKGREPKIGGALDRKMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSSS+EC+TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQG+CK CS+ILL D DK
Sbjct: 61   SSSSLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKTCSAILLNDQDK 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            + FL+ELRRPGVDNLRRMGILKKVLDQCKKQRRCLQC                   KIIH
Sbjct: 121  RQFLTELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCGALNGVVKKAAAGAGPASLKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKKS PEK+KW+GDW  VL+H PELER++KRC DDLNPLKTLNLFKQ+KPEDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKEVLSHHPELERFMKRCSDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGIDST+KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKGK 358
            AGLEKGISINNMMEHWDYLQL VAMYINSDSVNPA+L G +  GGKVKPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLT+PE+VTRYNK KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKQKLQQLI 420

Query: 419  VNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSL 478
            +NGPN +PGANYLLKK+EDARRNLR+GDR+KLAKNL+ GD+VERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPNVHPGANYLLKKNEDARRNLRYGDRIKLAKNLQHGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSN 538
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+N
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD+  +TQLLSMMS+G L+FDIPPP I KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSNGTLRFDIPPPAIMKP 600

Query: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658
             Y+WTGKQ+FSLLIRPNK+SPVV+NLDAKNKV++PPK K  PNEMS+NDG+V+IRGS IL
Sbjct: 601  YYMWTGKQVFSLLIRPNKESPVVINLDAKNKVFMPPKYKDYPNEMSRNDGYVVIRGSNIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718
            SGVMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRM+KLCARY+GNRGFSIGISDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARYLGNRGFSIGISDVTPA 720

Query: 719  XXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
                     +VE AYAKCDELID F KGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYAKCDELIDQFHKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838
            CINELDN+NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898
            TPQSKGFVRNSFFSGLTPPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958
            DNTVRTSSNGIVQFTYGGDGLDP+EMEGNA+PVNFNR+WDHA N+TF+N+++GLLPY+IM
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPMEMEGNAKPVNFNRSWDHAINITFSNLEKGLLPYEIM 960

Query: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018
            + T EIL+PLE RL+RYDN+G  + K++ ++ EY+DQ DAER FY SLRD+I  KA +LA
Sbjct: 961  EKTNEILKPLEERLIRYDNVGELVPKKDNEKAEYVDQFDAERDFYRSLRDYIQEKADILA 1020

Query: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078
            + R S+ M E+  EP  EL+ +D DE + E I+HSVDQ+Y+IT+K V+ FL +A+ KYR+
Sbjct: 1021 RVRKSRGMLEMSSEPGEELRKLDPDERITESIKHSVDQLYKITEKSVQTFLEIALYKYRK 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198
            INAVLVNE+DERAARVVKGRIEKTLLSD+A+YIQDVY+DNLS++QVRVDL TI+KLQLEL
Sbjct: 1141 INAVLVNENDERAARVVKGRIEKTLLSDIAYYIQDVYKDNLSFIQVRVDLGTIEKLQLEL 1200

Query: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258
            TIEDIAVA+T+APKLKIQ SDV+I+GKDKIAINV+PDG KAKSIST+AKEPS N VFYRM
Sbjct: 1201 TIEDIAVAITKAPKLKIQTSDVNILGKDKIAINVYPDGYKAKSISTMAKEPSNNAVFYRM 1260

Query: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318
            Q LRR LP IVVKG  DISRAVINIRDDGKRELLVEGYGLRDVM TDGV+G KT TNHIL
Sbjct: 1261 QHLRRVLPSIVVKGFGDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGMKTTTNHIL 1320

Query: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378
            EV +VLGIEAAR+SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR
Sbjct: 1321 EVNNVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKVVKGTN+SE  
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEAD 1440

Query: 1439 LKPKPTLFESLVNETSVKVN 1458
            LKPKPTLFE L N  + K+N
Sbjct: 1441 LKPKPTLFEKLSNCGTHKLN 1460

>Skud_15.279 Chr15 complement(496216..500598) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2575 bits (6673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1219/1460 (83%), Positives = 1334/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV SE PK+I GLEFSALSAADIVAQSEVE+STRDLFDLE  RAPK  GALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSS++EC TCHGNLASCHGHFGH+KLALPVFHIGYFKATIQILQGICK CS++LL +TDK
Sbjct: 61   SSSTLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAVLLSETDK 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            +HFL ELRRPGVDNLRRMGILKK+LDQCKKQRRCL C                   KIIH
Sbjct: 121  RHFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKKS PEK+ W+G+W  VL H+PELERYVKRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGID+TI SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDATIPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKGK 358
            AGL+KGISINNMMEHWDYLQL VAMYINSDSVNPA+L G +  GGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLTYPE+VTRYN+ KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRLKLQELI 420

Query: 419  VNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSL 478
            VNGPN +PGANYLLK++EDARRNLR+GDR+KLAKNL+IGD+VERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+N
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D+  +TQLLSMMSDG  QFD+PPP I KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDVPPPAIMKP 600

Query: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658
             YLWTGKQ+FSLLI+PN  SPVV+NLDAKNKV++PPKSKSLP+EMSQNDGFV+IRGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVIIRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718
            SGVMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRMAKLCAR++GNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 719  XXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
                     +VE AY KCDELI LF+KG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITLFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898
            TPQSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNFNR+WDHA N+TFNN D GLLPY IM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNEDEGLLPYAIM 960

Query: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018
            +   EIL+PLE RLVRYDN G+ + +E++DR EY+DQ DAER FY SLR++I  KA  LA
Sbjct: 961  KTANEILRPLEERLVRYDNRGSLVKEEDKDRAEYVDQYDAERDFYRSLREYINLKATALA 1020

Query: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078
              R S+ M E ++ P  EL+ +DLDE VP+++R SV Q+YRI++K VR+FL +A+ KYR+
Sbjct: 1021 NLRKSRGMFEQLEPPEKELEGIDLDEAVPDNVRTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKSISTPI 1140

Query: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198
            INAVLVN++DERAARVVKGR+EKTLLSDVA+Y+QDVY+DNLS++QVR+DLSTIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLSTIDKLQLEL 1200

Query: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258
            TIEDIA+A+TRA KLKIQASDV+I+GKD+IAINVFP+G KAKSIST AKEPSEN+VFYRM
Sbjct: 1201 TIEDIAIAITRASKLKIQASDVNIIGKDQIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318
            QQLRRALP +VVKGL DISRAVINIRDD KRELLVEGYGLRDVM TDGV+G KT TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDAKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378
            EV+SVLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKVVKGTN+SE+ 
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1439 LKPKPTLFESLVNETSVKVN 1458
            L PKP LFESL NE ++K N
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>SAKL0G02354g Chr7 complement(193623..197999) [4377 bp, 1458 aa] {ON}
            highly similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1458

 Score = 2574 bits (6671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1223/1458 (83%), Positives = 1327/1458 (91%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV   APKKI GLEFSALSA+DIVAQSEVEISTRDLFDLENGR PK GGALD KMGV
Sbjct: 1    MKEVVVDIAPKKIKGLEFSALSASDIVAQSEVEISTRDLFDLENGRTPKVGGALDTKMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSS  EC TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQG+CK C+SILL D DK
Sbjct: 61   SSSHAECSTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGVCKNCASILLSDDDK 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            + FL+ELRRPGVDNLRRMG LKK+LDQCKKQRRCL C                   KIIH
Sbjct: 121  RQFLAELRRPGVDNLRRMGTLKKILDQCKKQRRCLHCGMLNGVVKKAAAGSGSASLKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKKS PEKEKW+GDW  VL H+PELERY+KRCMDDLNPLKTLNLFKQVKPEDCE
Sbjct: 181  DTFRWVGKKSAPEKEKWVGDWKQVLEHNPELERYMKRCMDDLNPLKTLNLFKQVKPEDCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGIDS +KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSAVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQG 360
            AGLEKGISINNMME WDYLQLAVAMYINSDSVNPA++ G +GGK KPIRGFCQRLKGKQG
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGASGGKTKPIRGFCQRLKGKQG 360

Query: 361  RFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVN 420
            RFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLTYPE+VTRYNK KLQQLV+N
Sbjct: 361  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNKHKLQQLVIN 420

Query: 421  GPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHR 480
            GPN +PGANYLLKK++DARRNLR+GDR+KLAKNL+ GD+VERH+EDGDVVLFNRQPSLHR
Sbjct: 421  GPNIHPGANYLLKKNDDARRNLRYGDRMKLAKNLQYGDVVERHIEDGDVVLFNRQPSLHR 480

Query: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLL 540
            LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+NLL
Sbjct: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540

Query: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKPCY 600
            TPKSGEPIIAATQDFITGSYLISHKDSFFD+  +TQLLSMMSDG +QFD+PPP + KP Y
Sbjct: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDGNMQFDLPPPAVMKPHY 600

Query: 601  LWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILSG 660
            LWTGKQ+FSLLIRPNKKSPV++N+DAKNKV++PPK K LPNEMS NDGFV+IRGS+ILSG
Sbjct: 601  LWTGKQVFSLLIRPNKKSPVIINVDAKNKVFMPPKHKGLPNEMSVNDGFVVIRGSEILSG 660

Query: 661  VMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAXX 720
            VMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRMAKLCARY+GNRGFSIGISDVTP   
Sbjct: 661  VMDKSVLGDGKKHSVFYTILRDYGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPGAD 720

Query: 721  XXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
                    VE AYAKCDELID F+KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI
Sbjct: 721  LKQKKEDKVEEAYAKCDELIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780

Query: 781  NELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTP 840
             ELDN+NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSKTP
Sbjct: 781  RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840

Query: 841  QSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDN 900
            QSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC YDN
Sbjct: 841  QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900

Query: 901  TVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQV 960
            TVRTSSNGIVQFTYGGDGLDPL+MEGNAQPVNFNR+WDHA N+TF + D GLLPYQI++ 
Sbjct: 901  TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWDHANNITFTHKDFGLLPYQIIEN 960

Query: 961  TEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKF 1020
            T  IL+PLE +LVR+DNLGN++ KE+ ++IEYIDQ+DAER FY SLRD++  KA  LAK 
Sbjct: 961  TNSILKPLEQKLVRFDNLGNKLNKEDEEKIEYIDQHDAERNFYQSLRDYMTEKATHLAKI 1020

Query: 1021 RGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAK 1080
            R +K +K L+DEPA EL+ ++LDE  PE I  +V+Q+ +I+  +V  FL +AI KY RAK
Sbjct: 1021 RKAKGLKTLLDEPAPELKILNLDEQYPEYILTAVNQLCKISKNLVETFLGIAISKYHRAK 1080

Query: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140
            VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN
Sbjct: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140

Query: 1141 AVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELTI 1200
            AVLVN+ DERAARVVKGRIEKT+LSDV +YIQDVY+DNLS++Q +VDL TI+KLQLELTI
Sbjct: 1141 AVLVNDGDERAARVVKGRIEKTILSDVVYYIQDVYKDNLSFIQAKVDLGTIEKLQLELTI 1200

Query: 1201 EDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQQ 1260
            EDIAVA+TRA KLKI  +DV IVG++KI INVFP+G KAKSIST AKEPSEN VFYRMQ 
Sbjct: 1201 EDIAVAITRASKLKISTADVSIVGRNKININVFPEGYKAKSISTSAKEPSENAVFYRMQH 1260

Query: 1261 LRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHILEV 1320
            LRRALPGIVVKGL DISRAVINIRDDGKRELLVEGYGLRDVM+TDGV+G KT TNHILE+
Sbjct: 1261 LRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILEI 1320

Query: 1321 YSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDS 1380
            ++VLGIEAAR SIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMRDS
Sbjct: 1321 FNVLGIEAARTSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRDS 1380

Query: 1381 VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQLK 1440
            VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKVVKGT++SEE LK
Sbjct: 1381 VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTSISEEDLK 1440

Query: 1441 PKPTLFESLVNETSVKVN 1458
            PK TLFESL N+ ++K +
Sbjct: 1441 PKHTLFESLCNDVALKTH 1458

>YOR116C Chr15 complement(539763..544145) [4383 bp, 1460 aa] {ON}
            RPO31RNA polymerase III largest subunit C160, part of
            core enzyme; similar to bacterial beta-prime subunit and
            to RPA190 and RPO21
          Length = 1460

 Score = 2573 bits (6668), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1222/1460 (83%), Positives = 1333/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV SE PK+I GLEFSALSAADIVAQSEVE+STRDLFDLE  RAPK  GALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSSS+EC TCHGNLASCHGHFGH+KLALPVFHIGYFKATIQILQGICK CS+ILL +TDK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            + FL ELRRPGVDNLRRMGILKK+LDQCKKQRRCL C                   KIIH
Sbjct: 121  RQFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKKS PEK+ W+G+W  VLAH+PELERYVKRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLAHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGID+T+ SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKGK 358
            AGL+KGISINNMMEHWDYLQL VAMYINSDSVNPA+L G +  GGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLTYPE+VTRYN+ KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 419  VNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSL 478
            VNGPN +PGANYLLK++EDARRNLR+GDR+KLAKNL+IGD+VERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRMKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+N
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D+  +TQLLSMMSDG   FDIPPP I KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEHFDIPPPAIMKP 600

Query: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658
             YLWTGKQ+FSLLI+PN  SPVV+NLDAKNKV++PPKSKSLPNEMSQNDGFV+IRGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718
            SGVMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRMAKLCAR++GNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 719  XXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
                     +VE AY KCDELI LF+KG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYHKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898
            TPQSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNFNR+WDHA N+TFNN D+GLLPY IM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDKGLLPYAIM 960

Query: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018
            +   EIL PLE RLVRYDN G  + +E+ ++ EY+DQ DAER FYHSLR++I  KA  LA
Sbjct: 961  ETANEILGPLEERLVRYDNSGCLVKREDLNKAEYVDQYDAERDFYHSLREYINGKATALA 1020

Query: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078
              R S+ M  L++ PA ELQ +D DE VP++++ SV Q+YRI++K VR+FL +A+ KYR+
Sbjct: 1021 NLRKSRGMLGLLEPPAKELQGIDPDETVPDNVKTSVSQLYRISEKSVRKFLEIALFKYRK 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198
            INAVLVN++DERAARVVKGR+EKTLLSDVAFY+QDVY+DNLS++QVR+DL TIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAFYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258
            TIEDIAVA+TRA KLKIQASDV+I+GKD+IAINVFP+G KAKSIST AKEPSEN+VFYRM
Sbjct: 1201 TIEDIAVAITRASKLKIQASDVNIIGKDRIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318
            QQLRRALP +VVKGL DISRAVINIRDDGKRELLVEGYGLRDVM TDGV+G +T TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378
            EV+SVLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKVVKGTN+SE+ 
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISEKD 1440

Query: 1439 LKPKPTLFESLVNETSVKVN 1458
            L PK  LFESL NE ++K N
Sbjct: 1441 LVPKRCLFESLSNEAALKAN 1460

>Smik_15.294 Chr15 complement(500962..505344) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2571 bits (6663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1220/1460 (83%), Positives = 1334/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV SE PK+I GLEFSALSAADIVAQSEVE+STRDLFDLE  RAPK  GALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPKANGALDPKMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSSS+EC TCHGNLASCHGHFGH+KLALPVFHIGYFKATIQILQGICK CS+ILL +TDK
Sbjct: 61   SSSSLECATCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            +HFL ELRRPGVDNLRRMGILKK+LDQCKKQRRCL C                   KIIH
Sbjct: 121  RHFLQELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKKS PEK+ W+G+W  VL H+PELERYVKRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGID+T+ SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKGK 358
            AGL+KGISINNMMEHWDYLQL VAMYINSDSVNPA+L G +  GGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLTYPE+VTRYN+ KLQ+L+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELI 420

Query: 419  VNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSL 478
            VNGPN +PGANYLLK++EDARRNLR+GDR+KLAKNL+IGD+VERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKRNEDARRNLRYGDRLKLAKNLQIGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+N
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D+  +TQLLSMMSDG  QFDIPPP I KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLSMMSDGIEQFDIPPPAIMKP 600

Query: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658
             YLWTGKQ+FSLLI+PN  SPVV+NLDAKNKV++PPKSKSLPNEMSQNDGFV+IRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIKPNHNSPVVINLDAKNKVFVPPKSKSLPNEMSQNDGFVIIRGSKIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718
            SGVMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRMAKLCAR++GNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 719  XXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
                     +VE AY+KCDELI LF+KG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYSKCDELITLFNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898
            TPQSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNFNR+WDHA N+TFNN D GLLPY IM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNQDEGLLPYAIM 960

Query: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018
            Q T EIL+PLE RLVRYDN G  + +EN ++ EY+DQ DAER FY SL+++I  KA  LA
Sbjct: 961  QTTNEILRPLEERLVRYDNSGCLVKEENLNKAEYVDQYDAERDFYRSLKEYINLKATALA 1020

Query: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078
              R S+ M EL++ P  E + VD D+ VP++++ SV Q+YRI++K VR+FL +A+ KYR+
Sbjct: 1021 NLRKSRGMLELLEPPTKESEKVDPDKLVPDNVKTSVSQLYRISEKSVRKFLEIALYKYRK 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198
            INAVLVN++DERAARVVKGR+EKTLLSDVA+Y+QDVY+DNLS++QVR+DL TIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258
            TIEDIAVA+TRA KLKIQASDV+I+GKD+IAINVFP+G KA+SIST AKEPSEN+VFYRM
Sbjct: 1201 TIEDIAVAITRAAKLKIQASDVNIIGKDRIAINVFPEGYKARSISTSAKEPSENDVFYRM 1260

Query: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318
            QQLRRALP +VVKGL DISRAVINIRDDGKRELLVEGYGLRDVM TDGV+G +T TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSRTTTNHVL 1320

Query: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378
            EV+SVLGIEAAR SI+ EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIIREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKVVKGTN+SE  
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKGTNISERD 1440

Query: 1439 LKPKPTLFESLVNETSVKVN 1458
            L PKP LFESL NE ++K N
Sbjct: 1441 LVPKPCLFESLSNEAALKAN 1460

>KLTH0F16236g Chr6 (1316542..1320924) [4383 bp, 1460 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1460

 Score = 2558 bits (6631), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1215/1460 (83%), Positives = 1329/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV   APK+I GLEFSALSA+DIVAQS+VEISTRDLFDLENGR PK+GGALD +MGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVAQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSS  EC TCHGNLASCHGHFGHIKL+LPVFH+GYFKATIQ+LQ ICK C+++LL + DK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKTCAALLLSEEDK 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
              FLSELRRPG+DNLRRMGILKKV+DQCKKQRRCL+C                   KI+H
Sbjct: 121  HQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKKS PEK+KW+GDW +VLAH+PELERYVK+CMDDLNPLKTLNLFKQV PEDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLAHNPELERYVKKCMDDLNPLKTLNLFKQVAPEDCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGIDST+KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGG-TGGKVKPIRGFCQRLKGKQ 359
            AGLEKGISINNMME WDYLQLAVAMYINSDSVNPA++ GG TGGK KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVV 419
            GRFRGNLSGKRVDFSGRTV+SPDPNLS+DEVAVPDRVAKVLTYPE VTRYNK KLQQLV+
Sbjct: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKQKLQQLVI 420

Query: 420  NGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLH 479
            NGPNE+PGANYLLKKDE+ARRNLR+GDR+KLA+NL+ GD+VERHLEDGDVVLFNRQPSLH
Sbjct: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRMKLARNLQYGDVVERHLEDGDVVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNL 539
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+NL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKPC 599
            LTPKSGEPIIAATQDFITGSYLISHKDSFF + +  QLLSMMSDG LQFDIPPP+I KP 
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFSRAEFVQLLSMMSDGNLQFDIPPPSIMKPY 600

Query: 600  YLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILS 659
            Y+WTGKQ+FSLLIRPNK+SPVV+NLDAKNKVYIPPK KSLPNEMS NDG+V+IRGS+ILS
Sbjct: 601  YMWTGKQVFSLLIRPNKESPVVINLDAKNKVYIPPKDKSLPNEMSINDGYVVIRGSKILS 660

Query: 660  GVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAX 719
            GVMDKSVLGDGKKHSVFYTILRD+G QEAA AMNRMAKLCAR++GNRGFSIGI+DVTP  
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEAAFAMNRMAKLCARFLGNRGFSIGINDVTPGF 720

Query: 720  XXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
                    MVE AYAKCD LIDLF+KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 721  ELKNKKEIMVEDAYAKCDALIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 780  INELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKT 839
            I ELDN+N+ LIMA CGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHF KNSKT
Sbjct: 781  IKELDNLNSCLIMANCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840

Query: 840  PQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYD 899
            PQSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC YD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 900  NTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQ 959
            NT+RTSSNGIVQFTYGGDGLDP++MEGNAQPVNF+R+W+HA NVTFN++D+ LLPYQIMQ
Sbjct: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFSRSWEHANNVTFNHVDKPLLPYQIMQ 960

Query: 960  VTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAK 1019
             T  +L+PLE +LVRYDNLGNE+    +DR+EYIDQ+DAER FY SLRD+++ KA  LA 
Sbjct: 961  QTNGVLKPLEEKLVRYDNLGNELDPSLQDRVEYIDQDDAERNFYKSLRDYMYEKASHLAN 1020

Query: 1020 FRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRA 1079
             R  K +KE +DEPA ELQ++DLDE  P     SVDQ+ +I+ K+V +FL +AI KY +A
Sbjct: 1021 IRAHKGLKEFLDEPAAELQAMDLDEGAPASALASVDQLCKISSKLVLKFLEIAIFKYHKA 1080

Query: 1080 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139
            KVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1140 NAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELT 1199
            NAVLVN +DERAARVVKGRIEKTLLSDVAFYIQDVY+DN+S+LQV+VDL TI+KLQLELT
Sbjct: 1141 NAVLVNNNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNMSFLQVKVDLGTIEKLQLELT 1200

Query: 1200 IEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQ 1259
            +EDIAVA+TRA KLKI ASDV I+GKDK+ INV+P+ AK KSIST AKEP ENE+FYRMQ
Sbjct: 1201 VEDIAVAITRAAKLKIAASDVSIMGKDKVNINVYPEMAKLKSISTSAKEPVENELFYRMQ 1260

Query: 1260 QLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHILE 1319
             LRRALPGIVVKGL DI+RAVINI+DDG RELLVEGYGLR+VM+TDGV+G KT TNHILE
Sbjct: 1261 HLRRALPGIVVKGLPDIARAVINIKDDGSRELLVEGYGLREVMTTDGVIGMKTKTNHILE 1320

Query: 1320 VYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRD 1379
            V+SVLGIEAAR SIVGEIDYTMSNHGMSVDPRH+QLLGDVMTYKGEILGITRFGLSKMRD
Sbjct: 1321 VFSVLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEILGITRFGLSKMRD 1380

Query: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQL 1439
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGAFKVVKGT++SE  L
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTDISESDL 1440

Query: 1440 KPKPTLFESLVNE-TSVKVN 1458
             PKPTLFESL +  T++KVN
Sbjct: 1441 APKPTLFESLCDSVTALKVN 1460

>Suva_8.169 Chr8 complement(297556..301938) [4383 bp, 1460 aa] {ON}
            YOR116C (REAL)
          Length = 1460

 Score = 2557 bits (6627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1214/1460 (83%), Positives = 1329/1460 (91%), Gaps = 2/1460 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV SE PK+I GLEFSALSAADIVAQSEVE+STRDLFDLE  RAP+  GALDPKMGV
Sbjct: 1    MKEVVVSETPKRIKGLEFSALSAADIVAQSEVEVSTRDLFDLEKDRAPRANGALDPKMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSSS+EC TCHGNLASCHGHFGH+KLALPVFHIGYFKATIQILQGICK CS+ILL +TDK
Sbjct: 61   SSSSLECTTCHGNLASCHGHFGHLKLALPVFHIGYFKATIQILQGICKNCSAILLSETDK 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            + FL ELRRPGVDNLRRMGILKK+LDQCKKQRRCL C                   KIIH
Sbjct: 121  RKFLHELRRPGVDNLRRMGILKKILDQCKKQRRCLHCGALNGVVKKAAAGAGSAALKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKKS PEK+ W+G+W  VL H+PELERYVKRCMDDLNPLKTLNLFKQ+K  DCE
Sbjct: 181  DTFRWVGKKSAPEKDIWVGEWKEVLTHNPELERYVKRCMDDLNPLKTLNLFKQIKSADCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGID+T+ SGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDATVPSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKGK 358
            AGL+KGISINNMMEHWDYLQL VAMYINSDSVNPA+L G +  GGKVKPIRGFCQRLKGK
Sbjct: 301  AGLDKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGSSNGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLTYPE+VTRYN+ KLQ+LV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRHKLQELV 420

Query: 419  VNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSL 478
            VNGPN +PGANYLLKK+EDARRNLR+GDR+KLAK+L+IGD++ERHLEDGDVVLFNRQPSL
Sbjct: 421  VNGPNVHPGANYLLKKNEDARRNLRYGDRMKLAKSLQIGDVIERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+N
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSF+D+  +TQLL MMSDG  QFD+PPP I KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFYDRATLTQLLCMMSDGVEQFDVPPPAIMKP 600

Query: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658
             YLWTGKQ+FSLLI+P+ KSPVV+NLDAKNKV++PPKSKSLP+EMSQNDGFV+IRGSQIL
Sbjct: 601  YYLWTGKQVFSLLIKPSHKSPVVINLDAKNKVFVPPKSKSLPSEMSQNDGFVVIRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718
            SGVMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRMAKLCAR++GNRGFSIGI+DVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARFLGNRGFSIGINDVTPA 720

Query: 719  XXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
                     +VE AY KCDELI  F+KG+LETQPGCNEEQTLEAKIGG LSKVREEVG+V
Sbjct: 721  DDLKQKKEELVEIAYRKCDELITSFNKGELETQPGCNEEQTLEAKIGGFLSKVREEVGDV 780

Query: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838
            CINELDN NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNWNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898
            TPQSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958
            DNTVRTS+NGIVQFTYGGDGLDPLEMEGNAQPVNFNR+WDHA N+TF+N D GLLPY IM
Sbjct: 901  DNTVRTSANGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFDNQDEGLLPYAIM 960

Query: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018
            +   +IL PLE+RLVRYDN G  +  E++D+ E++DQ DAER FY SLR++I  KA  LA
Sbjct: 961  ETANKILVPLEDRLVRYDNRGFLVKDEDKDKAEHVDQYDAERDFYRSLREYINLKATTLA 1020

Query: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078
              R S+ M EL++ P  ELQ +D DE VP ++R SV Q+YRI+++ V++FL +A+ KYR+
Sbjct: 1021 NLRKSRGMLELVNAPPKELQGMDPDEAVPTNVRTSVSQLYRISEQSVKKFLEIALFKYRK 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A++EPGTA+GAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARLEPGTAIGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198
            INAVLVN++DERAARVVKGR+EKTLLSDVA+Y+QDVY+DNLS++QVR+DL TIDKLQLEL
Sbjct: 1141 INAVLVNDNDERAARVVKGRVEKTLLSDVAYYVQDVYKDNLSFIQVRIDLGTIDKLQLEL 1200

Query: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258
            TIEDIAVA+TRA KLKIQA DV I+GKDKIAINVFP+G KAKSIST AKEPSEN+VFYRM
Sbjct: 1201 TIEDIAVAITRASKLKIQAPDVTIIGKDKIAINVFPEGYKAKSISTSAKEPSENDVFYRM 1260

Query: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318
            QQLRRALP +VVKGL+DISRAVINIRDDGKRELLVEGYGLRDVM TDGV+G KT TNH+L
Sbjct: 1261 QQLRRALPDVVVKGLADISRAVINIRDDGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVL 1320

Query: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378
            EV+SVLGIEAAR SIV EI+YTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARYSIVREINYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKV+KGTNVSE+ 
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVIKGTNVSEKD 1440

Query: 1439 LKPKPTLFESLVNETSVKVN 1458
            L PKP LFESL NE ++K N
Sbjct: 1441 LIPKPCLFESLSNEAALKAN 1460

>KAFR0D05030 Chr4 complement(988159..992547) [4389 bp, 1462 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1462

 Score = 2548 bits (6604), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1212/1462 (82%), Positives = 1332/1462 (91%), Gaps = 4/1462 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV SEAPKKISG+EFSALSA+DIVAQSEVEIS+RDLFDLE  R  K  GALDP+MGV
Sbjct: 1    MKEVVISEAPKKISGIEFSALSASDIVAQSEVEISSRDLFDLEQNRKQKENGALDPRMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSSS+ C+TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQ ICK CSS+LL D DK
Sbjct: 61   SSSSLTCETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKNCSSVLLSDEDK 120

Query: 121  KHFLSELRRPG-VDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKII 179
            K +L ELR  G +DNL++MGILKKV+DQCKKQRRCL C                   KII
Sbjct: 121  KKYLHELRTSGRIDNLKKMGILKKVMDQCKKQRRCLHCGALNGVVKKAAAGSGTASLKII 180

Query: 180  HDTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDC 239
            HDTFRW GKKS PEK+ WIGDW+ VL+H PELER+VKRC DDLNPLKTLNLFKQV+PEDC
Sbjct: 181  HDTFRWVGKKSTPEKDNWIGDWNEVLSHHPELERFVKRCTDDLNPLKTLNLFKQVRPEDC 240

Query: 240  ELLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLI 299
            ELLGIDST+KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLT+KLTE+VWTSSLI
Sbjct: 241  ELLGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTIKLTEIVWTSSLI 300

Query: 300  KAGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKG 357
            KAGLEKGISINNMMEHWDYLQL VAMYIN+DSVNPA+L G +  GGKVKPIRGFCQRLKG
Sbjct: 301  KAGLEKGISINNMMEHWDYLQLTVAMYINADSVNPAMLPGASSGGGKVKPIRGFCQRLKG 360

Query: 358  KQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQL 417
            KQGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLTYPE+VTRYN+ KLQ+L
Sbjct: 361  KQGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNRKKLQEL 420

Query: 418  VVNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPS 477
            V+NGPN +PGANYLLKK+E+ARRNLR+GDR+KLAKNL+ GD+VERHLEDGDVVLFNRQPS
Sbjct: 421  VMNGPNIHPGANYLLKKNEEARRNLRYGDRLKLAKNLQYGDIVERHLEDGDVVLFNRQPS 480

Query: 478  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKS 537
            LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+
Sbjct: 481  LHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKN 540

Query: 538  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWK 597
            NLLTPKSGEPIIAATQDFITGSYLISHKDSFFD+   TQLLSMMSDG LQFDIPPP I K
Sbjct: 541  NLLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMSDGNLQFDIPPPAIMK 600

Query: 598  PCYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQI 657
            P YLWTGKQ+FSLLI+PN KSPVV+NLDAKNKVYIPPKSKSLPNEMS+NDGFV+IRGS I
Sbjct: 601  PYYLWTGKQLFSLLIKPNHKSPVVINLDAKNKVYIPPKSKSLPNEMSRNDGFVIIRGSNI 660

Query: 658  LSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTP 717
            LSGVMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRM+KLCAR++GNRGFSIGISDVTP
Sbjct: 661  LSGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMSKLCARFLGNRGFSIGISDVTP 720

Query: 718  AXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777
            A         +VE AYAKCD+LID ++KGKLETQPGCNEE+TLEAKIGGLLSKVREEVG+
Sbjct: 721  ADDLKIKKEELVEIAYAKCDDLIDSYNKGKLETQPGCNEEETLEAKIGGLLSKVREEVGD 780

Query: 778  VCINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNS 837
            VCINELDN+NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNS
Sbjct: 781  VCINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNS 840

Query: 838  KTPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCL 897
            KTPQSKGFVRNSFFSGLTPPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 
Sbjct: 841  KTPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQ 900

Query: 898  YDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQI 957
            YDNTVRTSSNGIVQFTYGGDGLDP+EMEG+AQPVNFNR+WDHA N+TFNN +RGLLPYQ+
Sbjct: 901  YDNTVRTSSNGIVQFTYGGDGLDPMEMEGSAQPVNFNRSWDHALNITFNNNERGLLPYQV 960

Query: 958  MQVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLL 1017
            M+ T E+L PLE RLVRYDNLGNE+ KE+ D++EY DQ DAER FY +LR +I +K+  L
Sbjct: 961  MKKTNEVLNPLEERLVRYDNLGNEVMKEDLDKLEYADQFDAERDFYKTLRSYIQSKSDHL 1020

Query: 1018 AKFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYR 1077
            A  R S+ + EL+ EP  ELQS+  DE   +  R SVDQ+ +IT+K V +FL +A+ KYR
Sbjct: 1021 AHVRKSRGLLELLSEPGEELQSLHPDERATDVSRSSVDQLCKITEKAVLKFLEIALSKYR 1080

Query: 1078 RAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTP 1137
            +A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTP
Sbjct: 1081 KARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTP 1140

Query: 1138 IINAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLE 1197
            IINAVLVN +DERAARVVKGR+EKT+LSDVA+YIQDVY+DNLS+LQ+R+DL+TI+KLQLE
Sbjct: 1141 IINAVLVNNNDERAARVVKGRVEKTMLSDVAYYIQDVYKDNLSFLQIRIDLNTIEKLQLE 1200

Query: 1198 LTIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYR 1257
            LTIEDIAVA+T+APKLKIQASDV I G DK+ +NVFP+G+K+KSIST AK+PSEN+VFYR
Sbjct: 1201 LTIEDIAVALTKAPKLKIQASDVSIAGDDKVIVNVFPEGSKSKSISTSAKDPSENDVFYR 1260

Query: 1258 MQQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHI 1317
            MQQLRRALP IVVKGL +I+RAVINIRDDGKRELLVEGYGLR+VM TDGV+G KTVTNH+
Sbjct: 1261 MQQLRRALPHIVVKGLPEIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTVTNHV 1320

Query: 1318 LEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKM 1377
            LEV SVLGIEAAR+SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKM
Sbjct: 1321 LEVSSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKM 1380

Query: 1378 RDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEE 1437
            RDSVLQLASFEKTTDHLFDAAFYMKKD VEGVSECIILGQTM+IGTG+FKVVKGT++  E
Sbjct: 1381 RDSVLQLASFEKTTDHLFDAAFYMKKDNVEGVSECIILGQTMSIGTGSFKVVKGTDIKPE 1440

Query: 1438 QLKPKPTLFESLVNETS-VKVN 1458
             LKPKPTLFESL + +S +K+N
Sbjct: 1441 DLKPKPTLFESLSSASSNIKLN 1462

>Kpol_1016.9 s1016 (19972..24354) [4383 bp, 1460 aa] {ON}
            (19972..24354) [4383 nt, 1461 aa]
          Length = 1460

 Score = 2531 bits (6560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1196/1460 (81%), Positives = 1321/1460 (90%), Gaps = 2/1460 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV SE PKKISGLEFSALSA+DIVAQSEVE+STRDLFDLENGRAPK GGALDPKMGV
Sbjct: 1    MKEVVVSETPKKISGLEFSALSASDIVAQSEVEVSTRDLFDLENGRAPKIGGALDPKMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSSSMEC TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQGICK CSSILL DTD+
Sbjct: 61   SSSSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKNCSSILLNDTDR 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            + FL ELRRPG+DNL+RM I+KK+LDQCKKQRRCL C                   KIIH
Sbjct: 121  RDFLHELRRPGIDNLKRMAIIKKILDQCKKQRRCLTCGALNGVVKRAAAGSGSASLKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKKS PEK++W+GDW+ VLA++PELER+ KR MDDLNPLKTLNLFKQ++PEDCE
Sbjct: 181  DTFRWVGKKSSPEKDEWVGDWEKVLANNPELERFAKRSMDDLNPLKTLNLFKQIRPEDCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGIDST+K+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKGK 358
            AGLEKGISINNMMEHWDYLQL+VAMYINSDSVNP+++ G +  G K KPIRGFCQRLKGK
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPSMMPGASSGGAKAKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLTYPE+VTRYN+ KLQ LV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPEKVTRYNREKLQALV 420

Query: 419  VNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSL 478
            +NGPN +PGANY+LK +E+ARRNLR+GDR+K+AK LR+GD+VERHLEDGD+VLFNRQPSL
Sbjct: 421  INGPNVHPGANYILKANEEARRNLRYGDRLKIAKQLRVGDIVERHLEDGDIVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSN 538
            HRLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEA+NLMGVK+N
Sbjct: 481  HRLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAMNLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKD+F D+   TQLLSMMSD  LQFDIPPPTI KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDTFLDRATFTQLLSMMSDSNLQFDIPPPTIIKP 600

Query: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658
              LWTGKQ+FSLLI+PNK SPVV+NLDAKNKV+IPPKSKSLPNEMSQNDGFV+IRGSQIL
Sbjct: 601  YCLWTGKQLFSLLIKPNKDSPVVINLDAKNKVFIPPKSKSLPNEMSQNDGFVVIRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718
            SGVMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRMAKLCARY+GNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANAMNRMAKLCARYLGNRGFSIGISDVTPD 720

Query: 719  XXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
                     +VE AYAKCDELIDLF+KGKLETQPGCNEEQTLEAKIGGLLSKVREEVG++
Sbjct: 721  NALKQKKEELVEIAYAKCDELIDLFTKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDI 780

Query: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838
            CINELDN+NAPLIMATCGSKGS LNVSQMVAVVGQQIISG+RVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFRKNSK 840

Query: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898
            TPQSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958
            DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNF R+WDHA N+TF+N  +GLLPY I+
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFKRSWDHAINITFDNSAQGLLPYAII 960

Query: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018
              T +IL P E RL+RYDN+G  +   ++ + E++DQ D+ER FY SLR ++  KA +LA
Sbjct: 961  NKTNDILAPFEERLIRYDNIGTLVKANDQAKDEFVDQLDSERNFYCSLRKYMQEKASILA 1020

Query: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078
              R  K +KEL  EP  E + +DLDE    + R +V+++ +IT+K V +FL +A+ KYRR
Sbjct: 1021 SIRKDKGLKELSSEPGNEFKEMDLDEGESSEARFAVEKLCKITEKTVEKFLEIAMSKYRR 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            A+VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1081 ARVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1140

Query: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198
            INAVLVN++D+RAARVVKGRIEKTLLSDVA+Y+QDVY+DNLS+L+V++DLSTIDKLQLEL
Sbjct: 1141 INAVLVNDNDKRAARVVKGRIEKTLLSDVAYYVQDVYKDNLSFLEVKIDLSTIDKLQLEL 1200

Query: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258
            TIEDIAVA+TRAPKLKIQ +DV IV KDKI I+V+P+G+KAKSIST  KEPSEN+VFYRM
Sbjct: 1201 TIEDIAVALTRAPKLKIQTTDVQIVSKDKITISVYPEGSKAKSISTSMKEPSENDVFYRM 1260

Query: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318
            Q LRRALP IVV GL DI+RAVINIRDDGKRELLVEGYGLR+VM TDGV+G KT TNH+L
Sbjct: 1261 QTLRRALPQIVVNGLPDIARAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTTTNHVL 1320

Query: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378
            EV+SVLGIEAAR+SI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1321 EVFSVLGIEAARSSIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1380

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGAFK++K T +  + 
Sbjct: 1381 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKILKSTEIKPDD 1440

Query: 1439 LKPKPTLFESLVNETSVKVN 1458
            LKPK TLFE+LV E ++KVN
Sbjct: 1441 LKPKRTLFENLVAEPALKVN 1460

>CAGL0L11660g Chr12 (1245685..1250064) [4380 bp, 1459 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116c RPO31 DNA-directed RNA polymerase III
          Length = 1459

 Score = 2503 bits (6487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1196/1458 (82%), Positives = 1320/1458 (90%), Gaps = 3/1458 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV  E PK+ISGLEFSALS ADIVAQSE+EIS+RDLFDLEN R+PK GGALDP+MGV
Sbjct: 1    MKEVVIGETPKRISGLEFSALSPADIVAQSELEISSRDLFDLENNRSPKEGGALDPRMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            S+SSMEC TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQGICK CS+ILL + DK
Sbjct: 61   SASSMECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQGICKTCSAILLSEQDK 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            +HFLSELRRPGVDNLRRM +LKKVLDQCKKQRRCL C                   KIIH
Sbjct: 121  RHFLSELRRPGVDNLRRMALLKKVLDQCKKQRRCLHCGALNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKKS PEK+KWIGDW  VL+H+PELERYVKR  DDLNPLKTLNLFKQ+  EDCE
Sbjct: 181  DTFRWVGKKSTPEKDKWIGDWKEVLSHNPELERYVKRATDDLNPLKTLNLFKQIASEDCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGID+T K+GRPETYIWRY+PAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDATNKAGRPETYIWRYIPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKGK 358
            AG+EKGISINNMMEHWDYLQ+ VAMYINSDS+NPA+L G +  GGKVKPIRGFCQRLKGK
Sbjct: 301  AGIEKGISINNMMEHWDYLQMTVAMYINSDSINPAMLPGSSTGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVP  VAKVLT+PE+VTRYN  KL+QLV
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNIKKLRQLV 420

Query: 419  VNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSL 478
             NGPN +PGANYLLKK+E+ARRNLR+GDR KLA NL+ GD+VERHLEDGDVVLFNRQPSL
Sbjct: 421  QNGPNVHPGANYLLKKNEEARRNLRYGDRQKLANNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+N
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFDK  +TQLLSMMSDG+LQFDIPPP I KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKASLTQLLSMMSDGSLQFDIPPPAIMKP 600

Query: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658
            CYLWTGKQ+FSLLI+PNK SPV +NLDAKNKVYIPPK K  PNEMSQNDGFV++RGSQIL
Sbjct: 601  CYLWTGKQVFSLLIKPNKNSPVKINLDAKNKVYIPPKQKHYPNEMSQNDGFVIVRGSQIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718
            SGVMDKSVLGDGKKHSVFYTILRD+G QEAA AMNRMAKLCARY+GNRGFSIGISDVTPA
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDFGPQEAASAMNRMAKLCARYLGNRGFSIGISDVTPA 720

Query: 719  XXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
                     +VE AYAKCDELIDL++KGKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  DDLKQKKEDLVEIAYAKCDELIDLYNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838
            CINELDN+NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSK 840

Query: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898
            TPQSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 841  TPQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958
            DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNR+WDHA N+TFNN DRGLLPY+I 
Sbjct: 901  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRSWDHAYNITFNNTDRGLLPYEIK 960

Query: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018
            +  + IL+PLE RL+RYD LG  ++ E+    +Y+DQ+D+ER FY SLR+F+  KA+ LA
Sbjct: 961  KTVDNILKPLEKRLIRYDTLGRPVSAEDDKLDDYVDQHDSERLFYASLREFMTDKAKKLA 1020

Query: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078
            K R S+ + +L+ +  LE    + +E++   ++HS+ Q+YRIT+  V++FL +AI KY R
Sbjct: 1021 KLRKSRGLPKLIKKSELEGYDPE-NEHIDAIVQHSITQLYRITEDAVQKFLEIAISKYHR 1079

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1080 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1139

Query: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198
            INAVLVN +DERAARVVKGRIEKTLLSDV +YIQDVY++N++YLQV+VDL+TIDKLQLEL
Sbjct: 1140 INAVLVNNNDERAARVVKGRIEKTLLSDVCYYIQDVYKENMAYLQVKVDLNTIDKLQLEL 1199

Query: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258
            TIEDIA+A+TRAPKLKIQ SDV ++GKDKIAINV P+G  +K+ ST  KEP+EN+VFYRM
Sbjct: 1200 TIEDIAIAITRAPKLKIQTSDVTVLGKDKIAINVLPEGFGSKTSSTSLKEPTENDVFYRM 1259

Query: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318
            Q LRRALP I+VKGL+DI+RAVINIRDDGKRELLVEGYGLRDVM TDGV+G KT TNH+L
Sbjct: 1260 QTLRRALPSIMVKGLNDIARAVINIRDDGKRELLVEGYGLRDVMCTDGVIGAKTATNHVL 1319

Query: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378
            E+++VLGIEAARASI+GEIDYTMSNHGMSVDPRHIQLLGDVMT+KGE+LGITRFGLSKMR
Sbjct: 1320 EIFNVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMR 1379

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKVVK T+++E++
Sbjct: 1380 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKNTDIAEDE 1439

Query: 1439 LKPKPTLFESLVNETSVK 1456
            LKPK TLFESL +  + K
Sbjct: 1440 LKPKRTLFESLTSNVANK 1457

>KLLA0E21253g Chr5 (1896457..1900830) [4374 bp, 1457 aa] {ON} highly
            similar to uniprot|P04051 Saccharomyces cerevisiae
            YOR116C
          Length = 1457

 Score = 2502 bits (6484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1191/1458 (81%), Positives = 1300/1458 (89%), Gaps = 1/1458 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKE V   APKKI G+ FSALSAADIV+QSEVEISTRDLFDL+NGR+ K GGALDP+MGV
Sbjct: 1    MKETVIDIAPKKIKGISFSALSAADIVSQSEVEISTRDLFDLDNGRSAKEGGALDPRMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSS  EC TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQ +CK C ++LL + DK
Sbjct: 61   SSSQAECTTCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQSVCKGCGALLLSEEDK 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            + FL+ELRRPG+DNLRRM ILKK+LDQCKKQRRC +C                   KIIH
Sbjct: 121  RKFLTELRRPGMDNLRRMNILKKILDQCKKQRRCFECGELNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKKS PEKE+WIGDW  VL ++PELERYVKRCMDDLNPLK LNLFKQ+KP DCE
Sbjct: 181  DTFRWVGKKSAPEKEQWIGDWKQVLENNPELERYVKRCMDDLNPLKVLNLFKQIKPNDCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGIDST KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQG 360
            AGLEKGISINNMME WDYLQLAVAMYINSDSVNP++L G +G K KPIRGFCQRLKGKQG
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPSMLPGSSGTKSKPIRGFCQRLKGKQG 360

Query: 361  RFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVN 420
            RFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAK+LTYPE+VTRYNK KLQQLV+N
Sbjct: 361  RFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKILTYPEKVTRYNKHKLQQLVIN 420

Query: 421  GPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHR 480
            GP  +PGANYLLKK+EDARRNLR+GDRVKLAK L+ GD+VERH+EDGDVVLFNRQPSLHR
Sbjct: 421  GPKVHPGANYLLKKNEDARRNLRYGDRVKLAKQLQYGDVVERHIEDGDVVLFNRQPSLHR 480

Query: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLL 540
            LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+NLL
Sbjct: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNLL 540

Query: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKPCY 600
            TPKSGEPIIAATQDFITGSYLISHKDSFFD+  +TQLLSMMSD  LQFDIPPP+I KP Y
Sbjct: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDRAQLTQLLSMMSDSNLQFDIPPPSIMKPHY 600

Query: 601  LWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILSG 660
            LWTGKQ+FSLLI+P++KSPVV+NLDAKNKVY+PP  K  PNEMSQNDGFVLIRGS ILSG
Sbjct: 601  LWTGKQVFSLLIKPSRKSPVVINLDAKNKVYLPPPKKEYPNEMSQNDGFVLIRGSNILSG 660

Query: 661  VMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAXX 720
            VMDKSVLGDGKKHSVFYTILRDYG  EAA+AMNRMAKLCARY+GNRGFSIGI+DVTP   
Sbjct: 661  VMDKSVLGDGKKHSVFYTILRDYGPNEAAQAMNRMAKLCARYLGNRGFSIGINDVTPGSD 720

Query: 721  XXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
                   MVESAYAKCDELIDLF+KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI
Sbjct: 721  LKQKKEQMVESAYAKCDELIDLFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780

Query: 781  NELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTP 840
             ELDN+NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSKTP
Sbjct: 781  RELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKTP 840

Query: 841  QSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDN 900
            QSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC YDN
Sbjct: 841  QSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYDN 900

Query: 901  TVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQV 960
            TVRTSSNGIVQFTYGGDGLDPL+MEGNAQPVNFNR+W HA N+T N+   GLLPYQI+  
Sbjct: 901  TVRTSSNGIVQFTYGGDGLDPLDMEGNAQPVNFNRSWTHANNLTLNDNSPGLLPYQIIAE 960

Query: 961  TEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKF 1020
            T  ILQPLEN+L RYDN+G E+ KE+  + EYIDQ DAER FY SLR+F+  KA  LA  
Sbjct: 961  TNVILQPLENKLKRYDNIGQELRKEDEHKDEYIDQFDAERSFYQSLREFMTEKALTLASL 1020

Query: 1021 RGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAK 1080
            RG + +KEL+DEPA EL+  + DENVP  I  +++Q+ +I+  +V++FL +AI KY RA+
Sbjct: 1021 RGERGLKELVDEPAEELREFNWDENVPASITIALNQLCKISKILVQKFLSIAISKYHRAR 1080

Query: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140
            VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN
Sbjct: 1081 VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIIN 1140

Query: 1141 AVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELTI 1200
            AVLVN++DERAARVVKGR+EKTLLSDV+FY+QD+YRDN+++LQ+++D  TI+KLQLELT+
Sbjct: 1141 AVLVNDNDERAARVVKGRVEKTLLSDVSFYVQDIYRDNMAFLQIKIDSETIEKLQLELTL 1200

Query: 1201 EDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQQ 1260
            EDI VA+ +APKLKI  +D+ I+GKDKI I V  DG   KSIST  KEP  NEVFYRMQQ
Sbjct: 1201 EDIVVAIAKAPKLKIGTNDISIIGKDKINIAVSSDGKSMKSISTAMKEPEPNEVFYRMQQ 1260

Query: 1261 LRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHILEV 1320
            LRRALP IVVKG SDISRAVINIRDDGKRELLVEGYGLRDVM+TDGV+G KT TNHILEV
Sbjct: 1261 LRRALPHIVVKGFSDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVIGSKTKTNHILEV 1320

Query: 1321 YSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDS 1380
            Y VLGIEAAR+ I+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGL+KMRDS
Sbjct: 1321 YDVLGIEAARSCIINEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLAKMRDS 1380

Query: 1381 VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQLK 1440
            VLQLASFEKTTDHLFDAAFYMK DAVEGVSECIILGQTM+IGTG+FKVVK T V E  L 
Sbjct: 1381 VLQLASFEKTTDHLFDAAFYMKNDAVEGVSECIILGQTMSIGTGSFKVVKNTVVGENDLT 1440

Query: 1441 PKPTLFESLVNETSVKVN 1458
            PKPTLFE+L  +T VK N
Sbjct: 1441 PKPTLFETLC-DTVVKAN 1457

>AER252C Chr5 complement(1101343..1105722) [4380 bp, 1459 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR116C
            (RPO31)
          Length = 1459

 Score = 2499 bits (6477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1193/1459 (81%), Positives = 1304/1459 (89%), Gaps = 1/1459 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV    PK+ISGLEFSALSA+DIVAQSEVEI TRDLFDLE+GRAPK GGALD +MGV
Sbjct: 1    MKEVVVDILPKRISGLEFSALSASDIVAQSEVEIFTRDLFDLEDGRAPKKGGALDSRMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSS  EC TCHG LASCHGHFGHIKLALPVFH+GYFKATIQILQ ICK C+ +LL + DK
Sbjct: 61   SSSQAECSTCHGTLASCHGHFGHIKLALPVFHVGYFKATIQILQSICKNCAKLLLNEEDK 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            + FLSELRRPG+DNLRRM  LKKVLDQCKKQRRCL C                   KIIH
Sbjct: 121  RQFLSELRRPGIDNLRRMATLKKVLDQCKKQRRCLHCGMLNGVVKKAAAGSGSAALKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKKS PEK+KWIGDW+ VL HSPELERY+KR M++LNPLKTLNLFKQ+ P+DCE
Sbjct: 181  DTFRWVGKKSAPEKDKWIGDWNQVLQHSPELERYMKRTMENLNPLKTLNLFKQISPQDCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGIDST+K+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGG-KVKPIRGFCQRLKGKQ 359
            AGLEKGISINNMME WDYLQ+AVAMYINSDSVNPA++ GG GG K KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGNGGGKTKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVV 419
            GRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLT+PE+VTRYNK KLQQL+V
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPEKVTRYNKHKLQQLIV 420

Query: 420  NGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLH 479
            NG N +PGANYLLKK+E+ARRNLR+GDR+KLAKNL+IGD+VERHLEDGDVVLFNRQPSLH
Sbjct: 421  NGANVHPGANYLLKKNEEARRNLRYGDRIKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNL 539
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+NL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKPC 599
            LTPKSGEPIIAATQDFITGSYLISHKDSFFD+    Q+LSMMSDG LQFDIPPP I +P 
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFVQMLSMMSDGNLQFDIPPPAIMRPH 600

Query: 600  YLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILS 659
            YLWTGKQ+FSLLI+PNKKSPV++NLDAKNKVYI PK+K+ PNEMS NDG+V+IRGS ILS
Sbjct: 601  YLWTGKQLFSLLIKPNKKSPVIINLDAKNKVYIAPKNKAYPNEMSANDGYVVIRGSNILS 660

Query: 660  GVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAX 719
            GVMDKSVLGDGKKHSVFYTILRD+G QEA +AMNRMAKLCARY+GNRGFSIGISDVTP  
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPQEATQAMNRMAKLCARYLGNRGFSIGISDVTPGV 720

Query: 720  XXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
                    MVE AYAKCDELIDL+ +GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+VC
Sbjct: 721  ELKATKEEMVEIAYAKCDELIDLYKRGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDVC 780

Query: 780  INELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKT 839
            I ELDN+NAPLIMATCGSKGS LNVSQMVAVVGQQIISG+RVPDGFQDRSLPHFPKNSKT
Sbjct: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFPKNSKT 840

Query: 840  PQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYD 899
            PQSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC YD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 900  NTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQ 959
            NTVRTSSNGIVQFTYGGDGLDPL MEGNA+PVNFNR+WDHA N+T+N+ D+G+LPYQI++
Sbjct: 901  NTVRTSSNGIVQFTYGGDGLDPLNMEGNAKPVNFNRSWDHANNITYNHDDKGMLPYQILE 960

Query: 960  VTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAK 1019
             T  IL PLE +L RYDN+GN +     +   YIDQ+DAER FY SLR ++  KA+ LA 
Sbjct: 961  ETNAILHPLEQQLSRYDNVGNPLAPGLENEELYIDQHDAEREFYQSLRTYMSEKARKLAD 1020

Query: 1020 FRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRA 1079
               S+ +KEL   PALELQ +DLD + PE    SV+Q+ +I+ K+VR FL +AI KYR+A
Sbjct: 1021 ITKSRGLKELYHAPALELQLMDLDASCPEVDVKSVNQLCKISSKLVRTFLDIAISKYRKA 1080

Query: 1080 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139
            KVEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1140 NAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELT 1199
            NA LVN+ DERAARVVKGR+EKTLLSDV FYIQDVYRDN+S+LQV+VDL+TI+KLQLELT
Sbjct: 1141 NATLVNDDDERAARVVKGRVEKTLLSDVIFYIQDVYRDNMSFLQVKVDLATIEKLQLELT 1200

Query: 1200 IEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQ 1259
            +EDIA+A+T APKLKI   DV IVG++KI INV  D  KAKSISTLA EP EN+VF++MQ
Sbjct: 1201 VEDIAIAITSAPKLKISTGDVSIVGRNKININVCNDLDKAKSISTLASEPHENDVFFKMQ 1260

Query: 1260 QLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHILE 1319
             LRRALPGIVVKGL DISRAVINIRDDGKRELLVEGYGLRDVM+TDGVVG+KT TNH LE
Sbjct: 1261 HLRRALPGIVVKGLPDISRAVINIRDDGKRELLVEGYGLRDVMTTDGVVGYKTKTNHFLE 1320

Query: 1320 VYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRD 1379
            VY VLGIEAAR SI+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMRD
Sbjct: 1321 VYDVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380

Query: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQL 1439
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM IGTG+FKVVKGTN+S + L
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMTIGTGSFKVVKGTNISPDDL 1440

Query: 1440 KPKPTLFESLVNETSVKVN 1458
            KPKPTLFE+L +  ++KVN
Sbjct: 1441 KPKPTLFENLCSLNTLKVN 1459

>TBLA0A03720 Chr1 complement(929751..934127) [4377 bp, 1458 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1458

 Score = 2499 bits (6477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1191/1459 (81%), Positives = 1307/1459 (89%), Gaps = 2/1459 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV+SE PKKISGLEFSALSAADIVAQSEV I+TRDL+DLE+GRAPK  GALD +MGV
Sbjct: 1    MKEVVTSEIPKKISGLEFSALSAADIVAQSEVAITTRDLYDLEHGRAPKKSGALDQRMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSS++EC+TCHGNLASCHGHFGHIKLALPVFH+GYFKATIQILQ ICK C+++LL D DK
Sbjct: 61   SSSNLECETCHGNLASCHGHFGHIKLALPVFHVGYFKATIQILQAICKSCAAVLLSDEDK 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            ++FLSELRRPG+DNL+RMGILKK+LDQCKKQRRCL C                   KIIH
Sbjct: 121  RNFLSELRRPGIDNLKRMGILKKILDQCKKQRRCLHCGGLNGVVKKAAAGGGSASLKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKK  PEK+ W+GDW  VL+H+PELER+VKR MDDLNPLKTLNLFKQ+KPEDCE
Sbjct: 181  DTFRWVGKKQTPEKDSWVGDWQEVLSHNPELERFVKRAMDDLNPLKTLNLFKQIKPEDCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGIDST KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK
Sbjct: 241  LLGIDSTSKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGG-TGGKVKPIRGFCQRLKGKQ 359
            AGLEKGISINNMMEHWDYLQL+VAMYINSDSVNP ++ G  TG KVKPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNPLLMPGASTGNKVKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVV 419
            GRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLT+PERVTRYNK KLQ LV+
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTFPERVTRYNKRKLQALVL 420

Query: 420  NGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLH 479
            NGPN +PGANYLLKKDE+ARRNLR+GD+VKLAKNL+IGD+VERHLEDGDVVLFNRQPSLH
Sbjct: 421  NGPNVHPGANYLLKKDEEARRNLRYGDKVKLAKNLQIGDVVERHLEDGDVVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNL 539
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+NL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKPC 599
            LTPKSGEPIIAATQDFITGSYLISHKDSFFD+   TQLLSMM DG LQFDIPPP I KPC
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFFDRATFTQLLSMMCDGNLQFDIPPPAIMKPC 600

Query: 600  YLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILS 659
            YLWTGKQ+FSLLI+PN  SPVV+N+DAKNKV+ PPK KSLP+EMS NDGFV+IRGSQILS
Sbjct: 601  YLWTGKQLFSLLIKPNSNSPVVINVDAKNKVFKPPKDKSLPSEMSPNDGFVVIRGSQILS 660

Query: 660  GVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAX 719
            GVMDKSVLGDGKKHSVFYTILRDYG QEAA AMNRMAKLCAR++GNRGFSIGI+DVTP  
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDYGPQEAATAMNRMAKLCARFLGNRGFSIGINDVTPDD 720

Query: 720  XXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
                    +VE AYAKCDELI L+++GKLETQPGCNEEQTLEAKI G+LSKVREEVG++C
Sbjct: 721  KLKNLKENLVEIAYAKCDELIGLYNQGKLETQPGCNEEQTLEAKISGILSKVREEVGDIC 780

Query: 780  INELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKT 839
            INELDN NAPLIMATCGSKGS LNVSQMVAVVGQQIISG+RVPDGFQDRSLPHF KNSKT
Sbjct: 781  INELDNWNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSKT 840

Query: 840  PQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYD 899
            PQSKGFVRNSF+SGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC YD
Sbjct: 841  PQSKGFVRNSFYSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 900  NTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQ 959
            NTVRTSSNGIVQFTYGGDGLDP +MEGNAQPVNFNR+WDHA N+ F+N D+ + PYQI++
Sbjct: 901  NTVRTSSNGIVQFTYGGDGLDPFDMEGNAQPVNFNRSWDHAYNIKFDNNDKTIYPYQILE 960

Query: 960  VTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAK 1019
            +T +IL PLE +L+RYDN+G  +T EN  + E++DQ DAER FY+SLRD++  KA  LA 
Sbjct: 961  ITNDILHPLEEKLIRYDNIGKVVTPENSGKDEFVDQLDAERNFYNSLRDYMTKKANELAD 1020

Query: 1020 FRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRA 1079
             R S+ MKEL+  P  E + +DLDE  P+ IRHSV+Q+ RIT+  VREFL++AI KYRRA
Sbjct: 1021 VRKSRGMKELLSAPGDEFKLMDLDEQTPDSIRHSVEQICRITENTVREFLKIAITKYRRA 1080

Query: 1080 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139
            +VEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 RVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1140 NAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELT 1199
            NAVLVNE+DERAARVVKGRIEKTLLSDVA+YIQD Y+DN SYL+V++DL TI+KLQLELT
Sbjct: 1141 NAVLVNENDERAARVVKGRIEKTLLSDVAYYIQDCYKDNNSYLEVKIDLGTIEKLQLELT 1200

Query: 1200 IEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQ 1259
            + DIA A+ RAPKLKIQ  DV      KI I+V P+ + +K IS  AKEP EN VFYRMQ
Sbjct: 1201 MSDIADAIARAPKLKIQFGDVVPESNSKIRISVRPEASVSK-ISASAKEPLENNVFYRMQ 1259

Query: 1260 QLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHILE 1319
             LRRALP IVVKGL DI+RAVINIRD+GKRELLVEGYGLRDVM TDGV+G KT TNH+LE
Sbjct: 1260 HLRRALPSIVVKGLPDIARAVINIRDNGKRELLVEGYGLRDVMCTDGVIGSKTTTNHVLE 1319

Query: 1320 VYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRD 1379
            V SVLGIEAARASI+GEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMRD
Sbjct: 1320 VNSVLGIEAARASIIGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1379

Query: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQL 1439
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKVVK T++    L
Sbjct: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVKDTHIRNGTL 1439

Query: 1440 KPKPTLFESLVNETSVKVN 1458
            KPK TLFESL  ET++K+N
Sbjct: 1440 KPKRTLFESLCKETNIKIN 1458

>Ecym_5525 Chr5 complement(1063773..1068152) [4380 bp, 1459 aa] {ON}
            similar to Ashbya gossypii AER252C
          Length = 1459

 Score = 2488 bits (6448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1185/1459 (81%), Positives = 1307/1459 (89%), Gaps = 1/1459 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV   APKKI GL FSALSA+DIVAQSEVEI TRDLFDLENGRAPK GGALD KMGV
Sbjct: 1    MKEVVVDVAPKKIKGLHFSALSASDIVAQSEVEIFTRDLFDLENGRAPKQGGALDSKMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSS  EC TCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQ ICK C++ILL + +K
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQSICKNCAAILLSEEEK 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            + FL+ELRRPG+DNLRRM  L+KVLDQCKKQRRCL C                   KIIH
Sbjct: 121  RQFLAELRRPGIDNLRRMATLRKVLDQCKKQRRCLHCGALNGVVKKAATGSGSAALKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKKS PEKEKWIGDW+ VL H+PELERY+KR MD+LNPLKTLNLFKQV+ +DCE
Sbjct: 181  DTFRWVGKKSAPEKEKWIGDWNQVLQHNPELERYMKRSMDNLNPLKTLNLFKQVRAQDCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGIDST+K+GRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTVKAGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKP-IRGFCQRLKGKQ 359
            AGLEKGISINNMME WDYLQ+AVAMYINSDSVNPA++ GGTGG     IRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQMAVAMYINSDSVNPALMPGGTGGGKTKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVV 419
            GRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVPDRVAKVLTYPERVTRYNK KLQQL++
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPDRVAKVLTYPERVTRYNKHKLQQLII 420

Query: 420  NGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLH 479
            NGPN +PGANY+LKK+EDARRNLR+GDR+KLAKN++IGD+VERH+EDGDVVLFNRQPSLH
Sbjct: 421  NGPNVHPGANYMLKKNEDARRNLRYGDRIKLAKNIQIGDVVERHIEDGDVVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNL 539
            RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+NL
Sbjct: 481  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKPC 599
            LTPKSGEPII+ATQDFITGSYLISHKDSFFD+   TQLLSMM+D  +QFD+PPP I KPC
Sbjct: 541  LTPKSGEPIISATQDFITGSYLISHKDSFFDRATFTQLLSMMADANMQFDLPPPAIIKPC 600

Query: 600  YLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILS 659
            YLWTGKQ+FSLLIRPNKKSPV++NLDAKNKVY+PPK+KS PNEMS NDG+V+IRGS+IL 
Sbjct: 601  YLWTGKQVFSLLIRPNKKSPVIINLDAKNKVYLPPKNKSFPNEMSSNDGYVIIRGSEILC 660

Query: 660  GVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAX 719
            GVMDKSVLGDGKKHSVFYTILRD+G  EAA+AMNRMAKLCARY+GNRGFSIGI+DVTP  
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPYEAAKAMNRMAKLCARYLGNRGFSIGINDVTPGK 720

Query: 720  XXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
                    MVE AYAKCDELIDLF +G+LETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 721  ELKAKKEEMVEIAYAKCDELIDLFKRGELETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 780  INELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKT 839
            I ELDN+NAPLIMATCGSKGS LNVSQMVAVVGQQIISG+RVPDGFQDRSLPHF KNSKT
Sbjct: 781  IRELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFAKNSKT 840

Query: 840  PQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYD 899
            PQSKGFVR+SFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC YD
Sbjct: 841  PQSKGFVRSSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 900  NTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQ 959
            NTVRTSSNG+VQFTYGGDGLDPL MEGNAQPVNFNR+WDHA N+TFNN + GLLPYQIM+
Sbjct: 901  NTVRTSSNGVVQFTYGGDGLDPLNMEGNAQPVNFNRSWDHANNITFNNEEPGLLPYQIME 960

Query: 960  VTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAK 1019
             +  IL PLE +L+R DN+GN I+ +     EYIDQNDAER FY SLR ++ AKA  LA+
Sbjct: 961  TSNSILVPLERQLLRLDNVGNAISADLGSNDEYIDQNDAERDFYQSLRTYMTAKAHRLAQ 1020

Query: 1020 FRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRA 1079
             R SK +K L++EPA EL+ +DLD +      +S++Q+ +I+  +V  FL +AI KY +A
Sbjct: 1021 IRKSKGLKSLLEEPAQELKYMDLDASASTADLNSINQLCKISYNLVTTFLNIAISKYHKA 1080

Query: 1080 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139
            KVEPGTAVGAIGA SIGEPGTQMTLKTFHFAGVASMN+TLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAIGAHSIGEPGTQMTLKTFHFAGVASMNITLGVPRIKEIINASKVISTPII 1140

Query: 1140 NAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELT 1199
            NA+LVN++DERAARVVKGRIEKTLLSDV FYIQDVYRDN+S++QV+VDLSTI+KLQLELT
Sbjct: 1141 NALLVNDNDERAARVVKGRIEKTLLSDVVFYIQDVYRDNMSFIQVKVDLSTIEKLQLELT 1200

Query: 1200 IEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQ 1259
            IEDIA+A++RAPKLKI   DV I+GK+KI I+V  D  K KSISTL  EP+EN+VFYRMQ
Sbjct: 1201 IEDIAIAISRAPKLKISTGDVSIIGKNKINISVGNDLEKGKSISTLVSEPNENDVFYRMQ 1260

Query: 1260 QLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHILE 1319
             LRRALP IVVKGL DISRAVINI +DGKRELLVEGYGLRDVM+TDGV+G+KT TNH LE
Sbjct: 1261 HLRRALPNIVVKGLPDISRAVINILEDGKRELLVEGYGLRDVMTTDGVIGYKTKTNHFLE 1320

Query: 1320 VYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRD 1379
            V+ VLGIEAAR SI+ EIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMRD
Sbjct: 1321 VFEVLGIEAARTSIIDEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMRD 1380

Query: 1380 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQL 1439
            SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTG+FKVV+GTN+S ++L
Sbjct: 1381 SVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGSFKVVRGTNISMDEL 1440

Query: 1440 KPKPTLFESLVNETSVKVN 1458
            KP PTLFE+L N T++KV+
Sbjct: 1441 KPNPTLFENLCNNTALKVS 1459

>KNAG0B04240 Chr2 (806212..810579) [4368 bp, 1455 aa] {ON} Anc_5.426
            YOR116C
          Length = 1455

 Score = 2481 bits (6430), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1186/1460 (81%), Positives = 1303/1460 (89%), Gaps = 7/1460 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV  E  KKISG+EFSAL+AADIVAQSEVEI+TRDLFDLE GR  KTGGALD +MGV
Sbjct: 1    MKEVVVGETQKKISGIEFSALNAADIVAQSEVEITTRDLFDLEKGREQKTGGALDRRMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSSS EC TCHGNLASCHGHFGHIKLALPVFH+GYFK+TIQILQ ICK+CS++LL D D+
Sbjct: 61   SSSSQECMTCHGNLASCHGHFGHIKLALPVFHVGYFKSTIQILQCICKDCSAVLLSDKDR 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            + FL ELRRPG+DNLR+M ILKKV+DQCKKQRRCL+C                   KIIH
Sbjct: 121  RDFLKELRRPGIDNLRKMSILKKVIDQCKKQRRCLKCGGLNGVVKKAAAGAGTASLKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKK VPEK++WIG+W+ +L H PELER+VKRC DDLNPLKTL LFKQ+K EDCE
Sbjct: 181  DTFRWVGKKMVPEKDRWIGEWNEILTHHPELERFVKRCSDDLNPLKTLTLFKQLKSEDCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGI+ST++SGRPETYIWRYLPAPPVCIRPSV MQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGINSTVRSGRPETYIWRYLPAPPVCIRPSVTMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGT--GGKVKPIRGFCQRLKGK 358
            AGL KGISINNMMEHWDYLQL VAMYINSDSVNPA+L G +  GGKVKPIRGFCQRLKGK
Sbjct: 301  AGLAKGISINNMMEHWDYLQLTVAMYINSDSVNPAMLPGASSGGGKVKPIRGFCQRLKGK 360

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418
            QGRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVP  VAKVLT+PE+VTRYNK KLQQL+
Sbjct: 361  QGRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPQLVAKVLTFPEKVTRYNKRKLQQLI 420

Query: 419  VNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSL 478
            +NGP  +PGANYLLKK+E+ARRNLR+GD++KLAKNL+ GD+VERHLEDGDVVLFNRQPSL
Sbjct: 421  INGPTVHPGANYLLKKNEEARRNLRYGDKLKLAKNLQYGDVVERHLEDGDVVLFNRQPSL 480

Query: 479  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSN 538
            HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+N
Sbjct: 481  HRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD   +TQLLSMMSD  LQFDIPPP I KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDLGSLTQLLSMMSDAKLQFDIPPPAIMKP 600

Query: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658
             YLWTGKQ+FSLLIRPNKKSPVV+NLDAKNKVYIPPK KS PNEMS NDGFV+IRGS+IL
Sbjct: 601  YYLWTGKQVFSLLIRPNKKSPVVINLDAKNKVYIPPKDKSFPNEMSINDGFVIIRGSEIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718
            SGVMDKSVLGDGKKHSVFYTILRDYG QEAA  MNRMAKLCARY+GNRGFSIGISDVTP+
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQEAANTMNRMAKLCARYLGNRGFSIGISDVTPS 720

Query: 719  XXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
                     MV  AYAKCDELID+F  GKLETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  SDLRDKKEEMVRFAYAKCDELIDMFKNGKLETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838
            CINELDN+NAPLIMATCGSKGSTLNVSQMVAVVGQQIISG+RVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFQKNSK 840

Query: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898
            TPQSKGFVRNSFFSGLTPPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 841  TPQSKGFVRNSFFSGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958
            D+TVRTS+NGIVQFTYGGDGLDPL+MEGNA+PVNF R+WDHA N+TFN  + GLLPY+I+
Sbjct: 901  DDTVRTSANGIVQFTYGGDGLDPLDMEGNAKPVNFIRSWDHACNITFNKNETGLLPYEIV 960

Query: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018
            + T+ +L+PLE +L+RYDNLG  + KE  D   Y D++DAER FY SLR ++  KA  LA
Sbjct: 961  RETDNVLKPLEEKLIRYDNLGAVVPKELIDDERYADRHDAERAFYKSLRMYMQEKAARLA 1020

Query: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078
            + R ++ + E+          V     V  +++ SVDQVY+IT K V  FL +A+ KY R
Sbjct: 1021 QIRNTRGLLEMTQNGGDTSMEV-----VSSELQASVDQVYKITKKNVNAFLTIALHKYHR 1075

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI
Sbjct: 1076 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1135

Query: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198
            INAVLVNE DERAARVVKGRIEKTLLSD+AFYIQDVYR N+SYL++RVDL+TI+KLQLEL
Sbjct: 1136 INAVLVNEGDERAARVVKGRIEKTLLSDLAFYIQDVYRGNMSYLEIRVDLATIEKLQLEL 1195

Query: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258
            T+EDIAVA++RAPKLKIQ +D+HI+GKDKI +NV+P+G KAKSIST AKEPSENEVFY+M
Sbjct: 1196 TMEDIAVALSRAPKLKIQTTDIHILGKDKIHVNVYPEGMKAKSISTSAKEPSENEVFYKM 1255

Query: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318
            Q LRR+LP +VVKGL DISRAVINIRDDGKRELLVEGYGLR+VM TDGV+G KT+TNH+L
Sbjct: 1256 QTLRRSLPDVVVKGLPDISRAVINIRDDGKRELLVEGYGLREVMCTDGVIGSKTITNHVL 1315

Query: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378
            EV SVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGE+LGITRFGLSKMR
Sbjct: 1316 EVNSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEVLGITRFGLSKMR 1375

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438
            DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM++GTG+FKVVK  +VSE  
Sbjct: 1376 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSVGTGSFKVVKYNDVSERD 1435

Query: 1439 LKPKPTLFESLVNETSVKVN 1458
            LK +PTLFESL +ET++K N
Sbjct: 1436 LKVRPTLFESLASETAIKAN 1455

>TPHA0H01760 Chr8 complement(402254..406633) [4380 bp, 1459 aa] {ON}
            Anc_5.426 YOR116C
          Length = 1459

 Score = 2452 bits (6355), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1165/1453 (80%), Positives = 1309/1453 (90%), Gaps = 4/1453 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV SE PK+ISGLEFSALS +DI+AQSEVEISTRDLFDLENGRAP  GGALDPKMGV
Sbjct: 1    MKEVVISETPKRISGLEFSALSTSDIIAQSEVEISTRDLFDLENGRAPIEGGALDPKMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSS++EC TCHGNLASCHGHFGHIKL+LPVFH+GYFKATIQILQG+CK CS+ILL DTDK
Sbjct: 61   SSSTLECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQILQGVCKSCSAILLNDTDK 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            +HFL ELR+P +DNL+RM ILKK+LDQCKKQRRCL+C                   KIIH
Sbjct: 121  RHFLHELRKPDIDNLKRMSILKKILDQCKKQRRCLECGDLNGVVKRAATGSGSASLKIIH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKK+VPEK+KWIGDW+ VL ++PELE+++KRC DDLNPLKTLNLFKQ+K EDCE
Sbjct: 181  DTFRWVGKKNVPEKDKWIGDWNQVLTNNPELEKFIKRCTDDLNPLKTLNLFKQIKNEDCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            LLGIDST+ SGRPETYIWRYLPAPPVCIRPSVMMQDS ASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LLGIDSTVASGRPETYIWRYLPAPPVCIRPSVMMQDSSASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGG-KVKPIRGFCQRLKGKQ 359
            AGLEKGISINNMMEHWDYLQL+VAMYINSDSVN  ++ G  GG K KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEHWDYLQLSVAMYINSDSVNLLVMPGSNGGTKAKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVV 419
            GRFRGNLSGKRVDFSGRTVISPDPNLS+DEVAVP+ VAKVLTYPE+VTRYNK KLQ+LV+
Sbjct: 361  GRFRGNLSGKRVDFSGRTVISPDPNLSIDEVAVPELVAKVLTYPEKVTRYNKTKLQKLVM 420

Query: 420  NGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLH 479
            NGPN +PGANYLLK +E+ARRNLR+G+R KLAK LRIGD+VERHLEDGD+VLFNRQPSLH
Sbjct: 421  NGPNVHPGANYLLKSNEEARRNLRYGNRDKLAKQLRIGDIVERHLEDGDIVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHV-PQSEEARAEAINLMGVKSN 538
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNL    Q+EEARAEAINLMGVK+N
Sbjct: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLLCYQQTEEARAEAINLMGVKNN 540

Query: 539  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKP 598
            LLTPKSGEPIIAATQDFITGSYLISHKDSFFD+  +TQLLSMMSD  L+FDIPPP I+KP
Sbjct: 541  LLTPKSGEPIIAATQDFITGSYLISHKDSFFDRATLTQLLSMMSDANLKFDIPPPAIFKP 600

Query: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658
              LWTGKQIFSLLI+PNK+SPVV+NLDAKNKVYIPP++KS P+EMS NDG+V+IRGS+IL
Sbjct: 601  QCLWTGKQIFSLLIKPNKESPVVINLDAKNKVYIPPQNKSWPSEMSPNDGYVIIRGSEIL 660

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718
            SGVMDKSVLGDGKKHSVFYTILRDYG QE+A AMNRMAKLCARY+GNRGFSIGISDVTP 
Sbjct: 661  SGVMDKSVLGDGKKHSVFYTILRDYGPQESANAMNRMAKLCARYLGNRGFSIGISDVTPG 720

Query: 719  XXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
                     +VE AY KCDELI  ++KG+LETQPGCNEEQTLEAKIGGLLSKVREEVG+V
Sbjct: 721  EELKLKKEDLVEIAYKKCDELIIQYNKGELETQPGCNEEQTLEAKIGGLLSKVREEVGDV 780

Query: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838
            CINELDN+NAPLIMATCGSKGS LNVSQMVAVVGQQIISG+RVPDGFQDRSLPHF KNSK
Sbjct: 781  CINELDNLNAPLIMATCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFEKNSK 840

Query: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898
            TPQSKGFVRNSFF+GLTPPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC Y
Sbjct: 841  TPQSKGFVRNSFFTGLTPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQY 900

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIM 958
            DNT+RTSSNGIVQFTYGGDGLDPL+MEGNA+PVNF RTWDHA+N+TF+   +GLLPYQI+
Sbjct: 901  DNTIRTSSNGIVQFTYGGDGLDPLDMEGNAKPVNFKRTWDHASNITFDFNAKGLLPYQII 960

Query: 959  QVTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLA 1018
            + T  ILQPLEN LVRY+N+G  ++K++  + EY+DQ DA+R FY S+R+++  KA+ LA
Sbjct: 961  KQTNLILQPLENALVRYNNVGKPLSKKDYHKDEYVDQLDAKRDFYASIREYMVEKAEQLA 1020

Query: 1019 KFRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRR 1078
            K R ++ +KEL+ EPA ELQ +D DEN+P ++R  VD++ +I++  V++FL +AI KY R
Sbjct: 1021 KIRKARSLKELISEPAEELQHIDFDENIPSNVREVVDKLCKISEANVKKFLEIAISKYHR 1080

Query: 1079 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPI 1138
            AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASK ISTPI
Sbjct: 1081 AKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKTISTPI 1140

Query: 1139 INAVLVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLEL 1198
            I AVLVN+SD RAARVVKGRIEKTLLSDVA+YI+DVYRDN +++++++DLSTI+KLQLEL
Sbjct: 1141 IKAVLVNDSDRRAARVVKGRIEKTLLSDVAYYIEDVYRDNRTFIRIKIDLSTIEKLQLEL 1200

Query: 1199 TIEDIAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRM 1258
            TIEDIA+A+++APKLKI +S++HIVG DKIAI+VF +   +KSIST  KE SEN VFY+M
Sbjct: 1201 TIEDIAIAISKAPKLKIDSSNIHIVGNDKIAIDVFEEA--SKSISTSLKESSENTVFYKM 1258

Query: 1259 QQLRRALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318
            Q LRRALP +VVKGL+DISRAVINI+DD K ELLVEGYGLRDVM TDGV+G KT TNHIL
Sbjct: 1259 QTLRRALPDVVVKGLADISRAVINIKDDSKTELLVEGYGLRDVMCTDGVIGTKTSTNHIL 1318

Query: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378
            E+++VLGIEAAR+SIVGEIDYTMSNHGMSVDPRHIQLLGDVMT+KGE+LGITRFGLSKMR
Sbjct: 1319 EIFNVLGIEAARSSIVGEIDYTMSNHGMSVDPRHIQLLGDVMTFKGEVLGITRFGLSKMR 1378

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQ 1438
            DSVLQLASFEKTTDHLFDAAFYMKKD V+GVSECIILGQTM+IGTG+F VVK T VS EQ
Sbjct: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDEVKGVSECIILGQTMSIGTGSFNVVKHTVVSPEQ 1438

Query: 1439 LKPKPTLFESLVN 1451
            +KPK TLFESLV+
Sbjct: 1439 VKPKRTLFESLVS 1451

>Kwal_55.21459 s55 (846902..850348) [3447 bp, 1148 aa] {ON} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 1148

 Score = 1998 bits (5175), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 941/1144 (82%), Positives = 1027/1144 (89%), Gaps = 1/1144 (0%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            MKEVV   APK+I GLEFSALSA+DIV QS+VEISTRDLFDLENGR PK+GGALD +MGV
Sbjct: 1    MKEVVVDIAPKRIKGLEFSALSASDIVGQSKVEISTRDLFDLENGRKPKSGGALDTRMGV 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
            SSS  EC TCHGNLASCHGHFGHIKL+LPVFH+GYFKATIQ+LQ ICK C+++LL + DK
Sbjct: 61   SSSQAECSTCHGNLASCHGHFGHIKLSLPVFHVGYFKATIQVLQSICKSCAALLLSEEDK 120

Query: 121  KHFLSELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIH 180
            + FLSELRRPG+DNLRRMGILKKV+DQCKKQRRCL+C                   KI+H
Sbjct: 121  RQFLSELRRPGIDNLRRMGILKKVVDQCKKQRRCLRCGSLNGVVKKAAAGSGSASLKILH 180

Query: 181  DTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
            DTFRW GKKS PEK+KW+GDW +VL+H+PELERYVK+CMDDLNPLKTLNLFKQV PEDCE
Sbjct: 181  DTFRWVGKKSAPEKDKWVGDWKTVLSHNPELERYVKKCMDDLNPLKTLNLFKQVSPEDCE 240

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
            L+GIDST+KSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTE+VWTSSLIK
Sbjct: 241  LMGIDSTVKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEIVWTSSLIK 300

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGG-TGGKVKPIRGFCQRLKGKQ 359
            AGLEKGISINNMME WDYLQLAVAMYINSDSVNPA++ GG TGGK KPIRGFCQRLKGKQ
Sbjct: 301  AGLEKGISINNMMEQWDYLQLAVAMYINSDSVNPAMMPGGSTGGKTKPIRGFCQRLKGKQ 360

Query: 360  GRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVV 419
            GRFRGNLSGKRVDFSGRTV+SPDPNLS+DEVAVPDRVAKVLTYPE VTRYNK KLQQLV+
Sbjct: 361  GRFRGNLSGKRVDFSGRTVVSPDPNLSIDEVAVPDRVAKVLTYPEMVTRYNKAKLQQLVI 420

Query: 420  NGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLH 479
            NGPNE+PGANYLLKKDE+ARRNLR+GDR+KLAKNL+ GDLVERHLEDGDVVLFNRQPSLH
Sbjct: 421  NGPNEHPGANYLLKKDEEARRNLRYGDRIKLAKNLQYGDLVERHLEDGDVVLFNRQPSLH 480

Query: 480  RLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNL 539
            RLSILSH+AKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQ+EEARAEAINLMGVK+NL
Sbjct: 481  RLSILSHFAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQTEEARAEAINLMGVKNNL 540

Query: 540  LTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFDIPPPTIWKPC 599
            LTPKSGEPIIAATQDFITGSYLISHKDSF+ + +  QLLSMMSDG +QFDIPPP I KP 
Sbjct: 541  LTPKSGEPIIAATQDFITGSYLISHKDSFYSRAEFVQLLSMMSDGNMQFDIPPPAIMKPY 600

Query: 600  YLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILS 659
            Y+WTGKQ+FSLLIRPNKKS VV+NLDAKNKVYIPPK K LPNEMS NDGFV+IRGSQILS
Sbjct: 601  YMWTGKQVFSLLIRPNKKSSVVINLDAKNKVYIPPKHKHLPNEMSINDGFVVIRGSQILS 660

Query: 660  GVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAX 719
            GVMDKSVLGDGKKHSVFYTILRD+G +EAA AMNRMAKLCARY+GNRGFSIGI+DVTP  
Sbjct: 661  GVMDKSVLGDGKKHSVFYTILRDFGPKEAAYAMNRMAKLCARYLGNRGFSIGINDVTPGF 720

Query: 720  XXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
                    MVE AYAKCD+LID F+KGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC
Sbjct: 721  ELKNKKEVMVEDAYAKCDDLIDQFNKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 780

Query: 780  INELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKT 839
            I ELDN+N+ LIMA CGSKGS LNVSQMVAVVGQQIISG+RVPDGFQDRSLPHF KNSKT
Sbjct: 781  IKELDNLNSCLIMANCGSKGSNLNVSQMVAVVGQQIISGNRVPDGFQDRSLPHFLKNSKT 840

Query: 840  PQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYD 899
            PQSKGFVRNSFFSGL+PPEFL+HAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC YD
Sbjct: 841  PQSKGFVRNSFFSGLSPPEFLFHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCQYD 900

Query: 900  NTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQ 959
            NT+RTSSNGIVQFTYGGDGLDP++MEGNAQPVNF R+WDHA N+TFN+ D+ LLPYQIMQ
Sbjct: 901  NTIRTSSNGIVQFTYGGDGLDPIDMEGNAQPVNFTRSWDHANNITFNHSDKPLLPYQIMQ 960

Query: 960  VTEEILQPLENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAK 1019
             T  ILQPLE +LVRYDNLG  +    +DR E+IDQ+DAER FY SLR+++  KA  LAK
Sbjct: 961  QTNSILQPLEEKLVRYDNLGRTLDPSLQDRAEFIDQDDAERNFYKSLREYLHTKASHLAK 1020

Query: 1020 FRGSKDMKELMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRA 1079
             R  K +K+ +DEPA ELQS+DLDE  P  +  SVDQ+ +I+ K+V +FL +AI KY +A
Sbjct: 1021 IRSHKGLKQFLDEPAPELQSMDLDEGSPSALLASVDQLCKISSKLVAKFLEIAIFKYHKA 1080

Query: 1080 KVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1139
            KVEPGTAVGA+GA SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII
Sbjct: 1081 KVEPGTAVGAVGAHSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPII 1140

Query: 1140 NAVL 1143
            NAVL
Sbjct: 1141 NAVL 1144

>ZYRO0F05918g Chr6 (487056..492290) [5235 bp, 1744 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1744

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/1511 (34%), Positives = 768/1511 (50%), Gaps = 145/1511 (9%)

Query: 7    SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
            S AP + +  ++F   S  +I A S  +I   +  D    RA K GG  DP++G    S+
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEICAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRSL 65

Query: 66   ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFLS 125
            +CQTC   +  C GHFGHI+LA PVFHIG+     ++ + +C  C  +LL++ +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIHDT 182
            E  R  +   D+ +R      V   CK +   + C                        T
Sbjct: 120  EQMRQAIKIKDSKKR---FNAVWSLCKAK---MICDTDVPSDEDPTQLISRGGCGNAQPT 173

Query: 183  FRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCELL 242
             R  G K V     W  D +S     PE     +R    LN  + LN+FK + PED   L
Sbjct: 174  IRRDGLKLVG---SWKKDKNSGDNEEPE-----QRV---LNMEEILNIFKHISPEDSWKL 222

Query: 243  GIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIKAG 302
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +++  +  ++  
Sbjct: 223  GFNEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303  LEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRF 362
               G   + + E    LQ  VA Y+++D          +G  VK IR    RLKGK+GR 
Sbjct: 280  EHNGAPHHTIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRA---RLKGKEGRI 336

Query: 363  RGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGP 422
            RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  LV NGP
Sbjct: 337  RGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTMLVRNGP 396

Query: 423  NEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHRLS 482
            NE+PGA Y+++ + D R +LR+  R    + L+ G  VERH+ D D VLFNRQPSLH++S
Sbjct: 397  NEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHVIDNDPVLFNRQPSLHKMS 454

Query: 483  ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLLTP 542
            +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V   +++P
Sbjct: 455  MMAHKVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQIVSP 514

Query: 543  KSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMS-----DGALQFDIPPPTIWK 597
            +S +P +   QD + G   ++ +D+F +   + Q+L+M+      DG     IP P I K
Sbjct: 515  QSNKPCMGVVQDTLCGIRKLTLRDNFIE---LGQVLNMLYWVPDWDGV----IPTPAILK 567

Query: 598  PCYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQI 657
            P  LWTGKQ+ S+ I    K   +   D    +  P           +++G ++I G QI
Sbjct: 568  PKPLWTGKQLLSVAI---PKGIHLQRFDEGTTLLSP-----------KDNGMLVIDG-QI 612

Query: 658  LSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTP 717
            + GV+DK  +G      + + + R+ G Q  A   + + K+   +  + GFS GI D   
Sbjct: 613  IFGVVDKKTVGSSSG-GLIHVVTREKGPQVCATLFSNIQKVVNYWFLHCGFSTGIGDTIA 671

Query: 718  AXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777
                       +  A  K +++        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672  DGQTMRQITEAIAEAKVKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGR 731

Query: 778  VCINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNS 837
            +    L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732  LAEVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDD 791

Query: 838  KTPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCL 897
             +P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792  YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 898  YDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRTWDHATNVTFNNMDRGLLPY 955
            YD T R S   I+QF YG DG+D   +E  A       +R ++    +   N D  L P 
Sbjct: 852  YDGTTRNSLGNIIQFIYGEDGMDAAHIEKQAVETIGGSDRNFERRYRIDLLNPDYSLDPS 911

Query: 956  QIMQ-------------VTEEILQPLENR-LVRYDNLGNEITKENRDRIEYIDQN----- 996
             +               + EE  Q +E+R  +R   +  E+       I  I QN     
Sbjct: 912  LLESGSEIIGDLKLQSLLDEEYKQLVEDRKFLRRIFVDGEVNWPLPVNIRRIIQNAQQTF 971

Query: 997  --DAERGFYHSLRDFIWAKAQLLAKF---RGSKDMKELMDEPALELQSVDLDENVPEDIR 1051
              D  +    ++RD +W   +L  +    RG+  + +   E A+ L    +   +     
Sbjct: 972  RIDRSKPSDVTIRDVVWGVKELQERLLVVRGNSRIIKEAQEDAITLFCCLMRSRLAS--- 1028

Query: 1052 HSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAG 1111
              V Q YR+T +     L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHFAG
Sbjct: 1029 RRVIQEYRLTKQAFEWVLNNIEVQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG 1088

Query: 1112 VASMNVTLGVPRIKEIINASKVISTPIINAVLVNE--SDERAARVVKGRIEKTLLSDVAF 1169
            VAS  VT GVPR+KEI+N +K + TP + A L  +  +D+  A++++  IE T L  V  
Sbjct: 1089 VASKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPDYAADQEKAKLIRSVIEHTTLKSVTV 1148

Query: 1170 YIQDVYRD-----------------NLSYLQVRVDLSTIDK----LQLEL---TIEDIAV 1205
               ++Y D                 + S L    + S   +    L+LEL    + D  +
Sbjct: 1149 -ASEIYYDPDPRSTAIPEDEEIIQLHFSLLDDETEKSLAQQSPWLLRLELDRAAMNDKDL 1207

Query: 1206 AMTRAPKLKIQAS---DVHIVGKDKIAINVFPDG--AKAKSISTLAKEPSENEVFYRMQQ 1260
             M +  + KI+ +   D+ ++  +  A  +       + KS+  L  E  E+ +  +++ 
Sbjct: 1208 TMGQVGE-KIKETFKNDLFVIWSEDNAEQLIIRCRVVRPKSMD-LETEAEEDHMLKKIEN 1265

Query: 1261 LRRALPGIVVKGLSDISRAVINIRD------DGKRE------LLVEGYGLRDVMSTDGVV 1308
                L  I ++G+ +I R V+   D       G+ +      L  +G  L +VM+  GV 
Sbjct: 1266 T--MLENITLRGVENIERVVMMKYDRKVPSETGEYQKIPEWVLETDGVNLSEVMTVPGVD 1323

Query: 1309 GHKTVTNHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILG 1368
              +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G +  
Sbjct: 1324 ASRIYTNSFIDIMEVLGIEAGRAALYKEVFNVIASDGSYVNYRHMALLVDVMTTQGGLTS 1383

Query: 1369 ITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKV 1428
            +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGAF V
Sbjct: 1384 VTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAFDV 1443

Query: 1429 VKGTNVSEEQL 1439
            +    + EE L
Sbjct: 1444 M----IDEESL 1450

>Ecym_8065 Chr8 (139544..144775) [5232 bp, 1743 aa] {ON} similar to
            Ashbya gossypii ADR086C
          Length = 1743

 Score =  724 bits (1868), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/1499 (35%), Positives = 765/1499 (51%), Gaps = 136/1499 (9%)

Query: 7    SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
            S AP + I  ++F   S  ++ A S  +I   +  D    RA K GG  DP++G    + 
Sbjct: 7    SSAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLGSIDRNY 65

Query: 66   ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFLS 125
            +CQTC   +  C GHFGHI+LA PVFHIG+     ++ + +C  C  +LL++       +
Sbjct: 66   KCQTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE------YN 119

Query: 126  ELRRPGV---DNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIHDT 182
            EL R  +   D  RR      V   CK +   + C                        +
Sbjct: 120  ELMRQAIKIKDPKRR---FNAVWSLCKSK---MVCDTEVPSEDDPSKYISRGGCGNAQPS 173

Query: 183  FRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCELL 242
             R  G   V     W  D +S  +  PE     KR    L+  + LN+FK + PED   L
Sbjct: 174  IRKDGLSLVG---TWKKDKNSEDSDQPE-----KRI---LSAEEILNVFKHITPEDSLRL 222

Query: 243  GIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIKAG 302
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +++  +  ++  
Sbjct: 223  GFNEDF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANINVQRL 279

Query: 303  LEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRF 362
               G   + + E    LQ  VA Y+++D          +G  +K IR    RLKGK+GR 
Sbjct: 280  EINGSPQHVIQESESLLQFHVATYMDNDIAGQPQAVQKSGRPIKSIRA---RLKGKEGRI 336

Query: 363  RGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGP 422
            RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGP
Sbjct: 337  RGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 423  NEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHRLS 482
            NE+PGA Y+++ + D R +LR+  R    + L+ G  VERH+ D D VLFNRQPSLH++S
Sbjct: 397  NEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNRQPSLHKMS 454

Query: 483  ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLLTP 542
            +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V   +++P
Sbjct: 455  MMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPQQIVSP 514

Query: 543  KSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMS-----DGALQFDIPPPTIWK 597
            +S +P +   QD + G   ++ +D+F +   + Q+L+M+      DG     IP PTI K
Sbjct: 515  QSNKPCMGIVQDTLCGIRKMTLRDTFIE---LDQVLNMLYWIPDWDGV----IPKPTILK 567

Query: 598  PCYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQI 657
            P  LW+GKQ+ S+ I PN    + L    +   Y+ PK          ++G ++I G QI
Sbjct: 568  PKPLWSGKQLLSMAI-PNG---IHLQRFDEGTTYLSPK----------DNGMLIIDG-QI 612

Query: 658  LSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTP 717
            + GV+DK  +G      + + + R+ G Q  A+    + K+   ++ + GFSIGI D   
Sbjct: 613  IFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKLFGNIQKVVNYWLLHNGFSIGIGDTIA 671

Query: 718  AXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777
                       +  A  +  E+        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672  DEKTMREITEAIALAKKRVQEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGR 731

Query: 778  VCINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNS 837
                 L ++N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732  SAELNLRDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDD 791

Query: 838  KTPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCL 897
             +P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792  YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 898  YDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRTWDHATNVTFNNMDRGLLPY 955
            YD T R S   I+QF YG DG+D   +E  +       +  ++    +   N + GL P 
Sbjct: 852  YDGTTRNSLGNIIQFVYGEDGMDASHIEKQSIDTIPGSDLAFEKRYRIDLLNPEYGLDPS 911

Query: 956  QIMQVT-------------EEILQPLENR-LVRYDNLGNEITKENRDRIEYIDQN----- 996
             +   T             EE  Q +++R L+R   L  E        I  I QN     
Sbjct: 912  LLESATEIMGDLKLQNMLDEEYKQLVQDRQLLRSVFLDGEHNWPLPVNIRRIIQNAQQTF 971

Query: 997  --DAERGFYHSLRDFIWAKAQL---LAKFRGSKDMKELMDEPALELQSVDLDENVPEDIR 1051
              D  +    +++D +    +L   L   RGS ++ +   E A+ L    +   +     
Sbjct: 972  RIDTTKPTDLTIKDVVLGVRKLQDNLLVLRGSSNILKEAQENAVTLFCSLVRSRLAT--- 1028

Query: 1052 HSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAG 1111
              V   YR+T +  +  L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAG
Sbjct: 1029 RRVLTEYRLTKQTFQWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG 1088

Query: 1112 VASMNVTLGVPRIKEIINASKVISTPIINAVLVNE---SDERAARVVKGRIEKTLLSDVA 1168
            VAS  VT GVPR+KEI+N +K + TP +  V +NE   +D+  A++++  IE T L  V 
Sbjct: 1089 VASKKVTSGVPRLKEILNVAKNMKTPSL-TVYLNEDYAADQEKAKLIRSAIEHTTLKSVT 1147

Query: 1169 FYIQDVYRDNLSYLQVRVD-------LSTIDK-------------LQLEL---TIEDIAV 1205
               +  Y  + S   +  D        S +D+             L+LEL    + D  +
Sbjct: 1148 VSSEIYYDPDPSSTVIEEDEEIIQLHFSLMDEETENSLKHQSPWLLRLELDRAAMNDKDL 1207

Query: 1206 AMTRAPKLKIQAS---DVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQQLR 1262
             M +  + KI+ +   D+ ++  +  A N+       +   TL  E    E     +   
Sbjct: 1208 TMGQVGE-KIKETFKNDLFVIWSEDNAENLIIRCRVVRDPKTLDAEAEAEEDHMLKKIEN 1266

Query: 1263 RALPGIVVKGLSDISRAVINIRD------DGKRE------LLVEGYGLRDVMSTDGVVGH 1310
              L  I ++G+ DI+R V+   D       G+        L  +G  L +VM+  GV   
Sbjct: 1267 TMLESITLRGVQDITRVVMMKYDRKVPNETGEYHKVPEWVLETDGVNLSEVMTVPGVDPT 1326

Query: 1311 KTVTNHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGIT 1370
            +  TN  +++ +VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G ++ +T
Sbjct: 1327 RIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVT 1386

Query: 1371 RFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            R G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGAF V+
Sbjct: 1387 RHGFNRADTGALMRCSFEETVEILFEAGASAELDDCNGVSENVILGQMAPIGTGAFDVM 1445

>KAFR0B01060 Chr2 complement(197351..202408) [5058 bp, 1685 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1685

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/1517 (34%), Positives = 771/1517 (50%), Gaps = 157/1517 (10%)

Query: 7    SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
            S AP + +  ++F   S  ++ A S  ++   +  D    RA K GG  DP++G    ++
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKVRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILL-EDTDKKHFL 124
            +CQTC   +  C GHFGHI LA PVFH+G+     ++ + +C  C  +LL E  ++   +
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFISKIKKVCESVCMHCGKLLLDEHNEQMRQV 125

Query: 125  SELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIHDTFR 184
             +++ P     +R      V   CK +   + C                        T R
Sbjct: 126  LKIKDPK----KR---FNAVWSLCKTK---MICETDVPSENDPTQLISRGGCGNAQPTVR 175

Query: 185  WAGKKSVPEKEKWIGDW--DSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCELL 242
              G K        +G W  D   +   E E+ V      L   + LN+FK + PED   L
Sbjct: 176  KDGLK-------LVGSWKKDKATSDGEEPEQRV------LGVEEILNIFKHISPEDSTKL 222

Query: 243  GIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIKAG 302
            G D      RPE  I   LP PP  +RPS+   +S    EDDLT KL +++  +  ++  
Sbjct: 223  GFDEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303  LEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRF 362
               G   + + E    LQ  VA Y+++D          +G  VK IR    RLKGK+GR 
Sbjct: 280  EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRA---RLKGKEGRI 336

Query: 363  RGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGP 422
            RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QLV NGP
Sbjct: 337  RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 423  NEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHRLS 482
            NE+PGA Y+++ + D R +LR+  R    + L+ G  VERH+ D D VLFNRQPSLH++S
Sbjct: 397  NEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMS 454

Query: 483  ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLLTP 542
            ++SH  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V   +++P
Sbjct: 455  MMSHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 543  KSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFD--IPPPTIWKPCY 600
            +S +P +   QD + G  +++ KD+F +   +  +L  + D    +D  IP P I KP  
Sbjct: 515  QSNKPCMGIVQDTLCGIRILTLKDTFLEFDHVLNMLYWVPD----WDGIIPTPAILKPKP 570

Query: 601  LWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILSG 660
            LWTGKQI S  I    K   +   D    +  P           +++G ++I G QI+ G
Sbjct: 571  LWTGKQILSAAI---PKGIHLQRFDEGTTLLSP-----------KDNGMLIIDG-QIIFG 615

Query: 661  VMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAXX 720
            V+DK  +G      + + + R+ G Q  +     + K+   ++ + GFS GI D      
Sbjct: 616  VVDKKTVGSSSG-GLIHVVTREKGPQVCSRLFGNIQKVVNFWLLHNGFSTGIGDTIANGE 674

Query: 721  XXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
                    +  A  K +E+        L  + G    ++ E  +   L++ R++ G +  
Sbjct: 675  TIKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAE 734

Query: 781  NELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTP 840
              L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P
Sbjct: 735  VNLNDTNYVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFSKDDYSP 794

Query: 841  QSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDN 900
            +SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD 
Sbjct: 795  ESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDG 854

Query: 901  TVRTSSNGIVQFTYGGDGLDPLEMEGNA------QPVNFNRTWDHATNVTFNNMDRGL-- 952
            T R S   I+QF YG DG+D   +E  +          F + +        N++D  L  
Sbjct: 855  TTRNSLGNIIQFIYGEDGIDASHIEKQSLDTIGGSDAAFEKRYRIDLLKVENSLDPSLLE 914

Query: 953  --------LPYQIMQVTEEILQPLENRL----VRYDNLGNEITKENRDRIEYIDQNDAER 1000
                    L  Q++ + EE  Q +E+R     V  D   N     N   I  I QN A++
Sbjct: 915  SGSEITGDLKLQVL-LDEEYRQLVEDRAFLRKVFTDGESNWPLPVN---IRRIIQN-AQQ 969

Query: 1001 GFY--HS------LRDFIWAKAQLLAK---FRGSKDMKELMDEPALELQSVDLDENVPED 1049
             F   HS      +RD I    +L  K    RG  ++ +   + A+ L    +   +   
Sbjct: 970  TFRIDHSKPSDLTIRDIIKGVRELQEKLLVLRGKNEIVQQAQQDAITLFCCLVRSRLA-- 1027

Query: 1050 IRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHF 1109
                V Q YR+T +     +     ++ R+ V PG  VG + AQSIGEP TQMTL TFHF
Sbjct: 1028 -TRRVIQEYRLTKESFDWVINNIESQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHF 1086

Query: 1110 AGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNE--SDERAARVVKGRIEKTLLSDV 1167
            AGVAS  VT GVPR+KEI+N +K + TP +   L  +  +D+  A+ ++  IE T L  V
Sbjct: 1087 AGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEEKYAADQERAKYIRSAIEHTTLKSV 1146

Query: 1168 A-----FYIQD----VYRDNLSYLQVRVDL------STIDK-----LQLEL---TIEDIA 1204
                  +Y  D    V  D+   +Q+   L      +++D+     L+LEL    + D  
Sbjct: 1147 TVASEIYYDPDPRSTVIEDDEEIIQLHFSLLDEEMEASLDQQSPWLLRLELDRAAMNDKD 1206

Query: 1205 VAMTRAPKLKIQAS---DVHIV----GKDKIAIN---VFPDGAKAKSISTLAKEPSENEV 1254
            + M +  + +I+ +   D+ ++      +K+ I    V P G  A++      E  E+ +
Sbjct: 1207 LTMGQVGE-RIKETFKKDLFVIWSEDNAEKLIIRCRVVRPKGLDAET------EAEEDHM 1259

Query: 1255 FYRMQQLRRALPGIVVKGLSDISRAVINIRD------DGKRE------LLVEGYGLRDVM 1302
              +++     L  I ++G+ +I R V+   D       G+ +      L  +G  L +VM
Sbjct: 1260 LKKIENT--MLENITLRGVENIERVVMMKYDRKVPSKTGEFQKVPEWVLETDGVNLAEVM 1317

Query: 1303 STDGVVGHKTVTNHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTY 1362
            +  GV   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT 
Sbjct: 1318 TIPGVDTTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTC 1377

Query: 1363 KGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIG 1422
            +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IG
Sbjct: 1378 QGGLTSVTRHGFNRANTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIG 1437

Query: 1423 TGAFKVVKGTNVSEEQL 1439
            TGAF    G  + EE L
Sbjct: 1438 TGAF----GVMIDEESL 1450

>SAKL0F10472g Chr6 (808869..814061) [5193 bp, 1730 aa] {ON} highly
            similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1730

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 515/1496 (34%), Positives = 761/1496 (50%), Gaps = 130/1496 (8%)

Query: 7    SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
            S AP + I  ++F   S  ++ A S  +I   +  D    RA K GG  DP++G    + 
Sbjct: 7    SSAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLGSIDRNY 65

Query: 66   ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFLS 125
            +CQTC   +  C GHFGHI+LA PVFHIG+     ++ + +C  C  +LL++ +++   +
Sbjct: 66   KCQTCGEGMNDCPGHFGHIELAKPVFHIGFLSRIKKVCECVCMHCGKLLLDEHNEQMKQA 125

Query: 126  ELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIHDTFRW 185
               +        +  L KV   C+ +                          I  D    
Sbjct: 126  IKIKDPKRRFNAVWTLSKVKMICETEVPS----EDDPTKYISRGGCGNTQPSIRKDGLSL 181

Query: 186  AGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCELLGID 245
             G         W  D ++  A  PE     KR    ++  + LN+FK + PED   LG +
Sbjct: 182  VGT--------WKKDKNADDADQPE-----KRI---ISAEEVLNVFKHICPEDSWRLGFN 225

Query: 246  STIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIKAGLEK 305
                  RPE  +   LP PP  +RPS+   ++    EDDLT KL +++  +  ++     
Sbjct: 226  EDF--ARPEWMLLTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKANINVQRLEIN 282

Query: 306  GISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRFRGN 365
            G   + + E    LQ  VA Y+++D          +G  +K IR    RLKGK+GR RGN
Sbjct: 283  GSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSGRPIKSIRA---RLKGKEGRIRGN 339

Query: 366  LSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGPNEY 425
            L GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGPNE+
Sbjct: 340  LMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEH 399

Query: 426  PGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHRLSILS 485
            PGA Y+++ + D R +LR+  R    + L+ G  VERH+ D D VLFNRQPSLH++S+++
Sbjct: 400  PGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDNDPVLFNRQPSLHKMSMMA 457

Query: 486  HYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLLTPKSG 545
            H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V   +++P+S 
Sbjct: 458  HRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSN 517

Query: 546  EPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMS-----DGALQFDIPPPTIWKPCY 600
            +P +   QD + G   ++ +D+F +   + Q+L+M+      DG     IP PTI KP  
Sbjct: 518  KPCMGIVQDTLCGVRKMTLRDTFIE---LDQVLNMLYWVPDWDGV----IPTPTILKPKP 570

Query: 601  LWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILSG 660
            LW+GKQI S+ I    K   +   D    +  P           +++G +++ G QI+ G
Sbjct: 571  LWSGKQILSMAI---PKGIHLQRFDEGTTLLSP-----------KDNGMLIVDG-QIIFG 615

Query: 661  VMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAXX 720
            V+DK  +G      + + + R+ G Q  A   + + K+   ++ + GFSIGI D      
Sbjct: 616  VVDKKTVG-SSNGGLIHIVTREKGPQICARLFSNIQKVVNYWLLHNGFSIGIGDTIADQK 674

Query: 721  XXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI 780
                    +  A  K + +        L  + G    ++ E  +   L++ R++ G    
Sbjct: 675  TMREITEAIAVAKKKVENVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGRSAE 734

Query: 781  NELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTP 840
              L ++N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P
Sbjct: 735  VNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDDYSP 794

Query: 841  QSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDN 900
            +SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD 
Sbjct: 795  ESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDG 854

Query: 901  TVRTSSNGIVQFTYGGDGLDPLEMEGNA--QPVNFNRTWDHATNVTFNNMDRGLLPYQI- 957
            T R S   I+QF YG DG+D   +E  +       +R ++    +   N D  L P  + 
Sbjct: 855  TTRNSLGNIIQFIYGEDGMDAAHIEKQSIDTIAGSDRAFERRYRIDLLNPDNALDPSLLE 914

Query: 958  ------------MQVTEEILQPLEN-RLVRYDNLGNEITKENRDRIEYIDQNDAERGFY- 1003
                          + EE  Q +E+ R +R   +  E        I  I QN A++ F  
Sbjct: 915  SGSEMMGDLKLQASLDEEYRQLVEDRRFLRKIFVDGEQNWPLPVNIRRIIQN-AQQTFRI 973

Query: 1004 -H------SLRDFIWAKAQLLAK---FRGSKDMKELMDEPALELQSVDLDENVPEDIRHS 1053
             H      ++ D I+    L  K    RG  +M +     A+ L    L   +       
Sbjct: 974  DHTKPTDLTIHDVIYGVKDLQEKLLVLRGKSEMLQEAQTNAVTLFCCLLRSRLAS---RR 1030

Query: 1054 VDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1113
            V + Y++T +  +  L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VIEEYKLTKQTFQWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1114 SMNVTLGVPRIKEIINASKVISTPIINAVLVNE--SDERAARVVKGRIEKTLLSDVA--- 1168
            S  VT GVPR+KEI+N +K + TP +   L +E  +D+  A++++  IE T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTVYLESEESADQEKAKLIRSAIEHTTLKSVTVAS 1150

Query: 1169 --FYIQD----VYRDNLSYLQVRVDL------STIDK-----LQLEL---TIEDIAVAMT 1208
              +Y  D    V  D+   +Q+   L       ++D      L+LEL    + D  + M 
Sbjct: 1151 EIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEQSLDHQSPWLLRLELDRAAMNDKDLTMG 1210

Query: 1209 RAPKLKIQAS---DVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQQLRRAL 1265
            +  + KI+ +   D+ ++  +  A  +       +   TL  E    E     +     L
Sbjct: 1211 QVGE-KIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHMLKKIENTML 1269

Query: 1266 PGIVVKGLSDISRAVINIRD------DGKRE------LLVEGYGLRDVMSTDGVVGHKTV 1313
              I ++G+ DI+R V+   D       G+ +      L  +G  L +VMS  GV   +  
Sbjct: 1270 ESITLRGVEDITRVVMMKYDRKTPSATGEYQKVPEWVLETDGVNLAEVMSVPGVDSTRIY 1329

Query: 1314 TNHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFG 1373
            TN  +++ +VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G
Sbjct: 1330 TNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHG 1389

Query: 1374 LSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
             ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGAF V+
Sbjct: 1390 FNRSDTGALMRCSFEETVEILFEAGAAAELDNCRGVSENVILGQMAPIGTGAFDVM 1445

>KLLA0F05071g Chr6 complement(496371..501533) [5163 bp, 1720 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1720

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1499 (34%), Positives = 761/1499 (50%), Gaps = 136/1499 (9%)

Query: 7    SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
            S AP + I  ++F   S  ++   S  +I   +  D    +A K GG  DP++G    + 
Sbjct: 7    SSAPLRTIKEVQFGLFSPEEVRGISVAKIEFPETMDESQMKA-KIGGLNDPRLGSIDRNY 65

Query: 66   ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFLS 125
            +CQTC   +A C GHFGHI+LA PVFHIG+     ++ + +C  C  +LL++       +
Sbjct: 66   KCQTCGEGMAECPGHFGHIELAKPVFHIGFLSKIKKVCESVCMHCGKLLLDE------YN 119

Query: 126  ELRRPGV---DNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIHDT 182
            E  R  +   D  RR      V   CK +   + C                     I  +
Sbjct: 120  EQMRQAIKIKDPKRR---FNAVWTLCKAK---MVCETEVPSPDDPTVFLSRGGCGHIQPS 173

Query: 183  FRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCELL 242
             R  G   V     W  D ++  +  PE     KR    ++  + LN+FK + PED   L
Sbjct: 174  IRKDGLSLVG---TWKKDKNADDSDQPE-----KRI---ISAEEILNVFKHISPEDGWRL 222

Query: 243  GIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIKAG 302
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +++  +  ++  
Sbjct: 223  GFNEDFS--RPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANINVQKL 279

Query: 303  LEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRF 362
               G   + + E    LQ  VA Y+++D          +G  +K IR    RLKGK+GR 
Sbjct: 280  EINGSPQHVIQESESLLQFHVATYMDNDIAGQPQAVQKSGRPIKSIRA---RLKGKEGRI 336

Query: 363  RGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGP 422
            RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGP
Sbjct: 337  RGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 423  NEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHRLS 482
            NE+PGA Y++++  D R +LR+  R    + L+ G  VERH+ D D VLFNRQPSLH++S
Sbjct: 397  NEHPGAKYVIRESGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPSLHKMS 454

Query: 483  ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLLTP 542
            +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V   +++P
Sbjct: 455  MMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 543  KSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMS-----DGALQFDIPPPTIWK 597
            +S +P +   QD + G   ++ +D+F +   + Q+L+M+      DG     IP P I K
Sbjct: 515  QSNKPCMGIVQDTLCGIRKMTLRDTFIE---LDQVLNMLYWIPDWDGI----IPTPAILK 567

Query: 598  PCYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQI 657
            P  LW+GKQ+ S+ I PN    + L        ++ PK          ++G ++I G +I
Sbjct: 568  PVPLWSGKQVLSMAI-PNG---IHLQRFDDGTTFLSPK----------DNGMLIIDG-KI 612

Query: 658  LSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTP 717
            + GV+DK  +G      + + + R+ G +  A   + + K+   ++ + GFSIGI D   
Sbjct: 613  IFGVVDKKTVGSSSG-GLIHVVTREKGPEICARLFSNIQKVVNYWLLHNGFSIGIGDTIA 671

Query: 718  AXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777
                       +  A  K +++        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672  DEKTMREITEAIAVAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGR 731

Query: 778  VCINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNS 837
                 L ++N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732  SAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDD 791

Query: 838  KTPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCL 897
             +P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792  YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 898  YDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRTWDHATNVTFNNMDRGLLPY 955
            YD T R S   ++QF YG DG+D   +E  +       +  ++    +   N +  L P 
Sbjct: 852  YDGTTRNSLGNVIQFIYGEDGMDAAHIEKQSIDTIPGSDSAFERRYRIDLLNEEYALDPS 911

Query: 956  QIMQVTEEI----LQPLEN-------------RLVRYDNLGNEITKENRDRIEYIDQN-- 996
             +   +E I    LQ L N             R V  D   N     N  RI    Q   
Sbjct: 912  LLESGSEIIGDSKLQLLLNDEYKQLVDDRQILRRVFVDGEHNWPLPVNIKRIIQNSQQTF 971

Query: 997  --DAERGFYHSLRDFIWAKAQLLAKF---RGSKDMKELMDEPALELQSVDLDENVPEDIR 1051
              D  +    ++ D I    +L  K    RG  D+ +   + A+ L    L   +    R
Sbjct: 972  RIDQTKPTDLTIEDVISGVRKLQEKLLVVRGKSDILKEAQQNAITLFCCLLRSRLA--TR 1029

Query: 1052 HSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAG 1111
              +++ YR+  +     L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAG
Sbjct: 1030 RVIEE-YRLNRQTFDWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAG 1088

Query: 1112 VASMNVTLGVPRIKEIINASKVISTPIINAVLVNE--SDERAARVVKGRIEKTLLSDVA- 1168
            VAS  VT GVPR+KEI+N +K + TP +   L  E  +D+  A+ ++  IE T L  V  
Sbjct: 1089 VASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDPEYAADQEKAKEIRSAIEHTTLKSVTV 1148

Query: 1169 ----FYIQD----VYRDNLSYLQVRVDL------STIDK-----LQLEL-----TIEDIA 1204
                +Y  D    V  D+   +Q+   L       ++D      L+LEL     T +D+ 
Sbjct: 1149 ASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEKSLDYQSPWLLRLELDRAAMTDKDLT 1208

Query: 1205 VAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAK--EPSENEVFYRMQQLR 1262
            +        +   +D+ ++  +  A  +       +   TL    E  E+ +  +++   
Sbjct: 1209 MGQVGEKIKETFKNDLFVIWSEDNAEKLIIRCRVIRDPKTLDADVEAEEDHMLKKIEN-- 1266

Query: 1263 RALPGIVVKGLSDISRAVINIRD------DGKRE------LLVEGYGLRDVMSTDGVVGH 1310
              L  I ++G+ DI+R V+   D       G+        L  +G  L +VM+  GV G 
Sbjct: 1267 SMLEKITLRGVEDITRVVMMKYDRKVPSETGEYHKVPEWVLETDGVNLSEVMTVSGVDGS 1326

Query: 1311 KTVTNHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGIT 1370
            +  TN  +++ +VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G ++ +T
Sbjct: 1327 RIYTNSFIDIMNVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVT 1386

Query: 1371 RFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            R G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGAF V+
Sbjct: 1387 RHGFNRADTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVILGQMAPIGTGAFDVM 1445

>KNAG0C03970 Chr3 complement(778936..784101) [5166 bp, 1721 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1721

 Score =  711 bits (1835), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1513 (34%), Positives = 770/1513 (50%), Gaps = 150/1513 (9%)

Query: 7    SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
            S AP + +  ++F   S  ++ A S  +I   +  D    RA K GG  DP++G    ++
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILL-EDTDKKHFL 124
            +CQTC   ++ C GHFGHI LA PVFH+G+     ++ + +C  C  +LL E+ ++   +
Sbjct: 66   KCQTCQEGMSECPGHFGHIDLAKPVFHVGFITKIKKVCECVCMHCGKLLLDENNEQMRQV 125

Query: 125  SELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIHDTFR 184
              ++ P     +R      +   CK +   + C                        T R
Sbjct: 126  MAIKDPK----KRFNATWAL---CKTK---MVCETDVPSENDPTKLVSRGGCGNTQPTVR 175

Query: 185  WAGKKSVPEKEKWIGDWD---SVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCEL 241
              G K        +G W    ++    PE     +R    L+  + LN+FK +  ED   
Sbjct: 176  KDGLK-------LVGSWKRKKTIEGEEPE-----QRV---LSTEEILNIFKHISTEDFIR 220

Query: 242  LGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIKA 301
            LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +++  +  ++ 
Sbjct: 221  LGFNEEFS--RPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 277

Query: 302  GLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGR 361
                G   + + E    LQ  VA Y+++D          +G  VK IR    RLKGK+GR
Sbjct: 278  LEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRA---RLKGKEGR 334

Query: 362  FRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNG 421
             RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QLV NG
Sbjct: 335  IRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRNG 394

Query: 422  PNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHRL 481
            PNE+PGA Y+++++ D R +LR+  R    + L+ G  VERH+ D D VLFNRQPSLH++
Sbjct: 395  PNEHPGAKYVIRENGD-RIDLRYSKRAGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHKM 452

Query: 482  SILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLLT 541
            S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V   +++
Sbjct: 453  SMMAHKVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS 512

Query: 542  PKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFD--IPPPTIWKPC 599
            P+S +P +   QD + G  +++ +D+F +   +  +L  + D    +D  IP P I KP 
Sbjct: 513  PQSNKPCMGIVQDTLCGIRILTLRDTFLELDHVLNMLYWVPD----WDGVIPTPAILKPK 568

Query: 600  YLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILS 659
             LWTGKQI S+ I PN    + L    +    + PK          ++G ++I G QI+ 
Sbjct: 569  PLWTGKQILSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QIIF 613

Query: 660  GVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAX 719
            GV+DK  +G      + + + R+ G Q  A     + K+   ++ + GFS GI D     
Sbjct: 614  GVVDKKTVGSSSG-GLIHVVTREKGPQTCARLFGNIQKVVNFWLLHNGFSTGIGDTIADG 672

Query: 720  XXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVC 779
                     +  A  K +E+        L  + G    ++ E  +   L++ R++ G + 
Sbjct: 673  ATIKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLA 732

Query: 780  INELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKT 839
               L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +
Sbjct: 733  EVNLNDTNFVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDYS 792

Query: 840  PQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYD 899
            P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD
Sbjct: 793  PESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYD 852

Query: 900  NTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRTWDHATNVTFNNMDRGLLPYQI 957
            NT R S   ++QF YG DG+D   +E  +       +  ++    +   N+   L P  +
Sbjct: 853  NTTRNSLGNVIQFIYGEDGIDASYIEKQSLDTIGGSDAAFEKKYRIDLMNVQNSLDP-TL 911

Query: 958  MQVTEEILQPLENRLVRYDNLGNEITKENRDR-------------------IEYIDQNDA 998
            ++   EI   L+ + +    L  E  +  +DR                   I  I QN A
Sbjct: 912  LESGSEITGDLKLQTL----LDEEYKQLVKDRAFLRNVFVDGESNWPLPVNIRRIIQN-A 966

Query: 999  ERGFY--HS------LRDFIWAKAQLLAK---FRGSKDMKELMDEPALELQSVDLDENVP 1047
            ++ F   HS      +RD I +  +L +K    RG  ++ E     A+ L    +   + 
Sbjct: 967  QQTFRIDHSKPSDLTIRDIIDSVNELQSKLLVLRGKSEIIERAQTDAVTLFCCLVRSRLA 1026

Query: 1048 EDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLKTF 1107
                  V + YR+T +     L     ++ R+ V PG  VG + AQSIGEP TQMTL TF
Sbjct: 1027 ---TRRVLKEYRLTKEAFNWVLNNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTF 1083

Query: 1108 HFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNE--SDERAARVVKGRIEKTLLS 1165
            HFAGVAS  VT GVPR+KEI+N +K + TP +   L ++  SD+  A++++  IE T L 
Sbjct: 1084 HFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKLIRSAIEHTTLK 1143

Query: 1166 DVA-----FYIQD----VYRDNLSYLQVRVDL------STIDK-----LQLELTIEDIAV 1205
             V      +Y  D    V  ++   +Q+   L      S++D+     L+LEL   D A 
Sbjct: 1144 SVTVASEIYYDPDPRSTVIEEDEEIIQLHFSLLDDEMESSLDQQSPWLLRLEL---DRAA 1200

Query: 1206 AMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEP------SENEVFYRMQ 1259
               +   +      +    K+ + +    D A+   I      P      +E E  + ++
Sbjct: 1201 MNDKDLTMGQVGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAETEAEEDHMLK 1260

Query: 1260 QLRRA-LPGIVVKGLSDISRAVINIRD------DGKRE------LLVEGYGLRDVMSTDG 1306
            ++    L  I ++G+ +I R V+   D       G+ +      L  +G  L +VM   G
Sbjct: 1261 KIENTMLENITLRGVENIERVVMMKYDRKVPNESGEYQKVPEWVLESDGVNLAEVMQVPG 1320

Query: 1307 VVGHKTVTNHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEI 1366
            V   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G +
Sbjct: 1321 VDATRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGL 1380

Query: 1367 LGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAF 1426
              +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   IGTGAF
Sbjct: 1381 TSVTRHGFNRSNTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQMAPIGTGAF 1440

Query: 1427 KVVKGTNVSEEQL 1439
             V+    + EE L
Sbjct: 1441 DVM----IDEESL 1449

>YDL140C Chr4 complement(205360..210561) [5202 bp, 1733 aa] {ON}
            RPO21RNA polymerase II largest subunit B220, part of
            central core; phosphorylation of C-terminal heptapeptide
            repeat domain regulates association with transcription
            and splicing factors; similar to bacterial beta-prime
          Length = 1733

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1520 (34%), Positives = 771/1520 (50%), Gaps = 163/1520 (10%)

Query: 7    SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
            S AP + +  ++F   S  ++ A S  +I   +  D    RA K GG  DP++G    ++
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFLS 125
            +CQTC   +  C GHFGHI LA PVFH+G+     ++ + +C  C  +LL++ +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIHDT 182
            EL R  +   D+ +R   +  +   CK +   + C                        T
Sbjct: 120  ELMRQALAIKDSKKRFAAIWTL---CKTK---MVCETDVPSEDDPTQLVSRGGCGNTQPT 173

Query: 183  FRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCELL 242
             R  G K V     W  D  +  A  PEL          L+  + LN+FK +  +D   L
Sbjct: 174  IRKDGLKLV---GSWKKDRATGDADEPELRV--------LSTEEILNIFKHISVKDFTSL 222

Query: 243  GIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIKAG 302
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +++  +  ++  
Sbjct: 223  GFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303  LEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRF 362
               G   + + E    LQ  VA Y+++D          +G  VK IR    RLKGK+GR 
Sbjct: 280  EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRA---RLKGKEGRI 336

Query: 363  RGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGP 422
            RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGP
Sbjct: 337  RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 423  NEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHRLS 482
            NE+PGA Y+++   D R +LR+  R    + L+ G  VERH+ D D VLFNRQPSLH++S
Sbjct: 397  NEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMS 454

Query: 483  ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLLTP 542
            +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V   +++P
Sbjct: 455  MMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 543  KSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMS-----DGALQFDIPPPTIWK 597
            +S +P +   QD + G   ++ +D+F +   + Q+L+M+      DG     IP P I K
Sbjct: 515  QSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----IPTPAIIK 567

Query: 598  PCYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQI 657
            P  LW+GKQI S+ I PN    + L    +    + PK          ++G ++I G QI
Sbjct: 568  PKPLWSGKQILSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QI 612

Query: 658  LSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTP 717
            + GV++K  +G      + + + R+ G Q  A+    + K+   ++ + GFS GI D   
Sbjct: 613  IFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIA 671

Query: 718  AXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777
                       +  A  K  ++        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672  DGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGR 731

Query: 778  VCINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNS 837
            +    L ++N    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732  LAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDD 791

Query: 838  KTPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCL 897
             +P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792  YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 898  YDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRTWDHATNVTFNNMDRGLLPY 955
            YDNT R S   ++QF YG DG+D   +E  +       +  ++    V   N D  L P 
Sbjct: 852  YDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRVDLLNTDHTLDP- 910

Query: 956  QIMQVTEEILQPLENRLVRYDNLGNEITKENRDR-------------------IEYIDQN 996
             +++   EIL  L+ +++    L  E  +  +DR                   I  I QN
Sbjct: 911  SLLESGSEILGDLKLQVL----LDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQN 966

Query: 997  DAERGFY--H------SLRDFIWAKAQL---LAKFRGSKDMKELMDEPALELQSVDLDEN 1045
             A++ F+  H      +++D +     L   L   RG  ++ +     A+ L    L   
Sbjct: 967  -AQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSR 1025

Query: 1046 VPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLK 1105
            +       V Q YR+T +     L     ++ R+ V PG  VG + AQSIGEP TQMTL 
Sbjct: 1026 LA---TRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLN 1082

Query: 1106 TFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLV--NESDERAARVVKGRIEKTL 1163
            TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L   + +D+  A++++  IE T 
Sbjct: 1083 TFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTT 1142

Query: 1164 LSDVA-----FYIQD----VYRDNLSYLQVRVDL------STIDK-----LQLEL---TI 1200
            L  V      +Y  D    V  ++   +Q+   L       + D+     L+LEL    +
Sbjct: 1143 LKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRAAM 1202

Query: 1201 EDIAVAMTRAPKLKIQA--SDVHIV----GKDKIAIN---VFPDGAKAKSISTLAKEPSE 1251
             D  + M +  +   Q   +D+ ++      +K+ I    V P    A++      E  E
Sbjct: 1203 NDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAET------EAEE 1256

Query: 1252 NEVFYRMQQLRRALPGIVVKGLSDISRAVINIRD------------DGKRELLVEGYGLR 1299
            + +  +++     L  I ++G+ +I R V+   D            + +  L  +G  L 
Sbjct: 1257 DHMLKKIENT--MLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLS 1314

Query: 1300 DVMSTDGVVGHKTVTNHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDV 1359
            +VM+  G+   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DV
Sbjct: 1315 EVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDV 1374

Query: 1360 MTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM 1419
            MT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ  
Sbjct: 1375 MTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMA 1434

Query: 1420 AIGTGAFKVVKGTNVSEEQL 1439
             IGTGAF V+    + EE L
Sbjct: 1435 PIGTGAFDVM----IDEESL 1450

>Suva_4.104 Chr4
            complement(193257..193711,193754..193782,194161..198878)
            [5202 bp, 1733 aa] {ON} YDL140C (REAL)
          Length = 1733

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 517/1515 (34%), Positives = 770/1515 (50%), Gaps = 153/1515 (10%)

Query: 7    SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
            S AP + +  ++F   S  ++ A S  +I   +  D    RA K GG  DP++G    ++
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFLS 125
            +CQTC   +  C GHFGHI LA PVFH+G+     ++ + +C  C  +LL++ +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIHDT 182
            EL R  +   D  +R G +  +   CK +   + C                        T
Sbjct: 120  ELMRQALAIKDTKKRFGAIWTL---CKTK---MVCETDVPSENDPTQLVSRGGCGNTQPT 173

Query: 183  FRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCELL 242
             R  G K V     W  D  +  A  PEL          L+  + LN+FK +  +D   L
Sbjct: 174  VRKDGLKLV---GSWKKDRATGDADEPELRV--------LSTEEILNIFKHISAKDSSSL 222

Query: 243  GIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIKAG 302
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +++  +  ++  
Sbjct: 223  GFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303  LEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRF 362
               G   + + E    LQ  VA Y+++D          +G  VK IR    RLKGK+GR 
Sbjct: 280  EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRA---RLKGKEGRI 336

Query: 363  RGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGP 422
            RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGP
Sbjct: 337  RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 423  NEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHRLS 482
            NE+PGA Y+++   D R +LR+  R    + L+ G  VERH+ D D VLFNRQPSLH++S
Sbjct: 397  NEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMS 454

Query: 483  ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLLTP 542
            +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V   +++P
Sbjct: 455  MMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 543  KSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMS-----DGALQFDIPPPTIWK 597
            +S +P +   QD + G   ++ +D+F    ++ Q+L+M+      DG     IP P I K
Sbjct: 515  QSNKPCMGIVQDTLCGIRKLTLRDTFI---ELDQVLNMLYWVPDWDGV----IPTPAIIK 567

Query: 598  PCYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQI 657
            P  LW+GKQ+ S+ I PN    + L    +    + PK          ++G ++I G QI
Sbjct: 568  PKPLWSGKQVLSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QI 612

Query: 658  LSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTP 717
            + GV++K  +G      + + + R+ G Q  A+    + K+   ++ + GFS GI D   
Sbjct: 613  VFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIA 671

Query: 718  AXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777
                       +  A  K  ++        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672  DGPTMREITETIADAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGR 731

Query: 778  VCINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNS 837
            +    L ++N    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732  LAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAYGFVDRTLPHFSKDD 791

Query: 838  KTPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCL 897
             +P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792  YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 898  YDNTVRTSSNGIVQFTYGGDGLDPLEMEGNA------QPVNFNRTW-------DHATNVT 944
            YDNT R S   ++QF YG DG+D   +E  +          F + +       DH  + +
Sbjct: 852  YDNTTRNSLGNVIQFIYGEDGMDASHIEKQSLDTIGGSDAAFEKRYRIDLLNPDHILDPS 911

Query: 945  FNNMDRGLLPYQIMQV--TEEILQPLENR-LVRYDNLGNEITKENRDRIEYIDQNDAERG 1001
                   +L    +QV   EE  Q +++R  +R+  +  E        I  I QN A++ 
Sbjct: 912  LLESGSEILGDLKLQVLLDEEYKQLVKDRSFLRHIFVDGEANWPLPVNIRRIIQN-AQQT 970

Query: 1002 FY--H------SLRDFIWAKAQL---LAKFRGSKDMKELMDEPALELQSVDLDENVPEDI 1050
            F+  H      +++D +     L   L   RG  ++ +   + A+ L    L   +    
Sbjct: 971  FHIDHTKPSDLTIKDIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCLLRSRLAS-- 1028

Query: 1051 RHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFA 1110
               V Q Y++T +     L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFA
Sbjct: 1029 -RRVIQEYKLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1087

Query: 1111 GVASMNVTLGVPRIKEIINASKVISTPIINAVLV--NESDERAARVVKGRIEKTLLSDVA 1168
            GVAS  VT GVPR+KEI+N +K + TP +   L   + +D+  A+ ++  IE T L  V 
Sbjct: 1088 GVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEKAKFIRSAIEHTTLKSVT 1147

Query: 1169 -----FYIQD----VYRDNLSYLQVRVDL------STIDK-----LQLEL---TIEDIAV 1205
                 +Y  D    V  ++   +Q+   L       + D+     L+LEL    + D  +
Sbjct: 1148 IASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAMNDKDL 1207

Query: 1206 AMTRAPKLKIQA--SDVHIV----GKDKIAIN---VFPDGAKAKSISTLAKEPSENEVFY 1256
             M +  +   Q   +D+ ++      +K+ I    V P    A++      E  E+ +  
Sbjct: 1208 TMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAET------EAEEDHMLK 1261

Query: 1257 RMQQLRRALPGIVVKGLSDISRAVINIRD------------DGKRELLVEGYGLRDVMST 1304
            +++     L  I ++G+ +I R V+   D            + +  L  +G  L +VM+ 
Sbjct: 1262 KIENT--MLENITLRGVENIERVVMMKYDRKVPSPTGEYIKEPEWVLETDGVNLSEVMTV 1319

Query: 1305 DGVVGHKTVTNHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKG 1364
             G+   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G
Sbjct: 1320 PGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQG 1379

Query: 1365 EILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTG 1424
             +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG
Sbjct: 1380 GLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTG 1439

Query: 1425 AFKVVKGTNVSEEQL 1439
            AF V+    + EE L
Sbjct: 1440 AFDVM----IDEESL 1450

>Kwal_56.24489 s56 (1018237..1023423) [5187 bp, 1728 aa] {ON} YDL140C
            (RPO21) - RNA polymerase II large subunit [contig 161]
            FULL
          Length = 1728

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/1526 (34%), Positives = 771/1526 (50%), Gaps = 162/1526 (10%)

Query: 1    MKEVVSSEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMG 59
            M E   S AP + +  ++F   S  ++ A S  +I   +  D    RA K GG  DP++G
Sbjct: 1    MVEFPYSSAPLRTVKEVQFGMFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTD 119
                + +CQTC   +  C GHFGHI+LA PVFHIGY     ++ + +C  C  +LL++  
Sbjct: 60   SIDRNFKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH- 118

Query: 120  KKHFLSELRRPGV---DNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXX 176
                 SEL +  +   D  RR      V   CK +   + C                   
Sbjct: 119  -----SELMKQAIKIKDPKRR---FNAVWSLCKVK---MVCETEVPSDNDPSQYVSRGGC 167

Query: 177  KIIHDTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKP 236
                 + R  G   V     W  D  +  A  PE     +R    ++  + LN+FK + P
Sbjct: 168  GNTQPSVRKDGLSLVG---TWKKDKGADDADQPE-----RRI---ISADEVLNVFKHISP 216

Query: 237  EDCELLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTS 296
            ED   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT KL +++  +
Sbjct: 217  EDSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKAN 273

Query: 297  SLIKAGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLK 356
              ++     G   + + E    LQ  VA Y+++D          +G  +K IR    RLK
Sbjct: 274  INVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSGRPIKSIRA---RLK 330

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQ 416
            GK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L Q
Sbjct: 331  GKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVVTPYNIDRLTQ 390

Query: 417  LVVNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQP 476
            LV NGPNE+PGA Y+++ + D R +LR+  R    + L+ G  VERH+ D D VLFNRQP
Sbjct: 391  LVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDEDPVLFNRQP 448

Query: 477  SLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVK 536
            SLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V 
Sbjct: 449  SLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP 508

Query: 537  SNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMS-----DGALQFDIP 591
              +++ +S +P +   QD + G   ++ +D+F +   + Q+L+M+      DG     IP
Sbjct: 509  QQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIE---LEQVLNMLYWIPDWDGV----IP 561

Query: 592  PPTIWKPCYLWTGKQIFSLLIRPNKKSPVVLNLDA--KNKVYIPPKSKSLPNEMSQNDGF 649
             P I KP  LW+GKQI S+ I      P  ++L    +    + PK          ++G 
Sbjct: 562  TPIILKPKPLWSGKQILSIAI------PTGIHLQRFDEGTTLLSPK----------DNGM 605

Query: 650  VLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFS 709
            ++I G QI+ GV+DK  +G      + + + R+ G +  A   + + K+   ++ + GFS
Sbjct: 606  LIIDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQKVVNYWLLHNGFS 663

Query: 710  IGISDVTPAXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLS 769
            IGI D              +  A  K +E+        L  + G    ++ E  +   L+
Sbjct: 664  IGIGDTIADEKSMREITDAIVVAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLN 723

Query: 770  KVREEVGEVCINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRS 829
            + R++ G      L ++N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+
Sbjct: 724  EARDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRT 783

Query: 830  LPHFPKNSKTPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMK 889
            LPHF K+  +P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K
Sbjct: 784  LPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVK 843

Query: 890  SLEDLSCLYDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFN--- 946
            +LED+   YD T R S   ++QF YG DG+D   +E   Q ++     D A    F    
Sbjct: 844  ALEDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE--KQAIDTIACSDAAFERRFKIDL 901

Query: 947  -NMDRGLLPYQIMQVTEEILQPLENRLVRYDNLGNEITKENRDR---------------- 989
             N    L P  +++   EI+  L+ + +    L  E  + + DR                
Sbjct: 902  LNPKHALDP-SLLESGSEIIGDLKLQAL----LDEEFKQLSEDRQFLRKIFVDGEQNWPL 956

Query: 990  ---IEYIDQNDAERGFY--H------SLRDFIWAKAQLLAK---FRGSKDMKELMDEPAL 1035
               I  I QN A++ F   H      S+RD I+   +L  K    RG   + +     A+
Sbjct: 957  PVNIRRIIQN-AQQTFRIDHTKPTDLSIRDVIYGVKELQEKLLVLRGKSKILQEAQVNAV 1015

Query: 1036 ELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSI 1095
             L    L   +       V Q YR+  +     L     ++ R+ V PG  VG + AQSI
Sbjct: 1016 TLFCCLLRSRLAS---RRVIQEYRLNKQTFEWVLSNVEAQFLRSLVHPGEMVGVLAAQSI 1072

Query: 1096 GEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNE--SDERAAR 1153
            GEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  E  +D+  A+
Sbjct: 1073 GEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDEEHAADQEKAK 1132

Query: 1154 VVKGRIEKTLLSDVA-----FYIQD----VYRDNLSYLQVRVDL------STIDK----- 1193
            +++  IE T L  +      +Y  D    V  D+   +Q+   L       ++D      
Sbjct: 1133 LIRSAIEHTTLKSITVASEIYYDPDPRSTVIEDDEEIIQLHFSLMDEETEQSLDYQSPWL 1192

Query: 1194 LQLEL---TIEDIAVAMTRAPKLKIQAS---DVHIVGKDKIAINVFPDGAKAKSISTL-- 1245
            L+LEL    + D  + M +  + KI+ +   D+ ++  +  A  +       +   TL  
Sbjct: 1193 LRLELDRAAMNDKDLTMGQVGE-KIKETFKNDLFVIWSEDNAEKLVIRCRVVRDPKTLDA 1251

Query: 1246 AKEPSENEVFYRMQQLRRALPGIVVKGLSDISRAVINIRDDG------------KRELLV 1293
              E  E+ +  R++     L  I ++G+ DI+R V+   D              +  L  
Sbjct: 1252 EAEAEEDHMLKRIENT--MLESITLRGVEDITRVVMMKYDRKVPSPAGDYHKIPEWVLET 1309

Query: 1294 EGYGLRDVMSTDGVVGHKTVTNHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHI 1353
            +G  L +VM   GV   +  TN  +++ +VLGIEA RA++  E+   +++ G  V+ RH+
Sbjct: 1310 DGVNLAEVMCVPGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHM 1369

Query: 1354 QLLGDVMTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECI 1413
             LL DVMT +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE +
Sbjct: 1370 ALLVDVMTSQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSENV 1429

Query: 1414 ILGQTMAIGTGAFKVVKGTNVSEEQL 1439
            +LGQ   IGTGAF V+    + EE L
Sbjct: 1430 LLGQVAPIGTGAFDVM----IDEESL 1451

>Smik_4.95 Chr4 complement(182198..187357) [5160 bp, 1719 aa] {ON}
            YDL140C (REAL)
          Length = 1719

 Score =  708 bits (1828), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/1520 (34%), Positives = 771/1520 (50%), Gaps = 163/1520 (10%)

Query: 7    SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
            S AP + +  ++F   S  ++ A S  +I   +  D    RA K GG  DP++G    ++
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFLS 125
            +CQTC   +  C GHFGHI LA PVFH+G+     ++ + +C  C  +LL++ +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIHDT 182
            EL R  +   D+ +R   +  +   CK +   + C                        T
Sbjct: 120  ELMRQALAIKDSKKRFAAIWTL---CKTK---MVCETDVPSEDDPTQLVSRGGCGNTQPT 173

Query: 183  FRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCELL 242
             R  G K V     W  D  S  A  PEL          L+  + LN+FK +  +D   L
Sbjct: 174  VRKDGLKLVG---SWKKDRASGDAEEPELRV--------LSTEEILNIFKHISVKDFTSL 222

Query: 243  GIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIKAG 302
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +++  +  ++  
Sbjct: 223  GFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303  LEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRF 362
               G   + + E    LQ  VA Y+++D          +G  VK IR    RLKGK+GR 
Sbjct: 280  EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRA---RLKGKEGRI 336

Query: 363  RGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGP 422
            RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGP
Sbjct: 337  RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 423  NEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHRLS 482
            NE+PGA Y+++   D R +LR+  R    + L+ G  VERH+ D D VLFNRQPSLH++S
Sbjct: 397  NEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMS 454

Query: 483  ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLLTP 542
            +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V   +++P
Sbjct: 455  MMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 543  KSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMS-----DGALQFDIPPPTIWK 597
            +S +P +   QD + G   ++ +D+F +   + Q+L+M+      DG     IP P I K
Sbjct: 515  QSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----IPTPAIIK 567

Query: 598  PCYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQI 657
            P  LW+GKQI S+ I PN    + L    +    + PK          ++G ++I G QI
Sbjct: 568  PKPLWSGKQILSVAI-PNG---IHLQRFDEGTTLLSPK----------DNGMLIIDG-QI 612

Query: 658  LSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTP 717
            + GV++K  +G      + + + R+ G Q  A+    + K+   ++ + GFS GI D   
Sbjct: 613  IFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIA 671

Query: 718  AXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777
                       +  A  K  ++        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672  DGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGR 731

Query: 778  VCINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNS 837
            +    L ++N    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732  LAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDD 791

Query: 838  KTPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCL 897
             +P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792  YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 898  YDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRTWDHATNVTFNNMDRGLLPY 955
            YDNT R S   ++QF YG DG+D   +E  +       +  ++    +   N +  L P 
Sbjct: 852  YDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRIDLLNTEHILDP- 910

Query: 956  QIMQVTEEILQPLENRLVRYDNLGNEITKENRDR-------------------IEYIDQN 996
             +++   EIL  L+ +++    L  E  +  +DR                   I  I QN
Sbjct: 911  SLLESGSEILGDLKLQVL----LDEEYKQLVKDRKFLREVFVDGEANWPLPVNIRRIIQN 966

Query: 997  DAERGFY--H------SLRDFIWAKAQL---LAKFRGSKDMKELMDEPALELQSVDLDEN 1045
             A++ F+  H      +++D +     L   L   RG  ++ +     A+ L    L   
Sbjct: 967  -AQQTFHIDHTKPSDLTIKDIVLGVKDLQGSLLVLRGKNEIIQNAQRDAVTLFCCLLRSR 1025

Query: 1046 VPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLK 1105
            +       V Q YR+T +     L     ++ R+ V PG  VG + AQSIGEP TQMTL 
Sbjct: 1026 LA---TRRVLQEYRLTKQAFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLN 1082

Query: 1106 TFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLV--NESDERAARVVKGRIEKTL 1163
            TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L   + +D+  A++++  IE T 
Sbjct: 1083 TFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTT 1142

Query: 1164 LSDVA-----FYIQD----VYRDNLSYLQVRVDL------STIDK-----LQLEL---TI 1200
            L  V      +Y  D    V  ++   +Q+   L       + D+     L+LEL    +
Sbjct: 1143 LKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAM 1202

Query: 1201 EDIAVAMTRAPKLKIQA--SDVHIV----GKDKIAIN---VFPDGAKAKSISTLAKEPSE 1251
             D  + M +  +   Q   +D+ ++      +K+ I    V P    A++      E  E
Sbjct: 1203 NDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAET------EAEE 1256

Query: 1252 NEVFYRMQQLRRALPGIVVKGLSDISRAVINIRD------------DGKRELLVEGYGLR 1299
            + +  +++     L  I ++G+ +I R V+   D            + +  L  +G  L 
Sbjct: 1257 DHMLKKIENT--MLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLS 1314

Query: 1300 DVMSTDGVVGHKTVTNHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDV 1359
            +VM+  G+   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DV
Sbjct: 1315 EVMTVPGIDATRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDV 1374

Query: 1360 MTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM 1419
            MT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ  
Sbjct: 1375 MTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMA 1434

Query: 1420 AIGTGAFKVVKGTNVSEEQL 1439
             IGTGAF V+    + EE L
Sbjct: 1435 PIGTGAFDVM----IDEESL 1450

>KLTH0H02046g Chr8 complement(182788..188010) [5223 bp, 1740 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140C
          Length = 1740

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/1518 (34%), Positives = 771/1518 (50%), Gaps = 146/1518 (9%)

Query: 1    MKEVVSSEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMG 59
            M E   S AP + +  ++F   S  ++ A S  +I   +  D    RA K GG  DP++G
Sbjct: 1    MVEFPYSSAPLRTVKEVQFGIFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLG 59

Query: 60   VSSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTD 119
                + +CQTC   +  C GHFGHI+LA PVFHIGY     ++ + +C  C  +LL++  
Sbjct: 60   SIDRNYKCQTCGEGMNDCPGHFGHIELAKPVFHIGYISKIKKVCECVCMHCGKLLLDEH- 118

Query: 120  KKHFLSELRRPGV---DNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXX 176
                 SEL R  +   D  RR      V   CK +   + C                   
Sbjct: 119  -----SELMRQAIKIKDPKRR---FNAVWSLCKAK---MVCETEVPSDNDPAQYVSRGGC 167

Query: 177  KIIHDTFRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKP 236
                 + R  G   V     W  D  +  A  PE  R V      ++  + LN+FK + P
Sbjct: 168  GNTQPSVRKDGLSLVG---TWKKDKGADDADQPE--RRV------ISADEVLNVFKHISP 216

Query: 237  EDCELLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTS 296
            ED   LG +      RPE  I   LP PP  +RPS+   ++    EDDLT KL +++  +
Sbjct: 217  EDSVRLGFNEDF--ARPEWMILTVLPVPPPPVRPSISFNET-QRGEDDLTYKLGDILKAN 273

Query: 297  SLIKAGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLK 356
              ++     G   + + E    LQ  VA Y+++D          +G  +K IR    RLK
Sbjct: 274  INVQRLEINGSPQHVIQESEALLQFHVATYMDNDIAGQPQALQKSGRPIKSIRA---RLK 330

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQ 416
            GK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L Q
Sbjct: 331  GKEGRIRGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIARTLTYPEVVTPYNIDRLTQ 390

Query: 417  LVVNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQP 476
            LV NGPNE+PGA Y+++ + D R +LR+  R    + L+ G  VERH+ D D VLFNRQP
Sbjct: 391  LVRNGPNEHPGAKYIIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIIDEDPVLFNRQP 448

Query: 477  SLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVK 536
            SLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V 
Sbjct: 449  SLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP 508

Query: 537  SNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMS-----DGALQFDIP 591
              +++ +S +P +   QD + G   ++ +D+F +   + Q+L+M+      DG     IP
Sbjct: 509  QQIVSAQSNKPCMGIVQDTLCGVRKMTLRDTFIE---LDQVLNMLYWIPDWDGV----IP 561

Query: 592  PPTIWKPCYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVL 651
             P I KP  LW+GKQI S+ I     S + L    +    + PK          ++G ++
Sbjct: 562  TPIILKPKPLWSGKQILSIAI----PSGIHLQRFDEGTTLLSPK----------DNGMLI 607

Query: 652  IRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIG 711
            I G QI+ GV+DK  +G      + + + R+ G +  A   + + K+   ++ + GFSIG
Sbjct: 608  IDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPKICARLFSNLQKVVNFWLLHNGFSIG 665

Query: 712  ISDVTPAXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKV 771
            I D              +  A  K +E+        L  + G    ++ E  +   L++ 
Sbjct: 666  IGDTIADEKSMREITEAIIVAKRKVEEVTKEAQANLLTAKHGMTLRESFEDSVVRYLNEA 725

Query: 772  REEVGEVCINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLP 831
            R++ G      L ++N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LP
Sbjct: 726  RDKAGRSAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLP 785

Query: 832  HFPKNSKTPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSL 891
            HF K+  +P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+L
Sbjct: 786  HFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKAL 845

Query: 892  EDLSCLYDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTF------ 945
            ED+   YD T R S   ++QF YG DG+D   +E   Q ++   + D A    F      
Sbjct: 846  EDIMVHYDGTTRNSLGNVIQFIYGEDGMDAAHIE--KQTIDTIASSDAAFERRFRIDLLN 903

Query: 946  --NNMDRGLLP--YQIMQ-------VTEEILQPLENR-LVRYDNLGNEITKENRDRIEYI 993
              + +D  LL    +I+        + EE  Q +E+R  +R   +  E        I  I
Sbjct: 904  PRHALDPSLLESGSEIIGDLKLQALLDEEFKQLVEDREFLRKIFVDGEQNWPLPVNIRRI 963

Query: 994  DQN-------DAERGFYHSLRDFIWAKAQLLAK---FRGSKDMKELMDEPALELQSVDLD 1043
             QN       D  +    ++RD ++   +L  K    RG   + +   + A+ L    L 
Sbjct: 964  IQNAQQTFRIDQTKPTDLTIRDVVYGVKELQEKLLVLRGKSKILQEAQQNAVTLFCCLLR 1023

Query: 1044 ENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMT 1103
              +       V Q YR+  +     L     ++ R+ V PG  VG + AQSIGEP TQMT
Sbjct: 1024 SRLAT---RRVIQEYRLNKQTFEWVLSNVESQFLRSIVHPGEMVGVLAAQSIGEPATQMT 1080

Query: 1104 LKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNE--SDERAARVVKGRIEK 1161
            L TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  +  +D+  A++++  IE 
Sbjct: 1081 LNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLDKDHAADQEKAKLIRSAIEH 1140

Query: 1162 TLLSDVA-----FYIQD----VYRDNLSYLQVRVDL------STIDK-----LQLEL--- 1198
            T L  +      +Y  D    V  ++   +Q+   L       ++D      L+LEL   
Sbjct: 1141 TTLKSITVASEIYYDPDPRSTVIEEDEEIIQLHFSLMDEETEQSLDYQSPWLLRLELDRA 1200

Query: 1199 TIEDIAVAMTRAPKLKIQAS---DVHIVGKDKIAINVFPDGAKAKSISTL--AKEPSENE 1253
             + D  + M +  + KI+ +   D+ ++  +  A  +       +   TL    E  E+ 
Sbjct: 1201 AMNDKDLTMGQVGE-KIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDH 1259

Query: 1254 VFYRMQQLRRALPGIVVKGLSDISRAVINIRD------DGKRE------LLVEGYGLRDV 1301
            +  R++     L  I ++G+ DI+R V+   D       G+        L  +G  L +V
Sbjct: 1260 MLKRIENT--MLESITLRGVEDITRVVMMKYDRKVPSPTGEYHKVPEWVLETDGVNLAEV 1317

Query: 1302 MSTDGVVGHKTVTNHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMT 1361
            M   GV   +  TN  +++ +VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT
Sbjct: 1318 MCVPGVDPARIYTNSFIDIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMT 1377

Query: 1362 YKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAI 1421
             +G ++ +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   I
Sbjct: 1378 SQGFLMSVTRHGFNRSDTGALMRCSFEETVEILFEAGAAAELDDCRGVSENVLLGQVAPI 1437

Query: 1422 GTGAFKVVKGTNVSEEQL 1439
            GTGAF V+    + EE L
Sbjct: 1438 GTGAFDVM----IDEESL 1451

>NDAI0A02130 Chr1 complement(477808..482997) [5190 bp, 1729 aa] {ON}
            Anc_7.314
          Length = 1729

 Score =  703 bits (1815), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 509/1508 (33%), Positives = 760/1508 (50%), Gaps = 139/1508 (9%)

Query: 7    SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
            S AP + +  ++F   S  ++ A S  +I   +  D    RA K GG  DP++G    ++
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFLS 125
            +CQTC   +  C GHFGHI LA PV H+G+     ++ + +C  C  +LL++ +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVLHVGFIAKIKKVCESVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIHDT 182
            E  R  +   D+ +R      V + CK +   + C                        T
Sbjct: 120  EQMRQAIAIKDSKKR---FNAVWNLCKTK---MICDTDVPSDDDPTQLISRGGCGNAQPT 173

Query: 183  FRWAGKKSVP--EKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCE 240
             R  G K V   +KEK   D D       E E+ V      L+  + LN+FK + PED  
Sbjct: 174  VRKDGLKLVGSWKKEKNTNDGD-------EPEQRV------LSTEEILNIFKHISPEDST 220

Query: 241  LLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIK 300
             LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +++  +  ++
Sbjct: 221  RLGFNEEF--ARPEWMILNVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLE 277

Query: 301  AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQG 360
                 G   + + E    LQ  VA Y+++D          +G  VK IR    RLKGK+G
Sbjct: 278  TLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRA---RLKGKEG 334

Query: 361  RFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVN 420
            R RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QLV N
Sbjct: 335  RIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQLVRN 394

Query: 421  GPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHR 480
            GPNE+PGA Y+++ + D R +LR+  R    + L+ G  VERH+ D D VLFNRQPSLH+
Sbjct: 395  GPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHITDNDPVLFNRQPSLHK 452

Query: 481  LSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLL 540
            +S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V   ++
Sbjct: 453  MSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIV 512

Query: 541  TPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFD--IPPPTIWKP 598
            + +S +P +   QD + G   ++ +D+F +  ++  +L  + D    +D  IP P I KP
Sbjct: 513  SAQSNKPCMGIVQDTLCGIRKLTLRDTFLEFDEVLNMLYWVPD----WDGVIPTPAIIKP 568

Query: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658
              LW+GKQ+ S+ I       + L    +    + PK          ++G +++ G QI+
Sbjct: 569  KPLWSGKQVLSIAI----PRGIHLQRFDEGTTLLSPK----------DNGMLVVDG-QII 613

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718
             GV+DK  +G      + + + R+ G    A+    + K+   ++ + GFS GI D    
Sbjct: 614  FGVVDKKTVG-SSNGGLIHVVTREKGPTICAKLFGNIQKVVNFWLLHNGFSTGIGDTIAD 672

Query: 719  XXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
                      +  A  K +++        L  + G    ++ E  +   L++ R++ G +
Sbjct: 673  GSTIKEITETIADAKRKVEDVTKEAQSNLLTAKHGMTLRESFEDNVVRFLNEARDKAGRL 732

Query: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838
                L+++N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733  AEMNLNDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGYGFVDRTLPHFSKDDY 792

Query: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898
            +P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793  SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRTWDHATNVTFNNMDRGLLPYQ 956
            D T R S   ++QF YG DG+D   +E  +       +  ++    +   N    L P  
Sbjct: 853  DGTARNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDAAFEKRYRIDLMNPKNALDP-S 911

Query: 957  IMQVTEEI-----LQPL----------ENRLVRYDNLGNEITKENRDRIEYIDQNDAERG 1001
            +++   EI     LQ L          + + +R   +  E        I  I QN A++ 
Sbjct: 912  LLESGSEITGDVKLQSLLDEEYKQLIKDRKFLRKIFVDGESNWPLPVNIRRIIQN-AQQT 970

Query: 1002 FY--HS------LRDFIWAKAQL---LAKFRGSKDMKELMDEPALELQSVDLDENVPEDI 1050
            F   HS      +RD I+    L   L   RG  ++ +   + A+ L    +   +    
Sbjct: 971  FRIDHSKPSDLTIRDIIFGLKDLEERLLVLRGKSEIIQKAQDDAITLFCCLVRSRLS--- 1027

Query: 1051 RHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFA 1110
               + Q YR+T +     L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFA
Sbjct: 1028 TRRILQEYRLTKQAFEWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFA 1087

Query: 1111 GVASMNVTLGVPRIKEIINASKVISTPIINAVLVNE--SDERAARVVKGRIEKTLLSDVA 1168
            GVAS  VT GVPR+KEI+N +K + TP +   L ++  SD+  A+ ++  IE T L  + 
Sbjct: 1088 GVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDDYSSDQEKAKFIRSAIEHTTLKSIT 1147

Query: 1169 FYIQDVYRDNLSYLQVRVDLSTIDKLQLELTIEDIAVAMTRAPK--LKIQASDVHIVGKD 1226
                ++Y D      V  +   I +L   L  ++   ++ R     L+++     +  KD
Sbjct: 1148 V-ASEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEQSLDRQSPWLLRLELDRAAMNDKD 1206

Query: 1227 KIAINV----------------FPDGAKAKSISTLAKEP------SENEVFYRMQQLRRA 1264
                 V                  D A+   I      P      +E E  + ++++   
Sbjct: 1207 LTMGQVGERIKETFRNDLFVIWSEDNAEKLIIRCRVVRPKSMDAETEAEEDHMLKKIENT 1266

Query: 1265 -LPGIVVKGLSDISRAVINIRD------DGKRE------LLVEGYGLRDVMSTDGVVGHK 1311
             L  I ++G+ +I R V+   D       G+ +      L  +G  L +VM+  GV   +
Sbjct: 1267 MLENITLRGVENIERVVMMKYDRKVPSQSGEYQKVPEWVLETDGVNLSEVMTVPGVDATR 1326

Query: 1312 TVTNHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITR 1371
              TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G +  ITR
Sbjct: 1327 IYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMTTQGALTSITR 1386

Query: 1372 FGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKG 1431
             G ++     L  +SFE+T + LF+A    + D   GVSE ++LGQ   IGTGAF V+  
Sbjct: 1387 HGFNRASTGALMRSSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPIGTGAFDVM-- 1444

Query: 1432 TNVSEEQL 1439
              + EE L
Sbjct: 1445 --IDEESL 1450

>CAGL0I03828g Chr9 complement(328922..334069) [5148 bp, 1715 aa] {ON}
            highly similar to uniprot|P04050 Saccharomyces cerevisiae
            YDL140c RPO21 DNA-directed RNA polymerase II
          Length = 1715

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/1513 (34%), Positives = 761/1513 (50%), Gaps = 149/1513 (9%)

Query: 7    SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
            S AP + +  ++F   S  +I A S  +I   +  D    RA K GG  DP++G    ++
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEIRAISVAKIRLPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFLS 125
            +CQTC   +  C GHFGHI LA PVFHIG+     ++ + +C  C  +LL++ +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCESLCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIHDTFRW 185
            E  R  +           V   CK +   + C                        T R 
Sbjct: 120  EQMRQAIQIKDPKKRFNAVWSLCKTK---MVCETDVPSEDDPTKLISRGGCGNTQPTIRK 176

Query: 186  AGKKSVP--EKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCELLG 243
             G K V   +K+K  GD D       E E+ V      L+  + LN+FK + PED   LG
Sbjct: 177  DGLKLVGSWKKDKSTGDAD-------EPEQRV------LSTEEILNIFKHISPEDSYRLG 223

Query: 244  IDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIKAGL 303
             +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +++  +  ++   
Sbjct: 224  FNEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLE 280

Query: 304  EKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRFR 363
              G   + + E    LQ  VA Y+++D          +G  VK IR    RLKGK+GR R
Sbjct: 281  HNGAPHHAVEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRA---RLKGKEGRIR 337

Query: 364  GNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGPN 423
            GNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L QLV NGPN
Sbjct: 338  GNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLSQLVRNGPN 397

Query: 424  EYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHRLSI 483
            E+PGA Y+++ + D R +LR+  R    + L+ G  VERH+ D D VLFNRQPSLH++S+
Sbjct: 398  EHPGAKYVIRDNGD-RIDLRYSKRSGDVQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMSM 455

Query: 484  LSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLLTPK 543
            ++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V   +++P+
Sbjct: 456  MAHRVKVVPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQ 515

Query: 544  SGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMS-----DGALQFDIPPPTIWKP 598
            S +P +   QD + G   ++ +D+F +     Q+L+M+      DG     IP P I KP
Sbjct: 516  SNKPCMGIVQDTLCGIRKLTLRDTFLE---FDQVLNMLYWVPDWDGV----IPTPAIIKP 568

Query: 599  CYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQIL 658
              LW+GKQI S+ I    K   +   D    +  P           +++G ++I G +I+
Sbjct: 569  KPLWSGKQILSVAI---PKGIHLQRFDEGTTLLSP-----------KDNGMLVIDG-EII 613

Query: 659  SGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPA 718
             GV+DK  +G      + + + R+ G    A     + K+   ++ + GFS GI D    
Sbjct: 614  FGVVDKKTVGSSSG-GLIHVVTREKGPTICARLFGNIQKVVNFWLLHNGFSTGIGDTVAD 672

Query: 719  XXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEV 778
                      +  A  K + +        L  + G    ++ E  +   L++ R+  G +
Sbjct: 673  GQTMREISETIAEAKQKVEAVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDRAGRL 732

Query: 779  CINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSK 838
                L ++N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  
Sbjct: 733  AEMNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDRTLPHFSKDDY 792

Query: 839  TPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLY 898
            +P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   Y
Sbjct: 793  SPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHY 852

Query: 899  DNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRTWDHATNVTFNNMDRGLLPYQ 956
            D T R S   ++QF YG DG+D   +E  +       ++ ++    +   N    L P  
Sbjct: 853  DGTTRNSLGNVIQFIYGEDGMDAGHIEKQSLDTMGGSDQAFERRYRIDLLNTSNSLEP-S 911

Query: 957  IMQVTEEILQPLENRLVRYDNLGNEITKENR----------------DRIEYIDQNDAER 1000
            +++   EI+  L+ ++   D    ++ K+ R                  I  I QN A++
Sbjct: 912  LLESGSEIIGDLKVQMA-LDEEYKQLVKDRRFLRTIFSDGESSWPLPVNIRRIIQN-AQQ 969

Query: 1001 GF---------------YHSLRDFIWAKAQLLAKFRGSKDMKELMDEPALELQSVDLDEN 1045
             F                +S+RD    + +LL     S+ +K+  D+ A+ L    L   
Sbjct: 970  TFRIDHTKPSDLTIPEIINSVRDL---QDRLLVLRSKSEIIKKAQDD-AVTLFCCLLRSR 1025

Query: 1046 VPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLK 1105
            +       V Q YR+T +     L     ++ R+ V PG  VG + AQSIGEP TQMTL 
Sbjct: 1026 LA---TRRVLQEYRLTKEAFEWVLNNVEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLN 1082

Query: 1106 TFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNE--SDERAARVVKGRIEKTL 1163
            TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L  E  +D+  A++V+  IE T 
Sbjct: 1083 TFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPEYSADQEKAKLVRSAIEHTT 1142

Query: 1164 LSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELTIEDIAVAM-TRAPKL--------K 1214
            L  V     ++Y D      V  +   I +L   L  ++    +  ++P L         
Sbjct: 1143 LKSVTV-ASEIYYDPDPRSTVIPEDDEIIQLHFSLLDDETEKLLDQQSPWLLRLELDRAA 1201

Query: 1215 IQASDVHI--VG---KDKIAINVF----PDGAKAKSISTLAKEP------SENEVFYRMQ 1259
            +   D+ +  VG   KD    ++F     D A+   I      P      +E E  + ++
Sbjct: 1202 MNDKDLTMGQVGERIKDTFKNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEEDHMLK 1261

Query: 1260 QLRRA-LPGIVVKGLSDISRAVINIRD------DGKRE------LLVEGYGLRDVMSTDG 1306
            ++    L  I ++G+  I R V+   D       G+ +      L  +G  L +VM+  G
Sbjct: 1262 KIENTMLENITLRGIEGIERVVMMKYDRKVPNETGEYQKVPEWVLETDGVNLSEVMTVPG 1321

Query: 1307 VVGHKTVTNHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEI 1366
            V   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G +
Sbjct: 1322 VDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGL 1381

Query: 1367 LGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAF 1426
              +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTGAF
Sbjct: 1382 TSVTRHGFNRSSTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGAF 1441

Query: 1427 KVVKGTNVSEEQL 1439
             V+    + EE L
Sbjct: 1442 DVM----IDEESL 1450

>NCAS0A13900 Chr1 (2728572..2733722) [5151 bp, 1716 aa] {ON} Anc_7.314
          Length = 1716

 Score =  702 bits (1813), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/1518 (34%), Positives = 771/1518 (50%), Gaps = 148/1518 (9%)

Query: 1    MKEVVSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGV 60
            + E  SS   + +  ++F   S  ++   S  +I   +  D    RA K GG  DP++G 
Sbjct: 2    VSEQYSSAPLRTVKEVQFGLFSPEEVRGISVAKIRFPETMDETQTRA-KIGGLNDPRLGS 60

Query: 61   SSSSMECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDK 120
               +++CQTC   +  C GHFGHI LA PVFH+G+     ++ + +C  C  +LL++ ++
Sbjct: 61   IDRNLKCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKVCESVCMHCGKLLLDEHNE 120

Query: 121  KHFLSELRRPGV--DNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKI 178
                 ++R+     D+ +R      V   CK +   + C                     
Sbjct: 121  -----QMRQAMAIKDSKKR---FNAVWTLCKTK---MICETDVPSDDDPTTLISRGGCGN 169

Query: 179  IHDTFRWAGKKSVP--EKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKP 236
               + R  G K V   +KEK   D D       E E+ V      L+  + LN+FK + P
Sbjct: 170  AQPSIRKDGLKLVGSWKKEKNTSDGD-------EPEQRV------LSTEEILNIFKHISP 216

Query: 237  EDCELLGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTS 296
            ED   +G        RPE  I   LP PP  +RPS+   +S    EDDLT KL +++  +
Sbjct: 217  EDSTRMGFSEEF--ARPEWMILCVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKAN 273

Query: 297  SLIKAGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLK 356
              ++     G   + + E    LQ  VA Y+++D          +G  VK IR    RLK
Sbjct: 274  ISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRA---RLK 330

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQ 416
            GK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +A+ LTYPE VT YN  +L Q
Sbjct: 331  GKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIARTLTYPEVVTPYNIDRLTQ 390

Query: 417  LVVNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQP 476
            LV NGPNE+PGA Y+++ + D R +LR+  R    + L+ G  VERH+ D D VLFNRQP
Sbjct: 391  LVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQP 448

Query: 477  SLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVK 536
            SLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V 
Sbjct: 449  SLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVP 508

Query: 537  SNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMS-----DGALQFDIP 591
              +++ +S +P +   QD + G   ++ +D+F +     Q+L+M+      DG     IP
Sbjct: 509  LQIVSAQSNKPCMGIVQDTLCGIRKLTLRDTFIE---FDQVLNMLYWVPDWDGV----IP 561

Query: 592  PPTIWKPCYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVL 651
             P + KP  LWTGKQ+ S  I    K   +   D    +  P           +++G ++
Sbjct: 562  TPAVLKPKPLWTGKQVLSAAI---PKGIHLQRFDEGTTLLSP-----------KDNGMLV 607

Query: 652  IRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIG 711
            I G QI+ GV+DK  +G      + + + R+ G    A     + K+   ++ + GFS G
Sbjct: 608  IDG-QIIFGVVDKKTVGSSSG-GLIHVVTREKGPTICARLFGNIQKIVNFWLLHNGFSTG 665

Query: 712  ISDVTPAXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKV 771
            I D              +  A  K +++        L  + G    ++ E  +   L++ 
Sbjct: 666  IGDTIADGQTIKEITETIAEAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEA 725

Query: 772  REEVG---EVCINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDR 828
            R++ G   EV +N+L+N+     M + GSKGS +N++QM A VGQQ + G R+  GF DR
Sbjct: 726  RDKAGRLAEVNLNDLNNVKQ---MVSAGSKGSFINIAQMSACVGQQSVEGKRIGFGFVDR 782

Query: 829  SLPHFPKNSKTPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLM 888
            +LPHF K+  +P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+
Sbjct: 783  TLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLV 842

Query: 889  KSLEDLSCLYDNTVRTSSNGIVQFTYGGDGLDPLEMEGN------AQPVNFNRTW----- 937
            K+LED+   YD T R S   ++QF YG DG+D   +E           V F R +     
Sbjct: 843  KALEDIMVHYDGTTRNSLGNVIQFIYGEDGIDAAHIEKQTLDTIGGSDVAFERRYRIDLL 902

Query: 938  --DHATNVTF---NNMDRGLLPYQIMQVTEEILQPLEN-RLVRYDNLGNEITKENRDRIE 991
              +H+ + T     +   G L  Q + + EE  Q +E+ R +R   +  E        I 
Sbjct: 903  NPEHSLDPTLLESGSEIAGDLKLQAL-LDEEYKQLVEDRRFLREIFVDGESNWPLPVNIR 961

Query: 992  YIDQNDAERGFY--HS------LRDFIWAKAQL---LAKFRGSKDMKELMDEPALELQSV 1040
             I QN A++ F   HS      +RD ++   +L   L   RG  ++ E     A+ L   
Sbjct: 962  RIIQN-AQQTFRIDHSKPSDLTIRDIVFGIKELQEHLLVLRGKSEIIEKAQSDAITLFCC 1020

Query: 1041 DLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGT 1100
             +   +       + Q Y++T +  +  L     ++ R+ V PG  VG + AQSIGEP T
Sbjct: 1021 LVRSRLA---TRRILQEYKLTKQAFQWVLNNVESQFLRSVVHPGEMVGVLAAQSIGEPAT 1077

Query: 1101 QMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVN--ESDERAARVVKGR 1158
            QMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L +   SD+  A+ ++  
Sbjct: 1078 QMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLKDGYSSDQEKAKFIRSA 1137

Query: 1159 IEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELTIEDIAVAMTR-APKL---- 1213
            IE T L  +     ++Y D      V  +   I +L   L  ++   ++ R +P L    
Sbjct: 1138 IEHTTLKSITV-ASEIYYDPDPRSTVIPEDDEIIQLHFSLMDDETEQSLDRQSPWLLRLE 1196

Query: 1214 ----KIQASDVHI--VG---KDKIAINVF----PDGAKAKSISTLAKEP------SENEV 1254
                 +   D+ +  VG   K+    ++F     D A+   I      P      +E E 
Sbjct: 1197 LDRAAMNDKDLTMGQVGERIKETFKNDLFVIWSEDNAEKLIIRCRVVRPKSLDAETEAEE 1256

Query: 1255 FYRMQQLRRA-LPGIVVKGLSDISRAVINIRD------DGKRE------LLVEGYGLRDV 1301
             + ++++    L  I ++G+ +I R V+   D       G+ E      L  +G  L +V
Sbjct: 1257 DHMLKKIENTMLENITLRGVENIERVVMMKYDRKVPSATGEYEKVPEWVLETDGVNLSEV 1316

Query: 1302 MSTDGVVGHKTVTNHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMT 1361
            M+  G+   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT
Sbjct: 1317 MTVPGIDATRIYTNSFIDIMEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDVMT 1376

Query: 1362 YKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAI 1421
             +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE ++LGQ   I
Sbjct: 1377 TQGGLTSVTRHGFNRASTGALMRCSFEETVEILFEAGASAELDDCRGVSENVLLGQMAPI 1436

Query: 1422 GTGAFKVVKGTNVSEEQL 1439
            GTGAF V+    + EE L
Sbjct: 1437 GTGAFDVM----IDEESL 1450

>Skud_4.114 Chr4 complement(201053..206233) [5181 bp, 1726 aa] {ON}
            YDL140C (REAL)
          Length = 1726

 Score =  701 bits (1810), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 513/1520 (33%), Positives = 769/1520 (50%), Gaps = 163/1520 (10%)

Query: 7    SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
            S AP + +  ++F   S  ++ A S  +I   +  D    RA K GG  DP++G    ++
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFLS 125
            +CQTC   +  C GHFGHI LA PVFH+G+     ++ + +C  C  +LL++ +      
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHVGFIAKIKKLCECVCMHCGKLLLDEHN------ 119

Query: 126  ELRRPGV---DNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIHDT 182
            EL R  +   D+ +R   +  +   CK +   + C                        T
Sbjct: 120  ELMRQALAIKDSKKRFAAIWTL---CKTK---MVCETDVPSENDPTQLVSRGGCGNTQPT 173

Query: 183  FRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCELL 242
             R  G K V     W  D  S  A  PEL          L+  + LN+FK +  ED   L
Sbjct: 174  VRKDGLKLV---GSWKKDRASGDADEPELRV--------LSTEEILNIFKHISVEDFTSL 222

Query: 243  GIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIKAG 302
            G +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +++  +  ++  
Sbjct: 223  GFNEVFS--RPEWMILTCLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303  LEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRF 362
               G   + + E    LQ  VA Y+++D          +G  VK IR    RLKGK+GR 
Sbjct: 280  EHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRA---RLKGKEGRI 336

Query: 363  RGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGP 422
            RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGP
Sbjct: 337  RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 423  NEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHRLS 482
            NE+PGA Y+++   D R +LR+  R    + L+ G  VERH+ D D VLFNRQPSLH++S
Sbjct: 397  NEHPGAKYVIRDSGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMS 454

Query: 483  ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLLTP 542
            +++H   + P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V   +++P
Sbjct: 455  MMAHRVIVIPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 543  KSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMS-----DGALQFDIPPPTIWK 597
            +S +P +   QD + G   ++ +D+F +   + Q+L+M+      DG     IP P I K
Sbjct: 515  QSNKPCMGIVQDTLCGIRKLTLRDTFIE---LDQVLNMLYWVPDWDGV----IPTPAIIK 567

Query: 598  PCYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQI 657
            P  LW+GKQ+ S  I     S + L    +    + PK          ++G ++I G QI
Sbjct: 568  PKPLWSGKQVLSAAI----PSGIHLQRFDEGTTLLSPK----------DNGMLIIDG-QI 612

Query: 658  LSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTP 717
            + GV++K  +G      + + + R+ G Q  A+    + K+   ++ + GFS GI D   
Sbjct: 613  VFGVVEKKTVGSSNG-GLIHVVTREKGPQVCAKLFGNIQKVVNFWLLHNGFSTGIGDTIA 671

Query: 718  AXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777
                       +  A  K  ++        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672  DGPTMREITETIAEAKKKVFDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGR 731

Query: 778  VCINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNS 837
            +    L ++N    M   GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732  LAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDD 791

Query: 838  KTPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCL 897
             +P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792  YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 898  YDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRTWDHATNVTFNNMDRGLLPY 955
            YDNT R S   ++QF YG DG+D   +E  +       ++ ++    +   N +  L P 
Sbjct: 852  YDNTTRNSLGNVIQFIYGEDGMDAAHIEKQSLDTIGGSDKAFEKRYRIDLLNPEHILDP- 910

Query: 956  QIMQVTEEILQPLENRLVRYDNLGNEITKENRDR-------------------IEYIDQN 996
             +++   EIL  L+ +++    L  E  +  +DR                   I  I QN
Sbjct: 911  SLLESGSEILGDLKLQVL----LDEEYKQLVKDRKFLREVFVDGEANWPMPVNIRRIIQN 966

Query: 997  DAERGFY--H------SLRDFIWAKAQL---LAKFRGSKDMKELMDEPALELQSVDLDEN 1045
             A++ F+  H      ++++ +     L   L   RG  ++ +   + A+ L        
Sbjct: 967  -AQQTFHIDHTRPSDLTIKEIVIGVKDLQENLLVLRGKNEIIQNAQQDAVTLFCCLFRSR 1025

Query: 1046 VPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLK 1105
            +       + Q YR+T +     L     ++ R+ V PG  VG + AQSIGEP TQMTL 
Sbjct: 1026 LA---TRRILQEYRLTKQAFEWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLN 1082

Query: 1106 TFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLV--NESDERAARVVKGRIEKTL 1163
            TFHFAGVAS  VT GVPR+KEI+N +K + TP +   L   + +D+  A++++  IE T 
Sbjct: 1083 TFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYLEPGHAADQEQAKLIRSAIEHTT 1142

Query: 1164 LSDVA-----FYIQD----VYRDNLSYLQVRVDL------STIDK-----LQLEL---TI 1200
            L  V      +Y  D    V  ++   +Q+   L       + D+     L+LEL    +
Sbjct: 1143 LKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDDEAEQSFDQQSPWLLRLELDRAAM 1202

Query: 1201 EDIAVAMTRAPKLKIQA--SDVHIV----GKDKIAIN---VFPDGAKAKSISTLAKEPSE 1251
             D  + M +  +   Q   +D+ ++      +K+ I    V P    A++      E  E
Sbjct: 1203 NDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAET------EAEE 1256

Query: 1252 NEVFYRMQQLRRALPGIVVKGLSDISRAVINIRD------------DGKRELLVEGYGLR 1299
            + +  +++     L  I ++G+ +I R V+   D            + +  L  +G  L 
Sbjct: 1257 DHMLKKIENT--MLENITLRGVENIERVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLS 1314

Query: 1300 DVMSTDGVVGHKTVTNHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDV 1359
            +VM+  G+   +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DV
Sbjct: 1315 EVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDV 1374

Query: 1360 MTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM 1419
            MT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ  
Sbjct: 1375 MTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMA 1434

Query: 1420 AIGTGAFKVVKGTNVSEEQL 1439
             IGTGAF V+    + EE L
Sbjct: 1435 PIGTGAFDVM----IDEESL 1450

>TDEL0C02320 Chr3 complement(403851..409034) [5184 bp, 1727 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1727

 Score =  689 bits (1779), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/1499 (33%), Positives = 754/1499 (50%), Gaps = 144/1499 (9%)

Query: 7    SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
            S AP + +  ++F   S  ++ A S  +I   +  D    RA K GG  DP++G    ++
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFLS 125
            +CQTC   +  C GHFGHI LA PVFHIG+     ++ + +C  C  +LL+D ++     
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHIGFITKIKKVCECVCMHCGKLLLDDHNE----- 120

Query: 126  ELRRPGV--DNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIHDTF 183
            ++R+     D+ +R   +  +   CK +   + C                        T 
Sbjct: 121  QMRQACKIKDSKKRFNAIWTL---CKTK---MICESDVPSEEDPTKLISRGGCGNAQPTV 174

Query: 184  RWAGKKSVP--EKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCEL 241
            R  G K V   +KEK  GD        PE        M+++     LN+FK +  ED   
Sbjct: 175  RKDGLKLVGSWKKEKNTGD--------PEEPEQRILTMEEI-----LNIFKHISKEDSNR 221

Query: 242  LGIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIKA 301
            LG +      RPE  I   LP PP  +RPS+   +S    EDDLT KL +++  +  ++ 
Sbjct: 222  LGFNEEF--ARPEWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLET 278

Query: 302  GLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGR 361
                G   + + E    LQ  VA Y+++D          +G  VK IR    RLKGK+GR
Sbjct: 279  LEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRA---RLKGKEGR 335

Query: 362  FRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNG 421
             RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  LV NG
Sbjct: 336  IRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTFLVRNG 395

Query: 422  PNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHRL 481
            PNE+PGA Y+++ + D R +LR+  R    + L+ G  VERH+ D D VLFNRQPSLH++
Sbjct: 396  PNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKM 453

Query: 482  SILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLLT 541
            S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V   +++
Sbjct: 454  SMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVS 513

Query: 542  PKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMS-----DGALQFDIPPPTIW 596
            P+S +P +   QD + G   ++ +D+F +   + Q+L+M+      DG     IP P I 
Sbjct: 514  PQSNKPCMGIVQDTLCGIRKLTLRDNFIE---LDQVLNMLYWVPDWDGV----IPTPAII 566

Query: 597  KPCYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQ 656
            KP  LWTGKQI S+ I    K   +   D    +  P           +++G ++I G +
Sbjct: 567  KPKPLWTGKQILSIAI---PKGIHLQRFDEGTTLLSP-----------KDNGMLIIDG-K 611

Query: 657  ILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVT 716
            I+ GV+DK  +G      + + + R+ G Q  A     + K+   +  + GFS GI D  
Sbjct: 612  IIFGVVDKKTVGSSSG-GLIHVVTREKGPQICARLFGNIQKVVNYWFLHNGFSTGIGDTI 670

Query: 717  PAXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG 776
                        +  A  K +++        L  + G    ++ E  +   L++ R++ G
Sbjct: 671  ADGQTMREITETIADAKKKVEDVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAG 730

Query: 777  EVCINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKN 836
             +    L ++N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+
Sbjct: 731  RLAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKD 790

Query: 837  SKTPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSC 896
              +P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+LED+  
Sbjct: 791  DYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMV 850

Query: 897  LYDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRTWDHATNVTFNNMDR---- 950
             YD+T R S   ++QF YG DG+D   +E  A       +  ++    +   N D     
Sbjct: 851  HYDSTTRNSLGNVIQFVYGEDGMDASHIEKQAIDTIGGSDSAFEKRYRIDLLNPDHLLDP 910

Query: 951  ----------GLLPYQIMQVTEEILQPLENRL----VRYDNLGNEITKENRDRIEYIDQN 996
                      G L  Q++ + EE  Q +E+R     V  D   N     N  RI    Q 
Sbjct: 911  SLLESGSEIVGDLKLQVL-LDEEYKQLVEDRFFLRSVFVDGEPNWPLPVNIRRIVQNAQQ 969

Query: 997  ----DAERGFYHSLRDFIWAKAQLLAK---FRGSKDMKELMDEPALELQSVDLDENVPED 1049
                D  +    S+RD  +A   L  K    RG+ ++ +   + A+ L    +   +   
Sbjct: 970  TFRIDHTKPSDLSIRDVYFAVKNLQDKLLVLRGNSEIIKNAQQDAVSLFCCLMRSRLA-- 1027

Query: 1050 IRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHF 1109
             R  +++ YR+T +     L    +++ R+ V PG  VG + AQSIGEP TQMTL TFHF
Sbjct: 1028 TRRVIEE-YRLTKQAFEWVLNNIEIQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHF 1086

Query: 1110 AGVASMNVTLGVPRIKEIINASKVISTPIINAVLVN---------ESDERAARVVKG--- 1157
            AGVAS  VT GVPR+      +K I + I +  L +         + D R+  + +    
Sbjct: 1087 AGVASKKVTSGVPRLXXXXEKAKFIRSAIEHTTLKSVTVASEIYYDPDPRSTVIAEDEEI 1146

Query: 1158 -RIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELTIEDIAVAMTRAPKLKIQ 1216
             ++  +LL D      +   D  S   +R++L        +LT+  +   +    K    
Sbjct: 1147 IQLHFSLLDDET----EKSLDQQSPWLLRLELDRAAMNDKDLTMGQVGEKIKETFK---- 1198

Query: 1217 ASDVHIV----GKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQQLRRALPGIVVKG 1272
             +D+ ++      +K+ I       K+  I T   E  E+ +  +++     L  I ++G
Sbjct: 1199 -NDLFVIWSEDNAEKLIIRCRVVRPKSMDIET---EAEEDHMLKKIENT--MLENITLRG 1252

Query: 1273 LSDISRAVINIRD------DGKRE------LLVEGYGLRDVMSTDGVVGHKTVTNHILEV 1320
            + +I R V+   D       G+        L  +G  L +VM+  GV   +  TN  +++
Sbjct: 1253 VENIERVVMMKYDRKVPSATGEYHKVPEWVLETDGVNLSEVMTVPGVDSKRIYTNSFIDI 1312

Query: 1321 YSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDS 1380
              VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G +  +TR G ++    
Sbjct: 1313 MEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSATG 1372

Query: 1381 VLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQL 1439
             L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+    + EE L
Sbjct: 1373 ALMRCSFEETVEILFEAGACAEMDDCRGVSENVILGQMAPIGTGSFDVM----IDEESL 1427

>TPHA0A03070 Chr1 complement(671766..676925) [5160 bp, 1719 aa] {ON}
            Anc_7.314 YDL140C
          Length = 1719

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 506/1520 (33%), Positives = 749/1520 (49%), Gaps = 163/1520 (10%)

Query: 7    SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
            S AP + +  ++F   S  ++ + S  +I   +  D    RA K GG  DP++G    ++
Sbjct: 7    SSAPLRTVKEVQFGLFSPEEVRSISVAKIKFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66   ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILL-EDTDKKHFL 124
            +CQTC   +  C GHFGHI LA PVFHIG+     ++ + IC  C  +LL E+ ++   +
Sbjct: 66   KCQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDENNEQMRQV 125

Query: 125  SELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIHDTFR 184
              ++    D+ +R   +  +   CK +     C                        T R
Sbjct: 126  MSIK----DSKKRFNAIWTL---CKTK---TVCETDVPSEDDPTQLISRGGCGNAQPTIR 175

Query: 185  WAGKKSVPEKEKWIGDW--DSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCELL 242
              G K        +G W  D       E E+ V      LN  + LN+FK +   D   L
Sbjct: 176  KDGLK-------LVGSWKKDKATNDGDEPEQRV------LNTEEILNIFKHISVHDSNTL 222

Query: 243  GIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIKAG 302
            G +      RP+  I   LP PP  +RPS+   +S    EDDLT KL +++  +  ++  
Sbjct: 223  GFNEQF--ARPDWMILTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETL 279

Query: 303  LEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRF 362
               G   + + E    LQ  +A Y+++D          +G  VK IR    RLKGK+GR 
Sbjct: 280  EHNGAPHHAIEEAESLLQFHIATYMDNDIAGQPQALQKSGRPVKSIRA---RLKGKEGRI 336

Query: 363  RGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGP 422
            RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGP
Sbjct: 337  RGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 423  NEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHRLS 482
            NE+PGA Y+++ + D R +LR+  R    + L+ G  VERH+ D D VLFNRQPSLH++S
Sbjct: 397  NEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMS 454

Query: 483  ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLLTP 542
            +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V   +++P
Sbjct: 455  MMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCSVPLQIVSP 514

Query: 543  KSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMS-----DGALQFDIPPPTIWK 597
            +S +P +   QD + G   ++ +D F +   + QLL+M+      DG     IP P I K
Sbjct: 515  QSNKPCMGIVQDTLCGIRKLTLRDCFIE---LDQLLNMLYWVPDWDGI----IPTPAIIK 567

Query: 598  PCYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQI 657
            P  LW+GKQI S+ I    K   +   D    +  P           +++G ++I G QI
Sbjct: 568  PVPLWSGKQILSIAI---PKGIHLQRFDEGTTMLSP-----------KDNGMLIIDG-QI 612

Query: 658  LSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTP 717
            + GV+DK  +G      + + + R+ G Q  A+    + K+   +  + GFS GI D   
Sbjct: 613  IFGVVDKKTVGSSNG-GLIHVVTREKGPQICAKMFGNIQKVVNFWFLHNGFSTGIGDTIA 671

Query: 718  AXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVG- 776
                       +  A  K +E+        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672  DGGTMKEITETIADAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGR 731

Query: 777  --EVCINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFP 834
              EV +N+L+N+     M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF 
Sbjct: 732  LAEVNLNDLNNVKQ---MVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFS 788

Query: 835  KNSKTPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDL 894
            K+  +P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+LED+
Sbjct: 789  KDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDI 848

Query: 895  SCLYDNTVRTSSNGIVQFTYGGDGLDPLEMEGNA------QPVNFNRTWDHATNVTFNNM 948
               YD+T R S   ++QF YG DG+D   +E  +          F + +        + +
Sbjct: 849  MVHYDSTTRNSLGNVIQFVYGEDGIDAGHIEKQSIDTIGGSDAAFEKRYRIDLMSPNHAL 908

Query: 949  DRGLLPYQIMQVTEEILQPL----------ENRLVRYDNLGNEITKENRDRIEYIDQNDA 998
            D  LL   +    +  LQ +          + R +R   +  E        I  I QN A
Sbjct: 909  DPSLLESGLEITGDVKLQSILDTEYKQLVDDRRFLRNVFIDGEPNWHLPVNIRRIIQN-A 967

Query: 999  ERGFY--HS----------LRDFIWAKAQLLAKFRGSKDMKELMDEPALEL-----QSVD 1041
            ++ F   H+          +RD    +  LL   RG   + E     A+ L     +S  
Sbjct: 968  QQTFRIDHTKPSDLTINEVIRDVARLQENLLV-LRGKGKIIEEAQNDAITLFCCLVRSRL 1026

Query: 1042 LDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQ 1101
                V ++ R +      + + +  +FLR  +       V    ++G    Q        
Sbjct: 1027 AVRRVLQEYRLTKQAFQWVLNNIESQFLRSIVHPGEMVGVLAAQSIGEPATQ-------- 1078

Query: 1102 MTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNE--SDERAARVVKGRI 1159
            MTL TFHFAGVAS  VT GVPR+KEI+N +K + TP     L  E  +D+  A++++  I
Sbjct: 1079 MTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSSTVYLDPEYATDQEKAKIIRSAI 1138

Query: 1160 EKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELTIEDIAVAM-TRAPK-LKIQA 1217
            E T L  V     ++Y D      V  +   I +L   L   +    +  ++P  L+++ 
Sbjct: 1139 EHTTLKSVTV-ASEIYYDPDPTTTVIAEDEEIIQLHYSLMDSETEKNIDNQSPWLLRLEL 1197

Query: 1218 SDVHIVGKDKIAINVFPDGAKAKS-----ISTLAKEPSENEVFYRMQQLR---------- 1262
                +  KD   + V   G K K      +S +  E + +++  R + +R          
Sbjct: 1198 DRAAMNDKDLTMVQV---GEKIKETFRNDLSVIWSEDNADKLIIRCRVVRPKSLDAETEA 1254

Query: 1263 -----------RALPGIVVKGLSDISRAVINIRD------DGKRE------LLVEGYGLR 1299
                         L  I ++G+ DI R V+   D       G+ +      L  +G  L 
Sbjct: 1255 EEDHMLKKIENTMLESITLRGVEDIERVVMMKYDRKMPSETGEYQKVPEWVLETDGVNLM 1314

Query: 1300 DVMSTDGVVGHKTVTNHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDV 1359
            +VM+  GV G +  TN  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DV
Sbjct: 1315 EVMTVPGVDGSRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGSYVNYRHMALLVDV 1374

Query: 1360 MTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM 1419
            MT +G +  +TR G ++     L   SFE+T + LF+A    + D   GVSE +ILGQ  
Sbjct: 1375 MTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMA 1434

Query: 1420 AIGTGAFKVVKGTNVSEEQL 1439
             IGTGAF V+    + EE L
Sbjct: 1435 PIGTGAFDVM----IDEESL 1450

>Kpol_162.1 s162 complement(211..4146) [3936 bp, 1311 aa] {ON}
            complement(211..4146) [3936 nt, 1312 aa]
          Length = 1311

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/1173 (36%), Positives = 623/1173 (53%), Gaps = 121/1173 (10%)

Query: 346  KPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPER 405
            +P++    RLKGK+GR RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE 
Sbjct: 2    RPVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEV 61

Query: 406  VTRYNKGKLQQLVVNGPNEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLE 465
            VT YN  +L QLV NGPNE+PGA Y+++ + D R +LR+  R    + L+ G  VERH+ 
Sbjct: 62   VTPYNIDRLTQLVRNGPNEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIM 119

Query: 466  DGDVVLFNRQPSLHRLSILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEA 525
            D D VLFNRQPSLH++S+++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE 
Sbjct: 120  DNDPVLFNRQPSLHKMSMMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEET 179

Query: 526  RAEAINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMS--- 582
            RAE   L  V   +++P+S +P +   QD + G   ++ +DSF +     Q+L+M+    
Sbjct: 180  RAELSQLCAVPMQIVSPQSNKPCMGIVQDTLCGIRKLTLRDSFIE---FDQVLNMLYWVP 236

Query: 583  --DGALQFDIPPPTIWKPCYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLP 640
              DG     IP P I KP  LWTGKQI S+ I    K   +   D    +  P       
Sbjct: 237  DWDGV----IPQPAILKPKPLWTGKQILSIAI---PKGIHLQRFDEGTTMLSP------- 282

Query: 641  NEMSQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCA 700
                +++G ++I G QI+ GV+DK  +G      + + + R+ G Q  A+    + K+  
Sbjct: 283  ----KDNGMLVIDG-QIVFGVVDKKTVGSSSG-GLIHVVTREKGPQVCAKMFGNIQKVVN 336

Query: 701  RYVGNRGFSIGISDVTPAXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTL 760
             ++ + GFS GI D              +  A  K +E+        L  + G    ++ 
Sbjct: 337  FWLLHNGFSTGIGDTIADGETMKEITETIAEAKKKVEEVTKEAQANLLTAKHGMTLRESF 396

Query: 761  EAKIGGLLSKVREEVGEVCINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSR 820
            E  +   L++ R++ G +    L++ N    M + GSKGS +N++QM A VGQQ + G R
Sbjct: 397  EDNVVRFLNEARDKAGRLAEVNLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKR 456

Query: 821  VPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAET 880
            +  GF DR+LPHF K+  +P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAET
Sbjct: 457  IAFGFVDRTLPHFSKDDYSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAET 516

Query: 881  GYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTYGGDGLDPLEMEGNAQPV--NFNRTWD 938
            GY+ RRL+K+LED+   YD+T R S   ++QF YG DG+D   +E  +       N+ ++
Sbjct: 517  GYIQRRLVKALEDIMVHYDSTTRNSLGNVIQFVYGEDGIDASYIEKQSIDTIGGSNQAFE 576

Query: 939  HATNVTF----NNMDRGLLP--------YQIMQVTEEILQPLEN--RLVRYDNLGNEITK 984
                +      +++D  LL          +I  + +E  + L N  R +R   +  E   
Sbjct: 577  KRYRIDLMSPEHSLDTTLLESGSEIIGDVKIQSMLDEEYKQLVNDRRFLRNVFIDGEQNW 636

Query: 985  ENRDRIEYIDQNDAERGFY--H------SLRDFIWAKAQLLAK---FRGSKDMKELMDEP 1033
                 I  I QN A++ F   H      ++RD ++   +L +K    RG   + E     
Sbjct: 637  PLPVNIRRIVQN-AQQTFRIDHTKPSDLTIRDVVYGVKELESKLLVLRGKSKIIEEAQND 695

Query: 1034 ALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQ 1093
            A+ L    L   +       V + YR+T +     L     ++ R+ V PG  VG + AQ
Sbjct: 696  AITLFCCLLRSRLAA---RRVLEEYRLTKQAFDWVLSNIESQFLRSIVHPGEMVGVLAAQ 752

Query: 1094 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEIINASKVISTPIINAVLVNES--DERA 1151
            SIGEP TQMTL TFHFAGVAS  VT GVPR+KEI+N +K + TP     L  E   D+  
Sbjct: 753  SIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSSTVYLEPEYAIDQEK 812

Query: 1152 ARVVKGRIEKTLLSDVA-----FYIQD----VYRDNLSYLQVRVDL------STIDK--- 1193
            A+ ++  IE T L  V      +Y  D    V  D+   +Q+   L        +D    
Sbjct: 813  AKFIRSAIEHTTLKSVTVASEIYYDPDPRSTVIPDDEEIIQLHFSLLDDETEKALDNQSP 872

Query: 1194 --LQLEL---TIEDIAVAMTRAPKLKIQAS---DVHIV----GKDKIAIN---VFPDGAK 1238
              L+LEL    + D  + M +  + KI+ +   D+ ++      DK+ I    V P    
Sbjct: 873  WLLRLELDRAAMNDKDLTMGQVGE-KIKETFKNDLFVIWSEDNADKLIIRCRVVRPKSLD 931

Query: 1239 AKSISTLAKEPSENEVFYRMQQLRRALPGIVVKGLSDISRAVINIRD------DGKRE-- 1290
            A++      E  E+ +  +++     L  I ++G+ DI R V+   D      +G  E  
Sbjct: 932  AET------EAEEDHMLKKIENT--MLESITLRGVEDIERVVMMKYDRKMPSENGAYEKV 983

Query: 1291 ----LLVEGYGLRDVMSTDGVVGHKTVTNHILEVYSVLGIEAARASIVGEIDYTMSNHGM 1346
                L  +G  L +VM+  GV   +  TN  +++  VLGIEA RA++  E+   +++ G 
Sbjct: 984  PEWVLETDGVNLLEVMTVTGVDPTRIYTNSFIDITEVLGIEAGRAALYREVYNVIASDGS 1043

Query: 1347 SVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFYMKKDAV 1406
             V+ RH+ LL DVMT +G +  +TR G ++     L   SFE+T + LF+A    + D  
Sbjct: 1044 YVNYRHMALLVDVMTTQGSLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDC 1103

Query: 1407 EGVSECIILGQTMAIGTGAFKVVKGTNVSEEQL 1439
             GVSE +ILGQ   +GTGAF V+    + EE L
Sbjct: 1104 RGVSENVILGQMAPVGTGAFDVM----IDEESL 1132

>Kwal_55.21464 s55 (850323..851285) [963 bp, 320 aa] {OFF} YOR116C
            (RPO31) - RNA polymerase III large subunit [contig 130]
            FULL
          Length = 320

 Score =  549 bits (1415), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 268/317 (84%), Positives = 294/317 (92%), Gaps = 1/317 (0%)

Query: 1143 LVNESDERAARVVKGRIEKTLLSDVAFYIQDVYRDNLSYLQVRVDLSTIDKLQLELTIED 1202
            LVN +DERAARVVKGRIEKTLLSDVAFYIQDVY+DNLS+LQV++DL TI+KLQLELTIED
Sbjct: 4    LVNMNDERAARVVKGRIEKTLLSDVAFYIQDVYKDNLSFLQVKIDLGTIEKLQLELTIED 63

Query: 1203 IAVAMTRAPKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQQLR 1262
            IAVA+TRA KLKI A DV I+GKDK+ INV+P+G+K KSIST AKEP ENE+FYR+Q LR
Sbjct: 64   IAVAITRASKLKIAAQDVSIIGKDKVNINVYPEGSKLKSISTSAKEPIENELFYRVQHLR 123

Query: 1263 RALPGIVVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVTNHILEVYS 1322
            R+LPGIVVKGL DI+RAVINI+ DG RELLVEGYGLRDVM+TDGVVGHKT TNHILEV S
Sbjct: 124  RSLPGIVVKGLPDIARAVINIKSDGSRELLVEGYGLRDVMTTDGVVGHKTKTNHILEVVS 183

Query: 1323 VLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVL 1382
            VLGIEAAR SIVGEIDYTMSNHGMSVDPRH+QLLGDVMTYKGE+LGITRFGLSKMRDSVL
Sbjct: 184  VLGIEAARTSIVGEIDYTMSNHGMSVDPRHVQLLGDVMTYKGEVLGITRFGLSKMRDSVL 243

Query: 1383 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVSEEQLKPK 1442
            QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTM+IGTGAFKVVKGTN+S E+LKPK
Sbjct: 244  QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMSIGTGAFKVVKGTNLSSEELKPK 303

Query: 1443 PTLFESLV-NETSVKVN 1458
             TLFESL  N  ++K+N
Sbjct: 304  ATLFESLCGNTAALKIN 320

>ADR086C Chr4 complement(860406..865643) [5238 bp, 1745 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL140C
           (RPO21)
          Length = 1745

 Score =  558 bits (1437), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 355/928 (38%), Positives = 503/928 (54%), Gaps = 64/928 (6%)

Query: 7   SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
           S AP + I  ++F   S  ++ A S  +I   +  D    RA K GG  DP++G    + 
Sbjct: 7   SSAPLRTIKEVQFGLFSPEEVRAISVAKIEFPETMDETQMRA-KVGGLNDPRLGSIDRNF 65

Query: 66  ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFLS 125
           +CQTC   +  C GHFGHI+LA PVFHIG+     ++ + +C  C  +LL++       +
Sbjct: 66  KCQTCGEGMNDCPGHFGHIELAKPVFHIGFISKIKKVCECVCMHCGKLLLDE------YN 119

Query: 126 ELRRPGV---DNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIHDT 182
           EL R  +   D  RR      V   CK +   + C                        +
Sbjct: 120 ELMRQAIKIKDPKRR---FNAVWSLCKAK---MVCDTEVPSEDDPSKYISRGGCGNAQPS 173

Query: 183 FRWAGKKSVPEKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCELL 242
            R  G   V     W  D ++  A  PE     KR    ++  + LN+FK + PED   L
Sbjct: 174 IRKDGLSLVG---TWKKDKNAEDADQPE-----KRI---ISAEEILNVFKHISPEDSWRL 222

Query: 243 GIDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIKAG 302
           G +      RPE  +   LP PP  +RPS+   +S    EDDLT KL +++  +  ++  
Sbjct: 223 GFNEDFS--RPEWMLLTVLPVPPPPVRPSISFNES-QRGEDDLTYKLGDILKANINVQRL 279

Query: 303 LEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRF 362
              G   + + E    LQ  VA Y+++D          +G  +K IR    RLKGK+GR 
Sbjct: 280 EINGSPQHVIQESESLLQFHVATYMDNDIAGQPQAVQKSGRPIKSIRA---RLKGKEGRI 336

Query: 363 RGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGP 422
           RGNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L QLV NGP
Sbjct: 337 RGNLMGKRVDFSARTVISGDPNLDLDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGP 396

Query: 423 NEYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHRLS 482
           NE+PGA Y+++ + D R +LR+  R    + L+ G  VERH+ D D VLFNRQPSLH++S
Sbjct: 397 NEHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDDDPVLFNRQPSLHKMS 454

Query: 483 ILSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLLTP 542
           +++H  K+ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V   +++P
Sbjct: 455 MMAHRVKVMPYSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSP 514

Query: 543 KSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMS-----DGALQFDIPPPTIWK 597
           +S +P +   QD + G   ++ +D+F +   + Q+L+M+      DG     IP PTI K
Sbjct: 515 QSNKPCMGIVQDTLCGIRKMTLRDTFIE---LDQVLNMLYWIPDWDGV----IPTPTILK 567

Query: 598 PCYLWTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQI 657
           P  LW+GKQ+ S+ I     S + L    +   Y+ PK          ++G ++I G QI
Sbjct: 568 PKPLWSGKQLLSMAI----PSGIHLQRFDEGTTYLSPK----------DNGMLIIDG-QI 612

Query: 658 LSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTP 717
           + GV+DK  +G      + + + R+ G +  A+    + K+   ++ + GFSIGI D   
Sbjct: 613 IFGVVDKKTVGSSSG-GLIHVVTREKGPEVCAKLFGNIQKVVNYWLLHNGFSIGIGDTIA 671

Query: 718 AXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGE 777
                      +  A  K +E+        L  + G    ++ E  +   L++ R++ G 
Sbjct: 672 DEKTMREITDAIALAKKKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRYLNEARDKAGR 731

Query: 778 VCINELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNS 837
                L ++N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+ 
Sbjct: 732 SAEVNLKDLNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFADRTLPHFSKDD 791

Query: 838 KTPQSKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCL 897
            +P+SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   
Sbjct: 792 YSPESKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVH 851

Query: 898 YDNTVRTSSNGIVQFTYGGDGLDPLEME 925
           YD T R S   I+QF YG DG+D   +E
Sbjct: 852 YDGTTRNSLGNIIQFVYGEDGMDAAHIE 879

 Score =  186 bits (472), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 134/411 (32%), Positives = 203/411 (49%), Gaps = 39/411 (9%)

Query: 1058 YRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVASMNV 1117
            YR+T +     L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVAS  V
Sbjct: 1035 YRLTKQTFEWVLNNIEAQFLRSIVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKV 1094

Query: 1118 TLGVPRIKEIINASKVISTPIINAVLVNE--SDERAARVVKGRIEKTLLSDVAFYIQDVY 1175
            T GVPR+KEI+N +K + TP +   L     +D+  A++++  IE T L  V    +  Y
Sbjct: 1095 TSGVPRLKEILNVAKNMKTPSLTVYLEESYATDQEKAKLIRSAIEHTTLKSVPVASEIYY 1154

Query: 1176 RDNLSYLQVRVD-------LSTIDK-------------LQLEL-----TIEDIAVAMTRA 1210
              + S   +  D        S +D+             L+LEL     T +D+ +     
Sbjct: 1155 DPDPSSTVIEEDEEIIQLHFSLMDEETEASLKHQSPWLLRLELDRVAMTDKDLTMGQVGE 1214

Query: 1211 PKLKIQASDVHIVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQQLRRALPGIVV 1270
               +   +D+ ++  +  A  +       +   TL  E    E     +     L  I +
Sbjct: 1215 KIKETFKNDLFVIWSEDNAEKLIIRCRVVRDPKTLDAEAEAEEDHMLKKIENTMLESITL 1274

Query: 1271 KGLSDISRAVINIRD------DGKRE------LLVEGYGLRDVMSTDGVVGHKTVTNHIL 1318
            +G+ DI+R V+   D       G+        L  +G  L +VMS  GV   +  TN  +
Sbjct: 1275 RGVQDITRVVMMKYDRKVPSETGEYHKIPEWVLETDGVNLSEVMSVPGVDPTRIYTNSFI 1334

Query: 1319 EVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMR 1378
            ++ +VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT +G ++ +TR G ++  
Sbjct: 1335 DIMNVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTSQGFLMSVTRHGFNRAD 1394

Query: 1379 DSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
               L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+
Sbjct: 1395 TGALMRCSFEETVEILFEAGAAAELDDCSGVSENVILGQMAPIGTGSFDVM 1445

>TBLA0F02170 Chr6 (535350..540530) [5181 bp, 1726 aa] {ON} Anc_7.314
           YDL140C
          Length = 1726

 Score =  548 bits (1413), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 348/924 (37%), Positives = 502/924 (54%), Gaps = 56/924 (6%)

Query: 7   SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
           S AP + I  ++F   S  +I A S  +I   +  D    RA K GG  DP++G    ++
Sbjct: 7   SSAPLRTIKEVQFGLFSPEEIRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNL 65

Query: 66  ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFLS 125
           +CQTC   +  C GHFGHI LA PVFHIG+     ++ + IC  C  +LL++ +++  + 
Sbjct: 66  KCQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECICMHCGKLLLDEHNEQ--MR 123

Query: 126 ELRRPGVDNLRRMGILKKVLDQCKKQRRCLQCXXXXXXXXXXXXXXXXXXXKIIHDTFRW 185
           ++ +   D+ +R      +   CK +   + C                        T R 
Sbjct: 124 QILKIK-DSKKR---FNAIWSLCKTK---MICDTDVPSEHDPTQLVSRGGCGNAQPTVRK 176

Query: 186 AGKKSVP--EKEKWIGDWDSVLAHSPELERYVKRCMDDLNPLKTLNLFKQVKPEDCELLG 243
            G K V   +KEK   D D       E E+ +      L+  + LN+FK + PED   +G
Sbjct: 177 DGLKLVGSWKKEKNTSDGD-------EPEQRI------LSTEEILNIFKHISPEDSIAMG 223

Query: 244 IDSTIKSGRPETYIWRYLPAPPVCIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIKAGL 303
            +      RPE      LP PP  +RPS+   +S    EDDLT KL +++  +  ++   
Sbjct: 224 FNEEFS--RPEWMFLTVLPVPPPPVRPSISFNES-QRGEDDLTFKLADILKANISLETLE 280

Query: 304 EKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRFR 363
             G   + + E    LQ  VA Y+++D          +G  VK IR    RLKGK+GR R
Sbjct: 281 HNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGRPVKSIRA---RLKGKEGRIR 337

Query: 364 GNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGPN 423
           GNL GKRVDFS RTVIS DPNL +D+V VP  +AK LTYPE VT YN  +L  LV NGPN
Sbjct: 338 GNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTHLVRNGPN 397

Query: 424 EYPGANYLLKKDEDARRNLRFGDRVKLAKNLRIGDLVERHLEDGDVVLFNRQPSLHRLSI 483
           E+PGA Y+++ + D R +LR+  R    + L+ G  VERH+ D D VLFNRQPSLH++S+
Sbjct: 398 EHPGAKYVIRDNGD-RIDLRYSKRAGDIQ-LQYGWKVERHIMDNDPVLFNRQPSLHKMSM 455

Query: 484 LSHYAKIRPWRTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGVKSNLLTPK 543
           ++H  ++ P+ TFRLN  V +PYNADFDGDEMNLHVPQSEE RAE   L  V   +++ +
Sbjct: 456 MAHRVRVMPFSTFRLNLSVTSPYNADFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSAQ 515

Query: 544 SGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSDGALQFD--IPPPTIWKPCYL 601
           S +P +   QD + G   ++ +D+F +   +  LL  + D    +D  IP P I KP  L
Sbjct: 516 SNKPCMGIVQDTLCGIRKLTLRDNFIEFDQVLNLLYWVPD----WDGVIPTPAILKPKPL 571

Query: 602 WTGKQIFSLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQNDGFVLIRGSQILSGV 661
           W+GKQI S+ I       + L    +   ++ PK          ++G ++I G QI+ GV
Sbjct: 572 WSGKQILSIAI----PKGIHLQRFDEGTTFLSPK----------DNGMLIIDG-QIIFGV 616

Query: 662 MDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNRGFSIGISDVTPAXXX 721
           +DK  +G      + + + R+ G Q  A+  + + K+   +  + GFS GI D       
Sbjct: 617 VDKKTVGSSSG-GLIHVVTREKGPQICAKLFSNIQKVTNYWFLHNGFSTGIGDTIADGET 675

Query: 722 XXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCIN 781
                  +  A  K +E+        L  + G    ++ E  +   L++ R++ G +   
Sbjct: 676 MREITGTIAEAKRKVEEVTKEAQANLLTAKHGMTLRESFEDNVVRFLNEARDKAGRLAEV 735

Query: 782 ELDNMNAPLIMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQ 841
            L++ N    M + GSKGS +N++QM A VGQQ + G R+  GF DR+LPHF K+  +P+
Sbjct: 736 NLNDTNNVKQMVSAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPE 795

Query: 842 SKGFVRNSFFSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNT 901
           SKGFV NS+  GLTP EF +HA+ GREGL+DTAVKTAETGY+ RRL+K+LED+   YD+T
Sbjct: 796 SKGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDST 855

Query: 902 VRTSSNGIVQFTYGGDGLDPLEME 925
            R S   ++QF YG DG+D   +E
Sbjct: 856 TRNSLGNVIQFVYGEDGIDAGHIE 879

 Score =  180 bits (457), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 136/425 (32%), Positives = 207/425 (48%), Gaps = 44/425 (10%)

Query: 1054 VDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLKTFHFAGVA 1113
            V Q +++  +  +  L     ++ R+ V PG  VG + AQSIGEP TQMTL TFHFAGVA
Sbjct: 1031 VLQEFKLNKQSFQWVLNNVEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVA 1090

Query: 1114 SMNVTLGVPRIKEIINASKVISTPIINAVL--VNESDERAARVVKGRIEKTLLSDVAFYI 1171
            S  VT GVPR+KEI+N +K + TP + A L     +D+  A++++  IE T L  V    
Sbjct: 1091 SKKVTSGVPRLKEILNVAKNMKTPSLTAYLEPAYAADQEKAKLIRSAIEHTTLKSVTV-A 1149

Query: 1172 QDVYRDNLSYLQVRVDLSTIDKLQLELTIEDIAVAMTRAPK--LKIQASDVHIVGKDKIA 1229
             ++Y D      V  +   I +L   L  E+   ++ +     L+++     +  KD   
Sbjct: 1150 SEIYYDPDPRTTVIAEDEEIMQLHFSLMDEETEKSLDQQSPWLLRLELDRAAMNDKDLTM 1209

Query: 1230 INV----------------FPDGAKAKSISTLAKEP------SENEVFYRMQQLRRA-LP 1266
              V                  D A+   I      P      +E E  + ++++    L 
Sbjct: 1210 GQVGEKIRETFRNDLFVIWSEDNAEKLIIRCRVVRPKALDAETEAEEDHMLKKIENTMLE 1269

Query: 1267 GIVVKGLSDISRAVINIRD------DGKRE------LLVEGYGLRDVMSTDGVVGHKTVT 1314
             I ++G+ +I R V+   D       G  E      L  +G  L +VM+  GV   +  T
Sbjct: 1270 NITLRGVENIERVVMMKYDRKIPGTSGAYEKVPEWVLETDGVNLLEVMTVPGVDASRIYT 1329

Query: 1315 NHILEVYSVLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGL 1374
            N  +++  VLGIEA RA++  E+   +++ G  V+ RH+ LL DVMT  G +  +TR G 
Sbjct: 1330 NSFIDITEVLGIEAGRAALYKEVYNVIASDGSYVNYRHMALLVDVMTTNGSLTSVTRHGF 1389

Query: 1375 SKMRDSVLQLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNV 1434
            ++     L   SFE+T + LF+A    + D   GVSE +ILGQ   IGTG+F V+    +
Sbjct: 1390 NRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGSFDVM----I 1445

Query: 1435 SEEQL 1439
             EE L
Sbjct: 1446 DEESL 1450

>YOR341W Chr15 (960987..965981) [4995 bp, 1664 aa] {ON}  RPA190RNA
            polymerase I largest subunit A190
          Length = 1664

 Score =  443 bits (1140), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 320/974 (32%), Positives = 500/974 (51%), Gaps = 116/974 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLI----------- 299
            + +++    L  PP   R PS + ++   ++++ L   L++V+ TS LI           
Sbjct: 351  KADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLK 356
              K  LE + +  + +M  +  +Q  V  +I+S         G T GKV PI G  Q L+
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKA-----QGRTSGKV-PIPGVKQALE 461

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQ 521

Query: 417  LVVNGPNEYPGANYLLKKDED--ARRNLRFGDRVKLAKNL----------RIGDLVERHL 464
             V+NGP+++PGA  +  +D    +   +    R  LA  L           +   V RH+
Sbjct: 522  AVINGPDKWPGATQIQNEDGSLVSLIGMSVEQRKALANQLLTPSSNVSTHTLNKKVYRHI 581

Query: 465  EDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQSE 523
            ++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E
Sbjct: 582  KNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 641

Query: 524  EARAEAINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMM-- 581
             ARAEA+NL    S  LTP SG P+    QD I+    ++ KDSFF +    Q +     
Sbjct: 642  NARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIR 701

Query: 582  -SDGAL---QFDIPPPTIWKPCYLWTGKQIFSLLIRPNKKSPVV--LNLDAKNKVYIPPK 635
              DG     +    PPTI+KP  LWTGKQI + ++  N   P +  +NL +KNK+     
Sbjct: 702  PEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISKNKIKNEYW 760

Query: 636  SK-SLPNEMSQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNR 694
             K SL NE       VL +   +L G++DKS  G   K+ + +++   YG + AA+ ++ 
Sbjct: 761  GKGSLENE-------VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLSV 812

Query: 695  MAKLCARYVGNRGFSIGISDVTPAXXXXXXXXXM----VESAYAKCDELIDL-------- 742
            + +L   Y+    F+ G+ D+            +    V++      E+ +L        
Sbjct: 813  LGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTPADD 872

Query: 743  --FSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCINELDNMNAPL----IMATCG 796
                K   E     N+   L+A     ++ +  +V   C+ +      P      MA  G
Sbjct: 873  PELLKRLQEILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAMALSG 932

Query: 797  SKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTP 856
            +KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P
Sbjct: 933  AKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKP 992

Query: 857  PEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTYGG 916
             E+ +H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF YGG
Sbjct: 993  QEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMYGG 1052

Query: 917  DGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQVTEEILQPLENRLVRYD 976
            D +D +  E +     F            +N    L  Y    + E +   +E+ L    
Sbjct: 1053 DAID-ITKESHMTQFEF----------CLDNYYALLKKYNPSALIEHL--DVESAL---- 1095

Query: 977  NLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELMDEPALE 1036
                   K ++  ++Y  ++  E  +  S++        +LAK+  +K +  + +    +
Sbjct: 1096 -------KYSKKTLKYRKKHSKEPHYKQSVK-----YDPVLAKYNPAKYLGSVSENFQDK 1143

Query: 1037 LQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAI-LKYRRAKVEPGTAVGAIGAQSI 1095
            L+S  LD+N          ++++ +D +  +  R  + LKY R+ + PG AVG I +QS+
Sbjct: 1144 LESF-LDKN---------SKLFKSSDGVNEKKFRALMQLKYMRSLINPGEAVGIIASQSV 1193

Query: 1096 GEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNE-SDERAAR 1153
            GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + N+ SDE+A  
Sbjct: 1194 GEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWNDVSDEQADT 1253

Query: 1154 VVKGRIEKTLLSDV 1167
              K  I K LLS+V
Sbjct: 1254 FCKS-ISKVLLSEV 1266

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVT-NHILEVYSVLGIE 1327
            +++ +  I R V    ++GKR L+ EG   + +   +  +    +T N +  V    G+E
Sbjct: 1497 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1556

Query: 1328 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1615

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            E T   L  A    +++ ++  S  I++G+   +GTG+F V+
Sbjct: 1616 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1657

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 58/124 (46%), Gaps = 3/124 (2%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +I+ ++F  L+A +I   S  +I+   + D  N   P +GG  D  +G    +
Sbjct: 3   ISKPVGSEITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           + C TC  +   C GH GHI+L +P ++  +F      L+  C  C    L+  +   + 
Sbjct: 61  L-CSTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYA 119

Query: 125 SELR 128
            +LR
Sbjct: 120 CKLR 123

>Skud_15.506 Chr15 (901437..906434) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  442 bits (1137), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 319/974 (32%), Positives = 500/974 (51%), Gaps = 116/974 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++V+ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLK 356
              K  LE + +  + +M  +  +Q  V  +I+S         G T GKV PI G  Q L+
Sbjct: 408  KDKVSLEDRKVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSGKV-PIPGVKQALE 461

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQ 521

Query: 417  LVVNGPNEYPGANYLLKKDED--ARRNLRFGDRVKLAKNL----------RIGDLVERHL 464
             V+NGP+++PGA  +  +D    +   + F  R  LA  L           +   V RH+
Sbjct: 522  AVINGPDKWPGATQIQNEDGSLVSLIGMSFEQRKALANQLLTPSSNVSTHTLNKKVYRHI 581

Query: 465  EDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQSE 523
            ++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E
Sbjct: 582  KNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 641

Query: 524  EARAEAINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMM-- 581
             ARAEA+NL    S  LTP SG P+    QD I+    ++ KDSFF +    Q +     
Sbjct: 642  NARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIR 701

Query: 582  -SDGAL---QFDIPPPTIWKPCYLWTGKQIFSLLIRPNKKSPVV--LNLDAKNKVYIPPK 635
              DG     +    PPTI+KP  LWTGKQI + ++  N   P +  +NL +KNK+     
Sbjct: 702  PEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISKNKIKNEYW 760

Query: 636  SK-SLPNEMSQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNR 694
             K SL +E       VL +   +L G++DKS  G   K+ + +++   YG + AA+ ++ 
Sbjct: 761  GKGSLESE-------VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLSV 812

Query: 695  MAKLCARYVGNRGFSIGISDVTPAXXXXXXXXXM----VESAYAKCDELIDL-------- 742
            + +L   Y+    F+ G+ D+            +    V++      E+ +L        
Sbjct: 813  LGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKETPSDD 872

Query: 743  --FSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCINELDNMNAPL----IMATCG 796
                K   E     N+   L+A     ++ +  +V   C+ +      P      MA  G
Sbjct: 873  PELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQAMALSG 932

Query: 797  SKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTP 856
            +KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P
Sbjct: 933  AKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKP 992

Query: 857  PEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTYGG 916
             E+ +H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   ++QF YGG
Sbjct: 993  QEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQFMYGG 1052

Query: 917  DGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQVTEEILQPLENRLVRYD 976
            D +D +  E +     F            +N    L  Y    + E +   +E+ L    
Sbjct: 1053 DAVD-ITKESHMTQFEF----------CLDNYYALLKKYNPSALIEHL--DVESAL---- 1095

Query: 977  NLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELMDEPALE 1036
                   K ++  ++Y  ++  E  +  S++        +LAK+  +K +  + +    +
Sbjct: 1096 -------KYSKKTLKYRKKHSKEPHYKQSMK-----YDPVLAKYSPAKYLGSVSENFQDK 1143

Query: 1037 LQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAI-LKYRRAKVEPGTAVGAIGAQSI 1095
            L+S  LDEN          ++++ TD +  +  R  + LKY R+ + PG AVG I +QS+
Sbjct: 1144 LESF-LDEN---------SKLFKSTDGVNEKKFRALMQLKYMRSLINPGEAVGIIASQSV 1193

Query: 1096 GEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNE-SDERAAR 1153
            GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + ++ SDE+A  
Sbjct: 1194 GEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWDDVSDEQADT 1253

Query: 1154 VVKGRIEKTLLSDV 1167
              K  I K LLS+V
Sbjct: 1254 FCKS-ISKVLLSEV 1266

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVT-NHILEVYSVLGIE 1327
            +++ +  I R V    ++GKR L+ EG   + +   +  +    +T N +  V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1328 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ LL D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            E T   L  A    +++ ++  S  I++G+   +GTG+F V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 58/124 (46%), Gaps = 3/124 (2%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +I+ ++F  L+A +I   S  +I+   + D  N   P +GG  D  +G    +
Sbjct: 3   ISKPVGSEITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           + C TC  +   C GH GHI+L +P ++  +F      L+  C  C    L+  +   + 
Sbjct: 61  L-CSTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYA 119

Query: 125 SELR 128
            +LR
Sbjct: 120 CKLR 123

>CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341w RPA190 DNA-directed RNA polymerase I
          Length = 1643

 Score =  442 bits (1136), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 312/978 (31%), Positives = 499/978 (51%), Gaps = 124/978 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLI----------- 299
            + + +    L  PP   R PS +  +   ++++ L   L++++ TS LI           
Sbjct: 337  KADMFFMDVLVVPPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDELSTLQ 393

Query: 300  --KAGLE-KGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLK 356
              K  LE + I  + +M  +  +Q  V  +I+S         G TGGKV PI G  Q L+
Sbjct: 394  KDKVSLEDRRIIFSRLMNAFVTIQNDVNSFIDSTKA-----QGNTGGKV-PIPGVKQALE 447

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 448  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQ 507

Query: 417  LVVNGPNEYPGANYLLKKDED--ARRNLRFGDRVKLAKNL----------RIGDLVERHL 464
             ++NGP+++PGA+ +  +D    +   +    R  LA  L           +   V RH+
Sbjct: 508  AIINGPDKWPGASQIQNEDGSLISLVGMTLEQRKALANQLMTPSSNPYTHTLNKKVYRHI 567

Query: 465  EDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQSE 523
            ++ D+VL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E
Sbjct: 568  KNRDIVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 627

Query: 524  EARAEAINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMM-- 581
             ARAEA NL    S  LTP SG P+    QD I+    +++KDSFF +    Q +     
Sbjct: 628  NARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCIR 687

Query: 582  -SDGA---LQFDIPPPTIWKPCYLWTGKQIFSLLIRPNKKSPVV--LNLDAKNKVYIPPK 635
              DG     +    PP I KP  LWTGKQI + ++  N   P +  +NL + NK+    K
Sbjct: 688  PEDGHATRAKLVTLPPAIHKPIPLWTGKQIITTVLL-NVTPPDMPGINLKSSNKI----K 742

Query: 636  SKSLPNEMSQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRM 695
            ++       +ND  V+ +  Q+L G++DKS  G   K+ + +++   YG + AA+ ++ +
Sbjct: 743  NEYWGKHSEEND--VIFKDGQLLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKVLSVL 799

Query: 696  AKLCARYVGNRGFSIGISDVTPAXXXXXXXXXMVESAYAKCDELIDLFSKG-----KLET 750
             +L   Y+ N  F+ G+ D+            +++       E +D+  +       L+ 
Sbjct: 800  GRLFTNYIMNTAFTCGMDDLRLTSDGNKWRSDILK-------ESVDIGRQAAAEVTNLDK 852

Query: 751  QPGCNEEQTLE--------------------AKIGGLLSKVREEVGEVCINELDNMNAPL 790
                N+ + L+                    AK+  + SKV  +       +    N+  
Sbjct: 853  DTPSNDPELLKRLEEILRDNNKLGILDAVSSAKVNTITSKVVSQCVPGGTMKKFPENSMQ 912

Query: 791  IMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSF 850
             MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F
Sbjct: 913  AMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRF 972

Query: 851  FSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIV 910
            +SG+ P E+ +H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++
Sbjct: 973  YSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLI 1032

Query: 911  QFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQVTEEILQPLEN 970
            QF YGGD +D ++ E +    NF            +N D  L  Y    + E +   +E 
Sbjct: 1033 QFLYGGDAVDVIK-ESHMTEFNF----------CLDNYDALLKKYNPSALVEHV--DVET 1079

Query: 971  RLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELM 1030
             L +Y     +  K+++D          E+ +  +L+        +L+K+  +K +  + 
Sbjct: 1080 AL-KYSKKTLKNRKKHKD----------EKHYKQTLK-----YDPVLSKYNPAKYLGAVS 1123

Query: 1031 DEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAI 1090
            +    +L+ + LD++       +  +   I +K  R  ++   LKY R+ + PG AVG I
Sbjct: 1124 ENFQDKLE-LFLDKS-----SKTFKEYESINEKKFRALMQ---LKYMRSLINPGEAVGII 1174

Query: 1091 GAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNESDE 1149
             +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + N+  +
Sbjct: 1175 ASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWNDVSD 1234

Query: 1150 RAARVVKGRIEKTLLSDV 1167
              A      I K +LS+V
Sbjct: 1235 ETADTFCKSISKVILSEV 1252

 Score = 87.0 bits (214), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVT-NHILEVYSVLGIE 1327
            +++ +  I R +    ++GKR L+ EG   + +   +  +    +T N I  V    G+E
Sbjct: 1478 IIRQVPHIDRCIRPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDIASVLQTYGVE 1537

Query: 1328 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1538 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1596

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            E T   L  A    +++ +E  S  I+LG+   +GTGAF ++
Sbjct: 1597 ETTCQFLTKAVLDNEREQLESPSARIVLGKLNNVGTGAFDIL 1638

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/124 (29%), Positives = 58/124 (46%), Gaps = 3/124 (2%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +IS ++F  L++ADI   S   I+   + D  N   P +GG  D  +G    +
Sbjct: 3   ISKPVGSEISSVDFGILTSADIRNLSAKRITNPTVLD--NLGHPISGGLYDLALGAFLRN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           + C TC  +   C GH GHI+L +P ++  +F      L+  C  C    L+  D   + 
Sbjct: 61  L-CGTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSACLFCHHFKLKSLDVHRYA 119

Query: 125 SELR 128
            +LR
Sbjct: 120 CKLR 123

>KNAG0D04970 Chr4 (905179..910194) [5016 bp, 1671 aa] {ON} Anc_7.51
            YOR341W
          Length = 1671

 Score =  442 bits (1136), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 308/961 (32%), Positives = 493/961 (51%), Gaps = 113/961 (11%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLIK------AGLEKG--------IS 308
            PP   R PS M ++   ++++ L   L++++ T+ LI+      + L+K         I 
Sbjct: 367  PPTRFRLPSKMGEEIHENSQNQL---LSKILTTALLIRDLNDEMSKLQKDKVSVDDRRII 423

Query: 309  INNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRFRGNLSG 368
             + +M  +  +Q  V  +I+S         G TGG V P+ G  Q L+ K+G FR ++ G
Sbjct: 424  FSRLMNGFVTIQNDVNAFIDSTKAQ-----GSTGGNV-PVPGVKQALEKKEGLFRKHMMG 477

Query: 369  KRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGPNEYPGA 428
            KRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q V+NGP+++PGA
Sbjct: 478  KRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWPGA 537

Query: 429  NYLLKKDEDARR----NLRFGDRVKLAKNL-----------RIGDLVERHLEDGDVVLFN 473
              L  ++ED        +    R  LA  L            +   V RH+++ D+V+ N
Sbjct: 538  --LQIQNEDGSLVSLIGMTLEQRKALANQLMTPSYVGGATHTLNKKVYRHIKNRDIVIMN 595

Query: 474  RQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINL 532
            RQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E ARAEA NL
Sbjct: 596  RQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNL 655

Query: 533  MGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMM---SDGAL--- 586
                S  LTP SG P+    QD I+    ++ KDSFF +    Q +       DG     
Sbjct: 656  ANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHATRP 715

Query: 587  QFDIPPPTIWKPCYLWTGKQIF-SLLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEMSQ 645
            +    PP +WKP  LWTGKQI  ++L+         +NL + NK+    K++       +
Sbjct: 716  KLVTVPPAVWKPVPLWTGKQIITTVLLNVTPADMPGINLKSNNKI----KNEYWGKSSEE 771

Query: 646  NDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGN 705
            N+  VL +  ++L G++DK+  G   K+ + +++   YG   AA+ ++ + +L   Y+  
Sbjct: 772  NE--VLFKNGELLCGILDKNQYG-ASKYGIVHSLHEVYGPDIAAKVLSVLGRLFTNYIMA 828

Query: 706  RGFSIGISDVTPAXXXXXXXXXM----VESAYAKCDELIDL----------FSKGKLETQ 751
              F+ G+ D+            +    V++      E+ +L            K   E  
Sbjct: 829  TAFTCGMDDLRLTAEGNKWRKDILKTSVDTGREAAAEVTNLEKDTTADDPELLKRLQEVL 888

Query: 752  PGCNEEQTLEAKIGGLLSKVREEVGEVCINELDNMNAPL----IMATCGSKGSTLNVSQM 807
               N+   L+A     ++ +  +V   C+ +      P      MA  G+KGS +NVSQ+
Sbjct: 889  RDNNKSGILDAVTSSKVNAITSKVVSTCVPDGTMKKFPYNSMQAMALSGAKGSNVNVSQI 948

Query: 808  VAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTPPEFLYHAISGR 867
            + ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ +H ++GR
Sbjct: 949  MCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMAGR 1008

Query: 868  EGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTYGGDGLDPLEMEGN 927
            EGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD +D +  E +
Sbjct: 1009 EGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDAVD-VTKESH 1067

Query: 928  AQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQVTEEILQPLENRLVRYDNLGNEITKENR 987
                +F             N D  L  Y    + E +   +E+ L           K ++
Sbjct: 1068 MTKFDF----------CLENYDALLKKYNPSALIEHL--DVESAL-----------KYSK 1104

Query: 988  DRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELMDEPALELQSVDLDENVP 1047
              ++Y  ++  E  +  S +        +LAK+  +K +  + ++   +L++  +D+N  
Sbjct: 1105 KSLKYRKKHAKEAHYKQSPK-----YDPVLAKYNPAKYLGSVSEKFQDKLETF-IDKN-S 1157

Query: 1048 EDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLKTF 1107
            +  +H+ D    I++K  R  ++   LKY R+ + PG AVG I +QS+GEP TQMTL TF
Sbjct: 1158 KLFKHNDD----ISEKKFRALMQ---LKYMRSLINPGEAVGIIASQSVGEPSTQMTLNTF 1210

Query: 1108 HFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNESDERAARVVKGRIEKTLLSD 1166
            HFAG  + NVTLG+PR++EII  AS  I TP +   ++++  ++ A      I K LLS+
Sbjct: 1211 HFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVSDQQADTFSKSISKVLLSE 1270

Query: 1167 V 1167
            V
Sbjct: 1271 V 1271

 Score = 80.5 bits (197), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/167 (29%), Positives = 86/167 (51%), Gaps = 12/167 (7%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLR------DVMSTDGVVGHKTVTNHILEVYS 1322
            ++  +  I R V    ++GKR L+ EG   +      D +  DG+      +N +  V  
Sbjct: 1501 IINQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEDFIDVDGIT-----SNDVSAVLK 1555

Query: 1323 VLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVL 1382
            V G+EAAR +IV EI      + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1556 VYGVEAARNTIVNEISNVFGRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLM 1615

Query: 1383 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            ++ S+E T   L  A    +++ ++  S  I++G+   +GTG+F ++
Sbjct: 1616 KM-SYETTCQFLTKAVLDHERENLDSPSARIVVGKLNNVGTGSFDIL 1661

 Score = 54.3 bits (129), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 58/124 (46%), Gaps = 3/124 (2%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +IS ++F   SA ++ A S  +I+   + D  N   P +GG  D  +G    +
Sbjct: 3   ISKPVGSRISSVDFDVFSAKEVRALSVKQITNPTVLD--NLGHPISGGLYDLALGAFLRN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           M C +C  +   C GH GHI+L +P ++  +F      L+  C  C    L+  +   F 
Sbjct: 61  M-CASCGLDEKFCPGHLGHIELPVPCYNPLFFNQLYIYLRSSCLFCYRFRLKALEVHAFA 119

Query: 125 SELR 128
            +LR
Sbjct: 120 MKLR 123

>Smik_15.519 Chr15 (910592..915589) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  438 bits (1126), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 319/977 (32%), Positives = 497/977 (50%), Gaps = 122/977 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLI----------- 299
            + +++    +  PP   R PS + ++   ++++ L   L++V+ TS LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGEEVHENSQNQL---LSKVLTTSLLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLK 356
              K  LE + +  + +M  +  +Q  V  +I+S         G T GKV P+ G  Q L+
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GRTSGKV-PVPGVKQALE 461

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQ 521

Query: 417  LVVNGPNEYPGANYLLKKDED--ARRNLRFGDRVKLAKNL----------RIGDLVERHL 464
             V+NGP+++PGA  +  +D    +   +    R  LA  L           +   V RH+
Sbjct: 522  AVINGPDKWPGATQIQNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKVYRHI 581

Query: 465  EDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQSE 523
            ++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E
Sbjct: 582  KNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 641

Query: 524  EARAEAINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMM-- 581
             ARAEA+NL    S  LTP SG P+    QD I+    ++ KDSFF +    Q +     
Sbjct: 642  NARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIR 701

Query: 582  -SDGAL---QFDIPPPTIWKPCYLWTGKQIFSLLIRPNKKSPVV--LNLDAKNKVYIPPK 635
              DG     +    PPTI+KP  LWTGKQI + ++  N   P +  +NL +KNK+     
Sbjct: 702  PEDGHTTRSKIVTLPPTIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLLSKNKIKNEYW 760

Query: 636  SK-SLPNEMSQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNR 694
             K SL NE       VL +   +L G++DKS  G   K+ + +++   YG + AA+ ++ 
Sbjct: 761  GKGSLENE-------VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLSV 812

Query: 695  MAKLCARYVGNRGFSIGISDVTPAXXXXXXXXXM----VESAYAKCDELIDL-------- 742
            + +L   Y+    F+ G+ D+            +    V++      E+ +L        
Sbjct: 813  LGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLDKDTPADD 872

Query: 743  --FSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCINELDNMNAPL----IMATCG 796
                K   E     N+   L+A     ++ +  +V   C+ +      P      MA  G
Sbjct: 873  PELLKRLQEILRDNNKSGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPYNSMQAMALSG 932

Query: 797  SKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTP 856
            +KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P
Sbjct: 933  AKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKP 992

Query: 857  PEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTYGG 916
             E+ +H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF YGG
Sbjct: 993  QEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMYGG 1052

Query: 917  DGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQVTEEILQPLENRLVRYD 976
            D +D +  E +     F            +N    L  Y    + E +   +E+ L    
Sbjct: 1053 DAID-ITKESHMTQFEF----------CLDNYYALLKKYNPSALIEHL--DVESAL---- 1095

Query: 977  NLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELMDEPALE 1036
                   K ++  ++Y  ++  E  +  S++        +LAK+            PA  
Sbjct: 1096 -------KYSKKTLKYRKKHIKEPHYKQSIK-----YDPVLAKYN-----------PAKY 1132

Query: 1037 LQSVDLDENVPEDIRHSVD---QVYRITDKMVREFLRVAI-LKYRRAKVEPGTAVGAIGA 1092
            L SV   EN  + +   +D   ++++  D +  +  R  + LKY R+ + PG AVG I +
Sbjct: 1133 LGSV--SENFQDKLESFLDKGSKLFKSADGVNEKKFRALMQLKYMRSLINPGEAVGIIAS 1190

Query: 1093 QSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNE-SDER 1150
            QS+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + ++ SDE+
Sbjct: 1191 QSVGEPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWDDVSDEQ 1250

Query: 1151 AARVVKGRIEKTLLSDV 1167
            A    K  I K LLS+V
Sbjct: 1251 ADTFCKS-ISKVLLSEV 1266

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVT-NHILEVYSVLGIE 1327
            +++ +  I R V    ++GKR L+ EG   + +   +  +    +T N +  V    G+E
Sbjct: 1498 IIRQIPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVE 1557

Query: 1328 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            E T   L  A    +++ ++  S  I++G+   +GTG+F V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVL 1658

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 58/124 (46%), Gaps = 3/124 (2%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +I+ ++F  L+A +I   S  +I+   + D  N   P +GG  D  +G    +
Sbjct: 3   ISKPVGSEITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           + C TC  +   C GH GHI+L +P ++  +F      L+  C  C    L+  +   + 
Sbjct: 61  L-CSTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYA 119

Query: 125 SELR 128
            +LR
Sbjct: 120 CKLR 123

>Kwal_26.6979 s26 complement(150350..155314) [4965 bp, 1654 aa] {ON}
            YOR341W (RPA190) - RNA polymerase I subunit 190 (alpha)
            [contig 46] FULL
          Length = 1654

 Score =  437 bits (1125), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 311/974 (31%), Positives = 498/974 (51%), Gaps = 116/974 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLIK---------- 300
            R + +    +  PP   R PS + ++   ++++ L   L++++ TS LI+          
Sbjct: 345  RADMFFLEVVIVPPTRFRLPSKLGEEIHENSQNQL---LSKILTTSLLIRDLNEEMSKLQ 401

Query: 301  ----AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLK 356
                +  +K +  N +M  +  +Q  V  +I+S         G  GGKV PI G  Q L+
Sbjct: 402  KDKVSAQDKIVIFNRLMNAFVTIQNDVNAFIDSTKAQ-----GSAGGKV-PIPGVKQALE 455

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 456  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQ 515

Query: 417  LVVNGPNEYPGANYLLKKDED--ARRNLRFGDRVKLAKNL----------RIGDLVERHL 464
             V+NGP+++PGA+ +  +D    +   +    R  LA  L           +   V RH+
Sbjct: 516  AVINGPDKWPGASQIQNEDGSLVSLVGMTTEQRKALANQLLTPSSHSSTHSLNKKVYRHI 575

Query: 465  EDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQSE 523
            ++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E
Sbjct: 576  KNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 635

Query: 524  EARAEAINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMM-- 581
             ARAEA NL    S  LTP SG P+    QD I+    ++ KDSFF + +  Q +     
Sbjct: 636  NARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIYGCIR 695

Query: 582  -SDGAL---QFDIPPPTIWKPCYLWTGKQIF-SLLIRPNKKSPVVLNLDAKNKVYIPPKS 636
              DG     +    PP + KP  LWTGKQI  ++L+         +NL +KNK+    K+
Sbjct: 696  PEDGHATRNKLVTVPPAVMKPVPLWTGKQIITTVLLNVTPADMPGINLISKNKI----KN 751

Query: 637  KSLPNEMSQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMA 696
                   ++ND  V+ +  ++L G++DKS  G   K+ + +++   YG   +A+ ++ + 
Sbjct: 752  DYWGKHSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPAVSAKVLSVLG 808

Query: 697  KLCARYVGNRGFSIGISDVTPAXXXXXXXXXMVESAY----AKCDELIDL---------- 742
            +L   Y+    F+ G+ D+            +++++     A   E+ +L          
Sbjct: 809  RLFTNYITATAFTCGMDDLRLTDDGNKWRSDILKTSTDVGRAAAAEVTNLDPDVSANDTE 868

Query: 743  FSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCI-----NELDNMNAPLIMATCGS 797
              K   E     N+   L+A     ++ +  +V   C+      +  N N+   MA  G+
Sbjct: 869  LLKRLEEILRDDNKLGILDAVTSSKVNTITSQVVSKCVPGGTMKKFPN-NSMQAMALSGA 927

Query: 798  KGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTPP 857
            KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P 
Sbjct: 928  KGSNVNVSQIMCLLGQQALEGRRVPVMISGKTLPSFKPFETDAMAGGYIKGRFYSGIRPQ 987

Query: 858  EFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTYGGD 917
            E+ +H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF YGGD
Sbjct: 988  EYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFLYGGD 1047

Query: 918  GLDPLEMEGNAQPVNFNRTWDHATNVTF--NNMDRGLLPYQIMQVTEEILQPLENRLVRY 975
             +D  +               H T   F  +N D  L  Y    + E +   +E+ L +Y
Sbjct: 1048 AVDVTQ-------------ESHMTEFKFCADNYDALLKKYNPSALIEHL--DVESAL-KY 1091

Query: 976  DNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELMDEPAL 1035
                 +  K+N +R+ +     A++  Y            +++KF  SK +  + +    
Sbjct: 1092 SKKALKNRKKN-ERVPHF----AQKVKYDP----------VVSKFNPSKYLGSVSENFQD 1136

Query: 1036 ELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSI 1095
            +L+S     N     R SV++         ++F  +  LKY R+ + PG AVG I +QS+
Sbjct: 1137 KLESFIDSNNELFKSRDSVNE---------KKFRALMQLKYMRSLINPGEAVGIIASQSV 1187

Query: 1096 GEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN-AVLVNESDERAAR 1153
            GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +L + +D +A  
Sbjct: 1188 GEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILADVTDSQADT 1247

Query: 1154 VVKGRIEKTLLSDV 1167
              K  I K +LS+V
Sbjct: 1248 FCKS-ITKVMLSEV 1260

 Score = 89.0 bits (219), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 53/168 (31%), Positives = 90/168 (53%), Gaps = 2/168 (1%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVT-NHILEVYSVLGIE 1327
            V++ + +I R V    ++GKR L+ EG   +++   D  V    +T N +  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFVDVNGITSNDVSSVLKTYGVE 1546

Query: 1328 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVVKGTNVS 1435
            E T   L  A    + + ++  S  ++LG+   +GTGAF V+   + S
Sbjct: 1606 ETTCQFLTKAVLDNESENLDSPSARLVLGKLNNVGTGAFDVLAKVSAS 1653

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 59/124 (47%), Gaps = 3/124 (2%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +I+ ++F  ++A DI   S ++I+   + D  N   P +GG  D  +G    +
Sbjct: 3   ISKPVGSEITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           + C TC  +   C GH GHI+L +P ++  +F      L+  C  C    L+  +   + 
Sbjct: 61  L-CATCGLDEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHGFRLKAPEVHRYA 119

Query: 125 SELR 128
            +L+
Sbjct: 120 CKLK 123

>ZYRO0D04532g Chr4 (374177..379180) [5004 bp, 1667 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1667

 Score =  437 bits (1124), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 316/975 (32%), Positives = 497/975 (50%), Gaps = 112/975 (11%)

Query: 249  KSGRPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLIK------A 301
            KS  P+ +    +  PP   R PS + ++   + ++ L   L++V+ TS LI+      +
Sbjct: 349  KSVTPDVFFMEVVLVPPTRFRLPSKLGEEVHENTQNQL---LSKVLTTSLLIRDLNDEMS 405

Query: 302  GLEKG--------ISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQ 353
             L+K         +  + +M  +  +Q  V  +I+S         G TGGKV PI G  Q
Sbjct: 406  NLQKDKVSVEDRRVIFSRLMNAFVTIQNDVNSFIDSTKAQ-----GSTGGKV-PIPGVKQ 459

Query: 354  RLKGKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGK 413
             L+ K+G FR ++ GKRV+ + R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +
Sbjct: 460  ALEKKEGLFRKHMMGKRVNHAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAE 519

Query: 414  LQQLVVNGPNEYPGANYLLKKDED--ARRNLRFGDRVKLAKNL----------RIGDLVE 461
            L+Q V+NGP+++PGA  +  +D    +   +    R  LA  L           +   V 
Sbjct: 520  LRQAVINGPDKWPGATQIQNEDGSLVSLVGMTLEQRNALANQLLTPSSNPATHTLNKKVF 579

Query: 462  RHLEDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVP 520
            RH+++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H P
Sbjct: 580  RHIKNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFP 639

Query: 521  QSEEARAEAINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSM 580
            Q+E AR+EA NL    S  LTP SG P+    QD I+    +++KDSFF +    Q +  
Sbjct: 640  QNENARSEAFNLANTDSQYLTPTSGSPLRGLIQDHISAGVWLTNKDSFFTRDQYQQYIYG 699

Query: 581  M---SDGAL---QFDIPPPTIWKPCYLWTGKQIFSLLIRPNKKSPVV-LNLDAKNKVYIP 633
                 DG     +    PP + KP  LWTGKQI + +I     + +  +NL +KNK+   
Sbjct: 700  CIRPEDGHSTRPKIVTVPPAVMKPVPLWTGKQIITTVIMNVTPADMPGINLLSKNKI--- 756

Query: 634  PKSKSLPNEMSQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMN 693
             K++      ++N+  V+ +   +L G++DKS  G   K+ + +++   YG + AA+ ++
Sbjct: 757  -KNEYWGQGSTENE--VIFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPETAAKVLS 812

Query: 694  RMAKLCARYVGNRGFSIGISDVTPAXXXXXXXXXMVESAY----AKCDELIDL------- 742
             + +L   ++ N  FS G+ D+            +++++         E+ +L       
Sbjct: 813  VLGRLFTNFITNTAFSCGMDDLRLTAEGNKDRKDLLKTSTDVGRQAAAEVTNLPTDTPSN 872

Query: 743  ---FSKGKLETQPGCNEEQTLEA----KIGGLLSKVREEVGEVCINELDNMNAPLIMATC 795
                 K   E     N+   L+A    K+  + SKV   V      +    N+   MA  
Sbjct: 873  DPELLKRLEEILRDDNKSGILDAVTSSKVNSVTSKVVSTVIPKGTMKKFPQNSMQAMALS 932

Query: 796  GSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLT 855
            G+KGST+NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ 
Sbjct: 933  GAKGSTVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFYSGIK 992

Query: 856  PPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTYG 915
            P E+ +H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQF YG
Sbjct: 993  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHVSYDNTVRDGDGTLVQFLYG 1052

Query: 916  GDGLDPLEMEGNAQPVNFNRTWDHATNVTF--NNMDRGLLPYQIMQVTEEILQPLENRLV 973
            GD +D  +               H T   F   N D  L  Y    + E +   +E+ L 
Sbjct: 1053 GDAVDTTK-------------ESHMTQFDFCLENYDALLRKYNPSALVEHL--DVESAL- 1096

Query: 974  RYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELMDEP 1033
                      K ++  ++   + D E  + +S +        +L+K+  +K +  + ++ 
Sbjct: 1097 ----------KYSKKALKSRKKIDKEPHYKNSDK-----YDPVLSKYNPAKYLGSVSEKF 1141

Query: 1034 ALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQ 1093
              +L+   LD +  +   HS      I +K  R  ++   LKY R+ V PG AVG I AQ
Sbjct: 1142 QDKLEGF-LDSHSKQLKLHS-----GINEKKFRALMQ---LKYMRSLVNPGEAVGIIAAQ 1192

Query: 1094 SIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNESDERAA 1152
            S+GEP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP ++  + N   +  A
Sbjct: 1193 SVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIVMTASAAIKTPQMSLPVWNHVSDDQA 1252

Query: 1153 RVVKGRIEKTLLSDV 1167
             +    I K +LS+V
Sbjct: 1253 SIFCKSITKVVLSEV 1267

 Score = 75.9 bits (185), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 82/162 (50%), Gaps = 2/162 (1%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTV-TNHILEVYSVLGIE 1327
            V++ +  ISR +       +R L  EG   + +   +  +    + +N +  V    G+E
Sbjct: 1500 VIREVPHISRCIPGEPVGDRRMLTTEGVNFQAMWDQEMFIDVDGIRSNDVAAVLRTYGVE 1559

Query: 1328 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1560 AARNTIVYEINNVFSRYAISVSFRHLDLIADLMTRQGNYLAFNRQGMETSTSSFMKM-SY 1618

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            E T   L  A     ++ ++  S  I+LG+   +GTGAF V+
Sbjct: 1619 ETTCQFLTKAVLDNDREKLQSPSARIVLGKLNNVGTGAFDVL 1660

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 57/124 (45%), Gaps = 3/124 (2%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +IS ++F+  SA +I   S  +I+   + D  N   P +GG  D  +G    +
Sbjct: 3   ISKPVGSEISSVDFNVFSAEEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           + C TC  +   C GH GHI+L +P ++  +F      L+  C  C    L   +   F 
Sbjct: 61  L-CATCGLDEKFCPGHQGHIELPVPCYNPLFFSQLYIYLRSSCLYCHRFRLRSIEVNRFA 119

Query: 125 SELR 128
            +LR
Sbjct: 120 CKLR 123

>KLTH0D01628g Chr4 complement(157597..162561) [4965 bp, 1654 aa] {ON}
            highly similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1654

 Score =  437 bits (1123), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 314/974 (32%), Positives = 501/974 (51%), Gaps = 116/974 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLI----------- 299
            R + +    +  PP   R PS + ++   + ++ L   L++++ TS LI           
Sbjct: 346  RADMFFLEVVIVPPTRFRLPSKLGEEIHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 402

Query: 300  --KAGLE-KGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLK 356
              K  +E K +  N +M  +  +Q  V  +I+S         G TGGKV PI G  Q L+
Sbjct: 403  KDKVSVEDKKVIFNRLMNAFVTIQNDVNAFIDSTKAQ-----GNTGGKV-PIPGVKQALE 456

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 457  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQ 516

Query: 417  LVVNGPNEYPGANYLLKKDED--ARRNLRFGDRVKLAKNL----------RIGDLVERHL 464
             V+NGP+++PGA  +  +D    +   +    R  LA  L           +   V RH+
Sbjct: 517  AVINGPDKWPGATQIQNEDGSLVSLVGMTTEQRKALANQLLTPSSHSATHSLNKKVYRHI 576

Query: 465  EDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQSE 523
            ++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E
Sbjct: 577  KNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 636

Query: 524  EARAEAINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMM-- 581
             ARAEA NL    S  LTP SG P+    QD I+    +++KDSFF + +  Q +     
Sbjct: 637  NARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREEYQQYIYGCIR 696

Query: 582  -SDGAL---QFDIPPPTIWKPCYLWTGKQIF-SLLIRPNKKSPVVLNLDAKNKVYIPPKS 636
              DG     +    PP ++KP  LWTGKQI  ++L+         +NL +KNK+    K+
Sbjct: 697  PEDGHATRNKLLTVPPAVFKPVPLWTGKQIITTVLLNVTPADMPGINLLSKNKI----KN 752

Query: 637  KSLPNEMSQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMA 696
            +      ++ND  V+ +  ++L G++DKS  G   K+ + +++   YG   +A+ ++ + 
Sbjct: 753  EYWGKGSTEND--VVFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVSAKVLSVLG 809

Query: 697  KLCARYVGNRGFSIGISDVTPAXXXXXXXXXMVES-------AYAKCDELIDLFSKGKLE 749
            +L   Y+    F+ G+ D+            ++++       A A+   L    S    E
Sbjct: 810  RLFTNYITATAFTCGMDDLRLTEEGNKWRSDILKTSTDVGRVAAAEVTNLDKDVSANDSE 869

Query: 750  TQPGCNEEQTLEAKIGGL-------LSKVREEVGEVCI-----NELDNMNAPLIMATCGS 797
                  E    + K+G L       ++ +  +V   C+      +  N N+   MA  G+
Sbjct: 870  LLKRLEEILRDDNKLGILDAVTSSKVNSITSQVVSKCVPDGTMKKFPN-NSMQAMALSGA 928

Query: 798  KGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTPP 857
            KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P 
Sbjct: 929  KGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAMAGGYIKGRFYSGIKPQ 988

Query: 858  EFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTYGGD 917
            E+ +H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF YGGD
Sbjct: 989  EYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDADGTLIQFLYGGD 1048

Query: 918  GLDPLEMEGNAQPVNFNRTWDHATNVTF--NNMDRGLLPYQIMQVTEEILQPLENRLVRY 975
             +D  +               H T   F  +N D  L  Y    + E +   +E+ L +Y
Sbjct: 1049 AVDVTQ-------------ESHMTQFKFCADNYDALLKKYNPAALIEHL--DVESAL-KY 1092

Query: 976  DNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELMDEPAL 1035
                ++   ++R + E +     +  +             +++KF  SK +  + +    
Sbjct: 1093 ----SKKALKHRKKTEKVPHYSQKVKY-----------DPVVSKFNPSKYLGSVSENFQD 1137

Query: 1036 ELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSI 1095
            +L+S  +D N   D+  S D V   ++K  R  ++   LKY R+ + PG AVG I +QS+
Sbjct: 1138 KLESF-IDSN--NDLFKSRDTV---SEKKFRALMQ---LKYMRSLINPGEAVGIIASQSV 1188

Query: 1096 GEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN-AVLVNESDERAAR 1153
            GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +L + +D +A  
Sbjct: 1189 GEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILADVTDPQADT 1248

Query: 1154 VVKGRIEKTLLSDV 1167
              K  + K +LS+V
Sbjct: 1249 FCKS-VTKVMLSEV 1261

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 88/162 (54%), Gaps = 2/162 (1%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVT-NHILEVYSVLGIE 1327
            V++ + +I R V    ++GKR L+ EG   +++   D  +    +T N +  V    G+E
Sbjct: 1487 VIREVKNIDRCVHPEPENGKRILVTEGVNFQEMWDQDAFIDVNGITSNDVASVLKTYGVE 1546

Query: 1328 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1547 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1605

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            E T   L  A    + + ++  S  I+LG+   +GTGAF V+
Sbjct: 1606 ETTCQFLTKAVLDNECENLDSPSARIVLGKLNNVGTGAFDVL 1647

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 69/146 (47%), Gaps = 13/146 (8%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +I+ ++F  ++A DI   S ++I+   + D  N   P +GG  D  +G    +
Sbjct: 3   ISKPVGSEITSVDFGVMTAQDIRNFSAMQITNPTVLD--NLGHPISGGLYDLALGAFLRN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           + C TC  +   C GH GHI+L +P ++  +F      L+  C  C    L+ ++   + 
Sbjct: 61  L-CATCGLDEKFCPGHQGHIELPVPCYNPLFFSQLYIFLRSSCLYCHGFRLKASEVHRYA 119

Query: 125 SELRRPGVDNLRRMGILKKVLDQCKK 150
            +L+      L + G+    +D+C K
Sbjct: 120 CKLK------LLQYGL----IDECYK 135

>NDAI0H01200 Chr8 complement(280165..285174) [5010 bp, 1669 aa] {ON}
            Anc_7.51
          Length = 1669

 Score =  435 bits (1118), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 302/907 (33%), Positives = 468/907 (51%), Gaps = 98/907 (10%)

Query: 304  EKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRFR 363
            ++ +  + +M  +  +Q  V  +I+S         G TGGKV PI G  Q L+ K+G FR
Sbjct: 418  DRRVIFSRLMNAFVTIQNDVNAFIDSTKA-----QGTTGGKV-PIPGVKQALEKKEGLFR 471

Query: 364  GNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGPN 423
             ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q V+NGP+
Sbjct: 472  KHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPD 531

Query: 424  EYPGANYLLKKDED--ARRNLRFGDRVKLAKNL----------RIGDLVERHLEDGDVVL 471
            ++PGA  +  +D    +   +    R  LA  L           +   V RH+++ D+V+
Sbjct: 532  KWPGAAQIQNEDGSLVSLVGMSAEQRKALANQLMTPSSNVGTHTLNKKVYRHIKNRDIVI 591

Query: 472  FNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAI 530
             NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E ARAEA 
Sbjct: 592  MNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAF 651

Query: 531  NLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMM---SDGAL- 586
            NL    S  LTP SG P+    QD I+    ++ KDSFF +    Q +       DG   
Sbjct: 652  NLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHAT 711

Query: 587  --QFDIPPPTIWKPCYLWTGKQIFS-LLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPNEM 643
              +    PPTI+KP  LWTGKQI S +L+         +NL + NK+          NE 
Sbjct: 712  RPKLITLPPTIYKPVPLWTGKQIISTVLLNVTPADMPGINLTSSNKI---------KNEY 762

Query: 644  ---SQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCA 700
               S N+  VL +  ++L G++DKS  G   K  + +++   YG   AA+ ++ + +L  
Sbjct: 763  WGKSSNENEVLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSIAAKVLSVLGRLFT 821

Query: 701  RYVGNRGFSIGISDVTPAXXXXXXXXXM----VESAYAKCDELIDL----------FSKG 746
             Y+ +  F+ G+ D+  +         +    V++      E+ +L            K 
Sbjct: 822  NYIMSTAFTCGMDDLRLSEEGNKWRSDILKTSVDTGREAAAEVTNLDKDTAADDAELLKR 881

Query: 747  KLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCINELDNMNAPL----IMATCGSKGSTL 802
              E     N+   L+A     ++ +  +V   C+ +      P      MA  G+KGS +
Sbjct: 882  LEEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMALSGAKGSNV 941

Query: 803  NVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTPPEFLYH 862
            NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P E+ +H
Sbjct: 942  NVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYIKGRFYSGIKPQEYYFH 1001

Query: 863  AISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTYGGDGLDPL 922
             ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YGGD +D +
Sbjct: 1002 CMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSVRDGDGTLIQFLYGGDAVD-V 1060

Query: 923  EMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQVTEEILQPLENRLVRYDNLGNEI 982
              E +    +F            +N D  L  Y    + E +   +E  L +Y    ++ 
Sbjct: 1061 TKESHMTEFDF----------CLDNYDALLNKYNPSALIEHL--DVETAL-KY----SKK 1103

Query: 983  TKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELMDEPALELQSVDL 1042
            T +NR +        A+   + +   +      +L+KF  +K +  + ++   +L+S  L
Sbjct: 1104 TLKNRKK-------HAKEAHHKNATKY----DPVLSKFNPAKYLGSVSEKFQDKLESY-L 1151

Query: 1043 DENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQM 1102
            D+N      H       +++K  R  ++   LKY R+ + PG AVG I +QS+GEP TQM
Sbjct: 1152 DKNSKLFKSHD-----NVSEKKFRALMQ---LKYMRSLINPGEAVGIIASQSVGEPSTQM 1203

Query: 1103 TLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN-AVLVNESDERAARVVKGRIE 1160
            TL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +  + SDE+A    K  I 
Sbjct: 1204 TLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWQDVSDEQADTFCKS-IS 1262

Query: 1161 KTLLSDV 1167
            K +LS+V
Sbjct: 1263 KVVLSEV 1269

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVT-NHILEVYSVLGIE 1327
            +++ +  I R V    ++GKR L+ EG     +   +  +    +T N +  V    G+E
Sbjct: 1502 IIREVPHIDRCVHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1561

Query: 1328 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1562 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1620

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            E T   L  A    +++ +E  S  I++G+   +GTG+F ++
Sbjct: 1621 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1662

 Score = 50.1 bits (118), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 59/124 (47%), Gaps = 3/124 (2%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +I+ ++F  L++ +I   S  +I+   + D  N   P +GG  D  +G    +
Sbjct: 3   ISKPVGSEITSVDFGILTSEEIRQLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           + C +C  +   C GH GHI+L +P ++  +F      L+  C  C  + L+  +   F 
Sbjct: 61  L-CSSCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHLKLKQIEVHRFA 119

Query: 125 SELR 128
            +LR
Sbjct: 120 CKLR 123

>Suva_8.391 Chr8 (702691..707688) [4998 bp, 1665 aa] {ON} YOR341W
            (REAL)
          Length = 1665

 Score =  433 bits (1114), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 317/973 (32%), Positives = 496/973 (50%), Gaps = 114/973 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLI----------- 299
            + +++    +  PP   R PS +  +   ++++ L   L++V+ T+ LI           
Sbjct: 351  KADSFFMDVIVVPPTRFRLPSKLGDEVHENSQNQL---LSKVLTTALLIRDLNDDLSKLQ 407

Query: 300  --KAGLE-KGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLK 356
              K  LE + +  + +M  +  +Q  V  +I+S         G T GKV PI G  Q L+
Sbjct: 408  KDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKA-----QGRTSGKV-PIPGVKQALE 461

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 462  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQ 521

Query: 417  LVVNGPNEYPGANYLLKKDED--ARRNLRFGDRVKLAKNL----------RIGDLVERHL 464
             V+NGP+++PGA  +  +D    +   +    R  LA  L           +   V RH+
Sbjct: 522  AVINGPDKWPGATQIQNEDGSLVSLIGMSLEQRKALANQLLTPSSNVSTHTLNKKVYRHI 581

Query: 465  EDGDVVLFNRQPSLHRLSILSHYAKIRP-WRTFRLNECVCTPYNADFDGDEMNLHVPQSE 523
            ++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E
Sbjct: 582  KNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 641

Query: 524  EARAEAINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMM-- 581
             ARAEA+NL    S  LTP SG P+    QD I+    ++ KDSFF +    Q +     
Sbjct: 642  NARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIR 701

Query: 582  -SDGALQFD---IPPPTIWKPCYLWTGKQIFSLLIRPNKKSPVV--LNLDAKNKVYIPPK 635
              DG    +     PP I+KP  LWTGKQI + ++  N   P +  +NL + NK+     
Sbjct: 702  PEDGHTTRNKIITLPPAIFKPYPLWTGKQIITTVLL-NVTPPDMPGINLISTNKIKNEYW 760

Query: 636  SK-SLPNEMSQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNR 694
             K SL NE       VL +   +L G++DKS  G   K+ + +++   YG + AA+ ++ 
Sbjct: 761  GKGSLENE-------VLFKDGALLCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLSV 812

Query: 695  MAKLCARYVGNRGFSIGISDVTPAXXXXXXXXXM----VESAYAKCDELIDL-------- 742
            + +L   Y+    F+ G+ D+            +    V++      E+ +L        
Sbjct: 813  LGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGRQAAAEVTNLNKDTPADD 872

Query: 743  --FSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCINELDNMNAPL----IMATCG 796
                K   E     N+   L+A     ++ +  +V   C+ +      P      MA  G
Sbjct: 873  AELLKRLQEILRDNNKSGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPCNSMQAMALSG 932

Query: 797  SKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTP 856
            +KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P
Sbjct: 933  AKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKP 992

Query: 857  PEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTYGG 916
             E+ +H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN++R +   +VQF YGG
Sbjct: 993  QEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRDADGTLVQFMYGG 1052

Query: 917  DGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQVTEEILQPLENRLVRYD 976
            D +D +  E +     F            +N    L  Y    + E +   +E+ L    
Sbjct: 1053 DAVD-ITKESHMTQFEF----------CLDNYYALLKKYNPSALIEHL--DVESAL---- 1095

Query: 977  NLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELMDEPALE 1036
                   K ++  ++Y  ++  E  +  +++        +LAK+  +K +  + +    +
Sbjct: 1096 -------KYSKKTLKYRKKHSKEPHYKQAVK-----YDPVLAKYNPAKYLGSVSENFQDK 1143

Query: 1037 LQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIG 1096
            L+S  LD+N    +  S D V    +K  R  ++   LKY R+ + PG AVG I +QS+G
Sbjct: 1144 LESF-LDKN--SKLFKSADGV---NEKKFRALMQ---LKYMRSLINPGEAVGIIASQSVG 1194

Query: 1097 EPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNE-SDERAARV 1154
            EP TQMTL TFHFAG  + NVTLG+PR++EI+  AS  I TP +   + ++ SDE+A   
Sbjct: 1195 EPSTQMTLNTFHFAGHGAANVTLGIPRLREIVMTASSAIKTPQMTLPIWDDVSDEQADTF 1254

Query: 1155 VKGRIEKTLLSDV 1167
             K  I K LLS+V
Sbjct: 1255 CKS-ISKVLLSEV 1266

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVT-NHILEVYSVLGIE 1327
            +++ +  I R V    ++GKR L+ EG   + +   +  +    +T N +  V    G+E
Sbjct: 1498 IIRQIPRIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVDGITSNDVAAVLRTYGVE 1557

Query: 1328 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1387
            AAR ++V EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S +++ S+
Sbjct: 1558 AARNTVVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSFMKM-SY 1616

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            E T   L  A    +++ ++  S  I++G+   +GTG+F V+
Sbjct: 1617 ETTCQFLTKAVLDNEREQLDSPSARIVVGRLNNVGTGSFDVL 1658

 Score = 50.4 bits (119), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 58/124 (46%), Gaps = 3/124 (2%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +I+ ++F  L+A +I   S  +I+   + D  N   P +GG  D  +G    +
Sbjct: 3   ISKPVGSEITSVDFGILTAKEIRNLSAKQITNPTVLD--NLGHPVSGGLYDLALGAFLRN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           + C TC  +   C GH GHI+L +P ++  +F      L+  C  C    L+  +   + 
Sbjct: 61  L-CSTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYA 119

Query: 125 SELR 128
            +L+
Sbjct: 120 CKLK 123

>TDEL0H04000 Chr8 (680730..685727) [4998 bp, 1665 aa] {ON} Anc_7.51
            YOR341W
          Length = 1665

 Score =  433 bits (1113), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 308/974 (31%), Positives = 497/974 (51%), Gaps = 116/974 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLIK------AGLE 304
            + + +    +  PP   R PS M ++   + ++ L   L++++ TS LI+      + ++
Sbjct: 350  KADNFFMEVVLVPPTRFRLPSKMGEEVHENTQNQL---LSKILTTSLLIRDLNDEMSTIQ 406

Query: 305  KG-ISINN-------MMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLK 356
            K  +S+++       +M  +  +Q  V  +I+S         G    K+ P+ G  Q L+
Sbjct: 407  KDKVSVDDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GSASSKI-PVPGVKQALE 460

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 461  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELRQ 520

Query: 417  LVVNGPNEYPGANYLLKKDED--ARRNLRFGDRVKLAKNLR----------IGDLVERHL 464
             V+NGP+++PGA+ +  +D    +   +    R  LA  L           +   V RH+
Sbjct: 521  AVINGPDKWPGASQIQNEDGTLVSLVGMTLEQRKALANQLMTPSSNVSTHPLNKKVYRHI 580

Query: 465  EDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQSE 523
            ++ DVVL NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E
Sbjct: 581  KNRDVVLMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 640

Query: 524  EARAEAINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLL----- 578
             ARAEA NL    S  LTP SG P+    QD I+    ++ KDSFF + +  Q +     
Sbjct: 641  NARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREEYQQYIYGCIR 700

Query: 579  ---SMMSDGALQFDIPPPTIWKPCYLWTGKQIFS-LLIRPNKKSPVVLNLDAKNKVYIPP 634
                  S G +     PP + KP  LWTGKQI S +L+         +NL++ NK+    
Sbjct: 701  PEHGHASRGKIV--TMPPAVLKPVPLWTGKQIISTVLLNVTPADMPGINLESNNKI---- 754

Query: 635  KSKSLPNEMSQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNR 694
            K++      ++ND  V+ +  +++ G++DKS  G   K+ + +++   YG + AA+ ++ 
Sbjct: 755  KNEYWGKGSTEND--VIFKNGELVCGILDKSQYG-ASKYGIVHSLHEVYGPEVAAKVLSV 811

Query: 695  MAKLCARYVGNRGFSIGISDVTPAXXXXXXXXXMVES-------AYAKCDEL-------- 739
            + +L   Y+    F+ G+ D+            ++++       A A+   L        
Sbjct: 812  LGRLFTNYITATAFTCGMDDLRLTAEGNKSRSEILKTSIDIGRQAAAEVTNLDKDTPSDD 871

Query: 740  IDLFSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCINELDNMNAPL----IMATC 795
            ++L  + + E     N+   L+A     ++ V  +V   C+ +      P      MA  
Sbjct: 872  VELLKRLE-EILRDENKSGILDAVTSSKVNTVTSKVVSTCVPDGTMKKFPYNSMQAMALS 930

Query: 796  GSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLT 855
            G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ 
Sbjct: 931  GAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDSMAGGYIKGRFYSGIK 990

Query: 856  PPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTYG 915
            P E+ +H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF YG
Sbjct: 991  PQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGSLIQFLYG 1050

Query: 916  GDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQVTEEILQPLENRLVRY 975
            GD +D +  E +    +F R           N D  L  Y  + + E +   +E  L +Y
Sbjct: 1051 GDAVD-VTKESHMTQFDFCR----------ENYDALLKKYNPVALAEHL--DVETAL-QY 1096

Query: 976  DNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELMDEPAL 1035
                ++  K+N     Y  +   +                +LAK+  +K +  + ++   
Sbjct: 1097 SKKVSKNRKKNSKTAHYEQKVKYD---------------PVLAKYNPAKYLGSVSEKFHD 1141

Query: 1036 ELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSI 1095
            +L+S   D+      R SV           + F  +  LKY R+ + PG AVG I +QS+
Sbjct: 1142 KLESYLEDKAKEFKSRESVS---------AKRFRALMQLKYMRSLINPGEAVGIIASQSV 1192

Query: 1096 GEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNE-SDERAAR 1153
            GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + ++ SDE+A  
Sbjct: 1193 GEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSAIKTPQMTLPIWDDVSDEQADL 1252

Query: 1154 VVKGRIEKTLLSDV 1167
              K  I K +LS+V
Sbjct: 1253 FCKS-ISKVVLSEV 1265

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 49/162 (30%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVT-NHILEVYSVLGIE 1327
            V++ +  I R V +   + KR L+ EG   + +   +  +    +T N +  V    G+E
Sbjct: 1497 VIREVPHIDRCVHSEPVNNKRMLVTEGVNFQAMWDQEAFIDVDAITSNDVASVLRTYGVE 1556

Query: 1328 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1557 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1615

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            E T   L  A    +++ +E  S  I+LG+   +GTG+F ++
Sbjct: 1616 ETTCQFLTKAVLDNEREELESPSARIVLGKLSNVGTGSFDLL 1657

 Score = 51.6 bits (122), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 58/124 (46%), Gaps = 3/124 (2%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +I+ L+F+ L+  DI   S  +I+   + D  N   P +GG  D  +G    +
Sbjct: 3   ISKPVGSEITSLDFNILTPQDIRNLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           + C TC  +   C GH GHI+L +P ++  +F      L+  C  C    L+  +   + 
Sbjct: 61  L-CSTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSCCLFCHHFRLKKVEVHRYA 119

Query: 125 SELR 128
            +L+
Sbjct: 120 CKLK 123

>NCAS0F00730 Chr6 complement(143500..148524) [5025 bp, 1674 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1674

 Score =  432 bits (1111), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 303/906 (33%), Positives = 470/906 (51%), Gaps = 96/906 (10%)

Query: 304  EKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRFR 363
            ++ I  + +M  +  +Q  V  +I+S         G  GGK+ PI G  Q L+ K+G FR
Sbjct: 423  DRRIIFSRLMNAFVTIQNDVNAFIDSTKAQ-----GTAGGKL-PIPGVKQALEKKEGLFR 476

Query: 364  GNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGPN 423
             ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q V+NGP+
Sbjct: 477  KHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPD 536

Query: 424  EYPGANYLLKKDEDARRNLRFG----DRVKLAKNL----------RIGDLVERHLEDGDV 469
            ++PGA  +  ++ED       G     R  LA  L           +   V RH+++ D+
Sbjct: 537  KWPGATQI--QNEDGSLVSLIGMSTEQRKALANQLMTPSSNITTHTLNKKVYRHIKNRDI 594

Query: 470  VLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAE 528
            V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E ARAE
Sbjct: 595  VIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAE 654

Query: 529  AINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMM---SDGA 585
            A NL    S  LTP SG P+    QD I+    ++ KDSFF +    Q +       DG 
Sbjct: 655  ASNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGH 714

Query: 586  L---QFDIPPPTIWKPCYLWTGKQIFS-LLIRPNKKSPVVLNLDAKNKVYIPPKSKSLPN 641
                +    PPTI KP  LWTGKQI S +L+     +   +NL + NK+    K++    
Sbjct: 715  ATRSKLITMPPTIHKPVPLWTGKQIISTVLLNITPANMPGINLKSSNKI----KNEYWGT 770

Query: 642  EMSQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCAR 701
               +N+  VL +  ++L G++DKS  G   K  + +++   YG   AA+ ++ + +L   
Sbjct: 771  GSQENE--VLFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPSVAAKVLSVLGRLFTN 827

Query: 702  YVGNRGFSIGISDVTPAXXXXXXXXXM----VESAYAKCDELIDL----------FSKGK 747
            Y+ +  F+ G+ D+            +    V++      E+ +L            K  
Sbjct: 828  YIMSTAFTCGMDDLRLTEEGNKWRSDILKTSVDTGREAAAEVTNLDKDTPANDPELLKRL 887

Query: 748  LETQPGCNEEQTLEAKIGGLLSKVREEVGEVCINELDNMNAPL----IMATCGSKGSTLN 803
             E     N+   L+A     ++ +  +V   C+ +      P      MA  G+KGS +N
Sbjct: 888  QEILRDNNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMALSGAKGSNVN 947

Query: 804  VSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTPPEFLYHA 863
            VSQ++ ++GQQ + G RVP     ++LP F        + G+V+  F+SG+ P E+ +H 
Sbjct: 948  VSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHC 1007

Query: 864  ISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTYGGDGLDPLE 923
            ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR +   ++QF YGGD +D + 
Sbjct: 1008 MAGREGLIDTAVKTSRSGYLQRCLTKQLEGIHISYDNSVRDTDGTLIQFLYGGDAVD-VT 1066

Query: 924  MEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQVTEEILQPLENRLVRYDNLGNEIT 983
             E +    +F            +N D  L  Y    + E +   +E+ L +Y        
Sbjct: 1067 KESHMTEFDF----------CLDNYDALLNKYNPSALIEHL--DVESAL-KYSK------ 1107

Query: 984  KENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELMDEPALELQSVDLD 1043
            K  ++R ++I +   ++   +           +L+KF  +K +  + ++   +L+   LD
Sbjct: 1108 KSLKNRKKHIKEPHYKQNIKYD---------PVLSKFNPAKYLGSVSEKFQDKLEGY-LD 1157

Query: 1044 ENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMT 1103
            +N    +  S D V    +K  R  ++   LKY R+ + PG AVG I +QS+GEP TQMT
Sbjct: 1158 KN--SKLFKSHDSV---NEKKFRALMQ---LKYMRSLINPGEAVGIIASQSVGEPSTQMT 1209

Query: 1104 LKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNE-SDERAARVVKGRIEK 1161
            L TFHFAG  + NVTLG+PR++EII  AS  I TP +   + N+ SDE+A    K  I K
Sbjct: 1210 LNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPIWNDVSDEQADTFCKS-ISK 1268

Query: 1162 TLLSDV 1167
             +LS+V
Sbjct: 1269 VVLSEV 1274

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVT-NHILEVYSVLGIE 1327
            +++ +  I R +    ++GKR L+ EG     +   +  +    +T N +  V    G+E
Sbjct: 1505 IIREVPHIDRCIHPEPENGKRVLVTEGVNFEAMWDQEAFIDVDGITSNDVASVLKTYGVE 1564

Query: 1328 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1565 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1623

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            E T   L  A    +++ +E  S  I++G+   +GTG+F ++
Sbjct: 1624 ETTLQFLTKAVLDNEREELESPSARIVMGKLNNVGTGSFDIL 1665

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 58/124 (46%), Gaps = 3/124 (2%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +I+ ++F  L++ +I   S  +I+   + D  N   P TGG  D  +G    +
Sbjct: 3   ISKPVGSEITSVDFGILTSDEIRQLSAKQITNPTVLD--NLGHPITGGLYDLSLGAFLRN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           + C TC  +   C GH GHI+L +P ++  +F      L+  C  C    L   +   F 
Sbjct: 61  L-CSTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRTSCLFCHHFRLRSIEVHRFA 119

Query: 125 SELR 128
           S+LR
Sbjct: 120 SKLR 123

>KAFR0K00540 Chr11 complement(114196..119184) [4989 bp, 1662 aa] {ON}
            Anc_7.51 YOR341W
          Length = 1662

 Score =  428 bits (1101), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 301/962 (31%), Positives = 484/962 (50%), Gaps = 115/962 (11%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLIK------AGLEKG--------IS 308
            PP   R PS + ++   ++++ L   L++++ TS LI+      + L+K         I 
Sbjct: 362  PPTRFRLPSKLGEEVHENSQNQL---LSKILTTSLLIRDLNDEMSKLQKDKVSVDDRRII 418

Query: 309  INNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRFRGNLSG 368
             + +M  +  +Q  V  +I+S         G T GKV P+ G  Q L+ K+G FR ++ G
Sbjct: 419  FSRLMNAFVTIQNDVNAFIDSTKA-----QGNTSGKV-PVPGVKQALEKKEGLFRKHMMG 472

Query: 369  KRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGPNEYPGA 428
            KRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT +N  +L+Q V+NGP+++PGA
Sbjct: 473  KRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSFNIAELRQAVINGPDKWPGA 532

Query: 429  NYLLKKDEDARRNLRFG----DRVKLAKNL-----------RIGDLVERHLEDGDVVLFN 473
              +  ++ED       G     R  LA  L            +   V RH+++ D+V+ N
Sbjct: 533  TQI--QNEDGSLVSLIGMSAEQRKALANQLMTPTSHNGATHTLNKKVYRHIKNRDIVIMN 590

Query: 474  RQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINL 532
            RQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E ARAEA NL
Sbjct: 591  RQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNL 650

Query: 533  MGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMM---SDGA---L 586
                S  LTP SG P+    QD I+    +++KDSFF +    Q +       DG     
Sbjct: 651  ANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCIRPEDGHATRA 710

Query: 587  QFDIPPPTIWKPCYLWTGKQIFSLLIRPNKKSPVV--LNLDAKNKVYIPPKSKSLPNEMS 644
            +    PP + KP  LWTGKQI + ++  N   P +  +NL + NK+      K       
Sbjct: 711  KLATVPPAVMKPVPLWTGKQIITTVLL-NITPPDMPGINLKSSNKIKNDYWGK------G 763

Query: 645  QNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVG 704
             N+  V+ +  ++L G++DKS  G   K+ + + +   YG   +A+A++ + +L   Y+ 
Sbjct: 764  SNENEVIFKNGELLCGILDKSQYG-ASKYGIIHCLHEVYGPDVSAKALSVLGRLFTNYIT 822

Query: 705  NRGFSIGISDVTPAXXXXXXXXXM----VESAYAKCDELIDL----------FSKGKLET 750
               F+ G+ D+            +    V++      E+ +L            K   E 
Sbjct: 823  ATAFTCGMDDLRLTEEGNKWRKEILKTSVDTGREAAAEVTNLPKDTPSNDPELLKRLEEI 882

Query: 751  QPGCNEEQTLEAKIGGLLSKVREEVGEVCI--NELDNM--NAPLIMATCGSKGSTLNVSQ 806
                N+   L+A     ++ +  +V   C+    +     N+   MA  G+KGS +NVSQ
Sbjct: 883  IRDNNKSGILDAVTSSKVNTITSKVVSTCVPGGTMKKFPENSMQSMALSGAKGSNVNVSQ 942

Query: 807  MVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTPPEFLYHAISG 866
            ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ P E+ +H ++G
Sbjct: 943  IMCLLGQQALEGRRVPVMVSGKTLPSFKPYETDARAGGYIKGRFYSGIRPQEYYFHCMAG 1002

Query: 867  REGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTYGGDGLDPLEMEG 926
            REGL+DTAVKTA +GY+ R L K LE +   YDN++R +   ++Q  YGGD +D +  E 
Sbjct: 1003 REGLIDTAVKTASSGYLQRCLTKQLEGVHVSYDNSIRDADGTLIQMLYGGDAID-VTKES 1061

Query: 927  NAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQVTEEILQPLENRLVRYDNLGNEITKEN 986
            +    NF             N D  L  Y    + E +   +E  L           K +
Sbjct: 1062 HLTKFNF----------CLENYDALLKKYNPSALIEHL--DVETAL-----------KYS 1098

Query: 987  RDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELMDEPALELQSVDLDENV 1046
            +  ++Y  ++  E  +  +++        +L+K+  +K +  + +    +L      EN 
Sbjct: 1099 KKSLKYRKKHAKEAHYQQTVK-----YDPILSKYNPAKYLGSVSENFQDQL------ENF 1147

Query: 1047 PEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGEPGTQMTLKT 1106
              D    +     + +K  R  ++   LKY R+ + PG AVG I +QS+GEP TQMTL T
Sbjct: 1148 LHDNSKLLKSHEDVNEKKFRALMQ---LKYMRSLINPGEAVGIIASQSVGEPSTQMTLNT 1204

Query: 1107 FHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNESDERAARVVKGRIEKTLLS 1165
            FHFAG  + NVTLG+PR++EII  AS  I TP +   ++++  +  A      I K +LS
Sbjct: 1205 FHFAGHGAANVTLGIPRLREIIMTASAAIKTPQMTLPILDDVTDEQADTFAKSISKVVLS 1264

Query: 1166 DV 1167
            +V
Sbjct: 1265 EV 1266

 Score = 82.8 bits (203), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 52/167 (31%), Positives = 86/167 (51%), Gaps = 12/167 (7%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGL------RDVMSTDGVVGHKTVTNHILEVYS 1322
            V++ +  I R V    ++GKR L+ EG          D +  DG+      +N +  V  
Sbjct: 1495 VIRQVPKIDRCVHPEPENGKRVLVTEGVNFNAMWDQEDFIDVDGIR-----SNDVSAVLK 1549

Query: 1323 VLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVL 1382
              G+EAAR ++V EI+   S + +SV  RH+ LL D+MT +G  L   R G+     S++
Sbjct: 1550 TYGVEAARNTVVNEINNVFSRYAISVSFRHLDLLADMMTRQGTYLAFNRQGMETSTSSLM 1609

Query: 1383 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            ++ S+E T   L  A    +++ +   S  I+LG+   +GTG+F V+
Sbjct: 1610 KM-SYETTCQFLTKAVLDNEREELNTPSARIVLGKLNNVGTGSFDVL 1655

 Score = 55.1 bits (131), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 58/117 (49%), Gaps = 3/117 (2%)

Query: 12  KISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSMECQTCH 71
           +I+ ++FS L++ DI + S  +I    + D  N   P +GG  D  +G    ++ C TC 
Sbjct: 10  EITSVDFSILTSKDIRSLSAKQIINPTVLD--NLGHPISGGLYDLSLGAFLRNL-CTTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFLSELR 128
            +   C GH GHI+L +PV++  +F      L+  C  C    L+  +   F  +L+
Sbjct: 67  LDEKFCPGHVGHIELPVPVYNPLFFNQLYIYLRSSCLFCHHFRLKSAEVHRFALKLK 123

>TPHA0H02800 Chr8 (659254..664200) [4947 bp, 1648 aa] {ON} Anc_7.51
            YOR341W
          Length = 1648

 Score =  427 bits (1099), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 327/1057 (30%), Positives = 520/1057 (49%), Gaps = 161/1057 (15%)

Query: 264  PPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLIK------AGLEKG--------IS 308
            PP   R PS +  +   ++++ L   L++++ TS LI+      + L+K         I 
Sbjct: 357  PPTRFRLPSKLGDEVHENSQNQL---LSKILTTSLLIRDLNDEISKLQKDKVALDDRRII 413

Query: 309  INNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRFRGNLSG 368
             + +M  +  +Q  V  +I+S         G   GK+ P+ G  Q L+ K+G FR ++ G
Sbjct: 414  FSRLMNAFVTIQNDVNSFIDSSKA-----QGNNSGKL-PVPGVKQALEKKEGLFRKHMMG 467

Query: 369  KRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLVVNGPNEYPGA 428
            KRV+++ R+VISPDPN+  DE+ VP   A  LTYPE VT YN  +L+Q V+NGP+++PGA
Sbjct: 468  KRVNYAARSVISPDPNIETDEIGVPPVFATKLTYPEPVTSYNIAELRQAVINGPDKWPGA 527

Query: 429  NYLLKKDED--ARRNLRFGDRVKLAKNL----------RIGDLVERHLEDGDVVLFNRQP 476
              +  +D    +   +    R  LA  L           +   V RH+++ DVV+ NRQP
Sbjct: 528  TQIQNEDGSLVSLIGMTVEQRKALANQLMTPSSNPATHTLNKKVYRHIKNRDVVIMNRQP 587

Query: 477  SLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQSEEARAEAINLMGV 535
            +LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E ARAEA NL   
Sbjct: 588  TLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENARAEAFNLANT 647

Query: 536  KSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMM---SDGAL---QFD 589
             S  LTP SG P+    QD I+    ++ KDS+F +    Q +       DG     +  
Sbjct: 648  DSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSYFTREQYQQYIYGCIRPEDGHSANNKLL 707

Query: 590  IPPPTIWKPCYLWTGKQIFSLLIRPNKKSPVVL---NLDAKNKVYIPPKSKSLPNEMSQN 646
              PP I KP  LWTGKQI + ++     SPV +   NL +KNK+    K +       +N
Sbjct: 708  TIPPAIIKPVPLWTGKQIITTVLL--NVSPVDMPGINLKSKNKI----KDEYWGQHSEEN 761

Query: 647  DGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKLCARYVGNR 706
            +  VL +   +L G++DKS  G   K+ + + +   YG + AA+ ++ + +L   Y+ N 
Sbjct: 762  E--VLFKDGALLCGILDKSQYG-ASKYGIVHALQEVYGPEVAAKVLSVLGRLFTNYITNT 818

Query: 707  GFSIGISDVTPAXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQTLEAKIGG 766
             F+ G+ D+              E    + D L     +G+       N E+   A    
Sbjct: 819  AFTCGMDDLRLTD----------EGNKWRTDILKTSVDRGRQAAVEVTNLEKDTSADDSE 868

Query: 767  LLSKVRE------------EVGEVCINELDNM----------------NAPLIMATCGSK 798
            LL ++ E             V    +N + +                 N+   MA  G+K
Sbjct: 869  LLKRLEEILRDDNKSGILDAVTSSKVNAITSQVVSKCVPGGTMKRFPENSMQSMALSGAK 928

Query: 799  GSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTPPE 858
            GS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+ P E
Sbjct: 929  GSNVNVSQIMCLLGQQALEGRRVPIMVSGKTLPSFKPFETDAMAGGYIKGRFYSGIKPQE 988

Query: 859  FLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTYGGDG 918
            + +H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +++F YGGD 
Sbjct: 989  YYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLIEFLYGGDA 1048

Query: 919  LDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQVTEEILQPLENRLVRYDNL 978
            +D  +            ++ +  +   +N D  L  Y                L+ + ++
Sbjct: 1049 VDVTK-----------ESYMNQFDFCLDNYDSLLKRYNPAA------------LIDFLDV 1085

Query: 979  GNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELMDEPALELQ 1038
             + + K ++  +++  +N   +   H L++  +    +LAK+  +K +  + ++   +L+
Sbjct: 1086 DSAL-KYSKKTLKHRKKN---KNVPHYLQNIKYDP--VLAKYNPAKYLGSVSEKFQDKLE 1139

Query: 1039 SVDLDENVPEDIRHSVDQVYRITDKMVRE--FLRVAILKYRRAKVEPGTAVGAIGAQSIG 1096
            +  LD N          Q+++ + K V E  F  +  LKY R+ + PG AVG I +QS+G
Sbjct: 1140 NF-LDSN---------SQLFK-SHKSVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVG 1188

Query: 1097 EPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNESDERAARVV 1155
            EP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++++  +  A + 
Sbjct: 1189 EPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILDDVTDDQADIF 1248

Query: 1156 KGRIEKTLLSDV---------------------AFYIQDVYRDNLSYLQVRVDLSTIDKL 1194
               I K +LS+V                      FY QD Y  N  Y   + +L  +   
Sbjct: 1249 AKSISKVILSEVIDSVSVTETTTSQSRSYVISMKFYEQDEY--NEEYDISKEELQNVVAN 1306

Query: 1195 QLELTIEDIAVAMTRAPKLKIQASDVHI-VGKDKIAI 1230
               LT  +IA+      + K  ASDV I + K ++A+
Sbjct: 1307 NF-LTSLEIAIHKEIKKQKKTTASDVGIAIPKAQLAL 1342

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 89/167 (53%), Gaps = 12/167 (7%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLR------DVMSTDGVVGHKTVTNHILEVYS 1322
            VV+ + +I R V    ++GKR L+ EG   +      D ++ DG+      +N +  V  
Sbjct: 1481 VVRQVPNIDRCVHPNAENGKRVLVTEGVNFQAMWEQNDFVNVDGIT-----SNDVSSVLK 1535

Query: 1323 VLGIEAARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVL 1382
              G+EAAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++
Sbjct: 1536 TYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGSYLAFNRQGMETSTSSLM 1595

Query: 1383 QLASFEKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            ++ S+E T   L  A    +++ +   S  I+LG+   +GTGAF V+
Sbjct: 1596 KM-SYETTCQFLTKAVLDNEREELNSPSARIVLGKLNNVGTGAFDVL 1641

 Score = 52.8 bits (125), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 58/124 (46%), Gaps = 3/124 (2%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +I+ ++FS LSA +I   S  +I+   + D  N   P +GG  D  +G    +
Sbjct: 3   ISKPVGSEITSVDFSILSAEEIRNLSTKQITNPTVLD--NLGHPISGGLYDLALGAFLRN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           + C TC  +   C GH GHI+L +P ++  +F      L+  C  C    L   +   + 
Sbjct: 61  L-CSTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSVEVHRYT 119

Query: 125 SELR 128
            +L+
Sbjct: 120 CKLK 123

>KLLA0F23243g Chr6 (2165407..2170368) [4962 bp, 1653 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1653

 Score =  426 bits (1094), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 303/985 (30%), Positives = 490/985 (49%), Gaps = 132/985 (13%)

Query: 254  ETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLIK------------ 300
            + +    L  PP   R PS +  +   + ++ L   L++++ TS LI+            
Sbjct: 353  DMFFMEVLIVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSRLQKD 409

Query: 301  --AGLEKGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGK 358
              +  ++ +  N +M  +  +Q  V  +I+S     +     +G KV PI G  Q L+ K
Sbjct: 410  KVSADDRKVIFNRLMNAFVTIQNDVNAFIDSTKAQSS-----SGNKV-PIPGLKQALEKK 463

Query: 359  QGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQLV 418
            +G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q V
Sbjct: 464  EGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNVAELRQAV 523

Query: 419  VNGPNEYPGANYLLKKDED--ARRNLRFGDRVKLAKNL----------RIGDLVERHLED 466
            +NGP+++PGA  +  +D    +   +    R  LA  L           I   V RH+++
Sbjct: 524  INGPDKWPGATQIQNEDGSFVSLVGMTLEQRKALANQLLTPSTHDVAHSINKKVYRHIKN 583

Query: 467  GDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQSEEA 525
             DVV+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E A
Sbjct: 584  RDVVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNENA 643

Query: 526  RAEAINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMM---S 582
            +AEA+NL    S  LTP SG P+    QD I+    ++ KDSFF +    Q +       
Sbjct: 644  KAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPE 703

Query: 583  DGAL---QFDIPPPTIWKPCYLWTGKQIF-SLLIRPNKKSPVVLNLDAKNKVYIPPKSKS 638
            DG     +    PP + KP  LWTGKQI  ++L+     +   +NL++KNK+    K++ 
Sbjct: 704  DGHATRNKLVTIPPAVMKPEPLWTGKQIITTVLLNTCPANMPGINLNSKNKI----KNEY 759

Query: 639  LPNEMSQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMAKL 698
                  +N+  V+ +  Q+L G++DKS  G   K  + +++   YG   AA+ ++ + +L
Sbjct: 760  WGKSSEENN--VVFKDGQLLCGILDKSQYG-ASKFGIVHSLHEVYGPDVAAKVLSVLGRL 816

Query: 699  CARYVGNRGFSIGISDVTPAXXXXXXXXXMVESAYAKCDELIDLFSKGKLETQPGCNEEQ 758
               Y+    F+ G+ D+            +++++       +D+   G++      N ++
Sbjct: 817  FTNYITATAFTCGMDDLRLTAEGNKWRNDILQTS-------VDI---GRVAAAEVTNLDK 866

Query: 759  TLEAKIGGLLSKVRE------------------------EVGEVCINELDNMNAPL---- 790
             +++  G LL ++ E                        +V   C+ +      P     
Sbjct: 867  DVKSDDGELLKRLEEILRDDNKLGILDAITSSKVNSITSQVVSKCVPDGTMKKFPYNSMQ 926

Query: 791  IMATCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSF 850
             MA  G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F
Sbjct: 927  AMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRF 986

Query: 851  FSGLTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIV 910
            +SG+ P E+ +H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++
Sbjct: 987  YSGIRPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLI 1046

Query: 911  QFTYGGDGLDPLEMEGNAQPVNFNRTWDHATNVTF--NNMDRGLLPYQIMQVTEEILQPL 968
            QF YGGD +D  +               H T   F  +N D  L  Y    + + +   +
Sbjct: 1047 QFLYGGDAVDITK-------------ESHMTEFKFCVDNYDALLKKYNPSALVDHL--DV 1091

Query: 969  ENRLVRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKE 1028
            E+ L +Y     +  K+N     Y     A+   Y            +L+KF  SK +  
Sbjct: 1092 ESAL-KYSKKTLKNRKKNSKLPHY-----AQTSKYDP----------VLSKFNPSKYLGA 1135

Query: 1029 LMDEPALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVG 1088
            +         S +  + + + I  + D   +  +   ++F  +  LKY R+ + PG AVG
Sbjct: 1136 V---------SENFQDKLEKFISTNDDFFKKDENVNEKKFRALMQLKYMRSLINPGEAVG 1186

Query: 1089 AIGAQSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNES 1147
             I +QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   + ++ 
Sbjct: 1187 IIASQSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQLTMPIRDDV 1246

Query: 1148 DERAARVVKGRIEKTLLSDVAFYIQ 1172
             +  A      I K +LS+V   +Q
Sbjct: 1247 SDELADTFCKNITKVMLSEVIDKVQ 1271

 Score = 82.4 bits (202), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/162 (29%), Positives = 86/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTV-TNHILEVYSVLGIE 1327
            +++ +  I R V    ++GKR L+ EG   + +   D  +    + +N +  V    G+E
Sbjct: 1488 IIRQVPHIDRCVHPEPENGKRVLVTEGVNFQAMWDQDDFIDINGIRSNDVAAVLKTYGVE 1547

Query: 1328 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1548 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGNYLAFNRQGMESSTSSLMKM-SY 1606

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            E T   L  A    + + ++  S  I++G+   +GTG+F ++
Sbjct: 1607 ETTCQFLTKAVLDNEHEELKSPSAKIVMGKLNGVGTGSFDLL 1648

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 65/141 (46%), Gaps = 12/141 (8%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +I+ ++FS L++ +I   S  +++   + D  N   P  GG  D  +G    +
Sbjct: 3   ISKPVGAEITSIDFSVLTSDEIRKLSAKQVTNPTVLD--NLGHPIQGGLYDLALGAFLKN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           + C TC  +   C GH GHI+L +P ++  +F      L+  C  C    L+ ++   + 
Sbjct: 61  L-CATCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLKSSEVHLYA 119

Query: 125 SELR---------RPGVDNLR 136
            +LR         R  +DN+R
Sbjct: 120 CKLRLLQYALIDERYQIDNIR 140

>TBLA0E01930 Chr5 (468692..473671) [4980 bp, 1659 aa] {ON} Anc_7.51
            YOR341W
          Length = 1659

 Score =  424 bits (1091), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 307/975 (31%), Positives = 486/975 (49%), Gaps = 116/975 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLI----------- 299
            +P+ +    +  PP   R PS +  +   + ++ L   L++++ TS LI           
Sbjct: 353  KPDAFFMDVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 409

Query: 300  --KAGLE-KGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLK 356
              K  LE + +  + +M  +  +Q  V  +I+S         G TGG    I G  Q L+
Sbjct: 410  KDKVSLEDRRVIFSRLMNAFVTIQNDVNSFIDSSKA-----QGNTGGN-DVIPGVKQALE 463

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 464  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFAVKLTYPEPVTSYNIAELRQ 523

Query: 417  LVVNGPNEYPGANYLLKKDED--ARRNLRFGDRVKLAKNLR----------IGDLVERHL 464
             V+NGP+++PGA  +  +D    +   +    R  LA  L           +   V RH+
Sbjct: 524  AVINGPDKWPGAIQIQNEDGTLVSLIGMTLEQRKALANQLMTPSSNSSSHVLNKKVYRHI 583

Query: 465  EDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQSE 523
            ++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E
Sbjct: 584  KNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 643

Query: 524  EARAEAINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMM-- 581
             ARAE++ L    S  LTP SG P+    QD I+    +++KDSFF +    Q +     
Sbjct: 644  NARAESLFLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCIR 703

Query: 582  -SDG-ALQFDIP--PPTIWKPCYLWTGKQIF-SLLIRPNKKSPVVLNLDAKNKVYIPPKS 636
              DG A +  I   PPTI+KP  LWTGKQI  ++L+         +NL +KNK+      
Sbjct: 704  PEDGHATRAKIVTLPPTIFKPIPLWTGKQIITTVLLNITPSDMPGINLHSKNKI------ 757

Query: 637  KSLPNEM---SQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMN 693
                NE      N+  V+ +   +L G++DK+  G   K+ + +++   YG   AA+ ++
Sbjct: 758  ---KNEYWGKGSNENEVIFKDGALLCGILDKNQYGSS-KYGIVHSLHELYGPDVAAKVLS 813

Query: 694  RMAKLCARYVGNRGFSIGISDVTPAXXXXXXXXXM----VESAYAKCDELIDLFSKGKLE 749
             + +L   Y+    F+ G+ D+            +    V++      E+ +L SK    
Sbjct: 814  VLGRLFTNYITATAFTCGMDDLRLTDEGNKWRRDILKTSVDTGRQAAAEVTNL-SKDTPA 872

Query: 750  TQPGC-----------NEEQTLEAKIGGLLSKVREEVGEVCI----NELDNMNAPLIMAT 794
              P             N+   L+A     ++ +  +V   C+     +    N+   MA 
Sbjct: 873  DDPELLKRLEEILRDDNKSGILDAVTSSKVNAITSKVVSTCVPGGTMKKFPYNSMQAMAL 932

Query: 795  CGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 854
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG+
Sbjct: 933  SGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPYETDAMAGGYIKGRFYSGI 992

Query: 855  TPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTY 914
             P E+ +H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +++F Y
Sbjct: 993  KPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIEFLY 1052

Query: 915  GGDGLDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQVTEEILQPLENRLVR 974
            GGD +D +  E       F             N D  +  Y    + E +   +E+ L +
Sbjct: 1053 GGDAVD-VTKESYMTQFKF----------CLENYDGLVKKYNPSALIEHL--NVESAL-K 1098

Query: 975  YDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELMDEPA 1034
            Y     +  K++     Y+  +  +                +LAK+  SK +  + ++  
Sbjct: 1099 YSKKALKYRKKHSSVPHYLQNSKYD---------------PVLAKYNPSKYLGSVSEKFQ 1143

Query: 1035 LELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQS 1094
             +L+   L+EN        V     + +K  R  ++   LKY R+ ++PG +VG I +QS
Sbjct: 1144 DKLEEF-LNEN-----SKLVKSTEGVNEKKFRALMQ---LKYMRSLIDPGESVGIIASQS 1194

Query: 1095 IGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNESDERAAR 1153
            +GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +N  ++N+   + A 
Sbjct: 1195 VGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASSSIKTPQMNLPILNDVSNQQAE 1254

Query: 1154 VVKGRIEKTLLSDVA 1168
                 I K LLS V 
Sbjct: 1255 TFCKSITKVLLSQVT 1269

 Score = 89.0 bits (219), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 57/209 (27%), Positives = 100/209 (47%), Gaps = 2/209 (0%)

Query: 1222 IVGKDKIAINVFPDGAKAKSISTLAKEPSENEVFYRMQQLRRALPGIVVKGLSDISRAVI 1281
            I+ ++K       D +K K      +  +E E    +  +       V++ + +I R V 
Sbjct: 1445 IISRNKFIAKYNFDDSKGKWCEFRLELAAETEKLLMVNIVEDVCRKSVIREVPNIERCVY 1504

Query: 1282 NIRDDGKRELLVEGYGLRDVMSTDGVVG-HKTVTNHILEVYSVLGIEAARASIVGEIDYT 1340
               ++G R L+ EG   + +   D  +   K  +N +  V    G+EAAR +IV EID  
Sbjct: 1505 PEANNGDRSLITEGVNFQAMWDQDTFIDVDKITSNDVSAVLRTYGVEAARNTIVNEIDRV 1564

Query: 1341 MSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASFEKTTDHLFDAAFY 1400
             S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+E T   L  A   
Sbjct: 1565 FSTYAISVSSRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SYETTCQFLTKAVLD 1623

Query: 1401 MKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
             + + +   S  I+LG+   +GTG+F ++
Sbjct: 1624 NEHEELNSPSARIVLGKLNNVGTGSFDIL 1652

 Score = 50.4 bits (119), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 12  KISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSMECQTCH 71
           +I+ ++F  LS+  I   S  +I+   + D  N   P +GG  D  +G    ++ C TC 
Sbjct: 10  EITSVDFEILSSDQIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRNL-CSTCG 66

Query: 72  GNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFLSELR 128
            +   C GH GHI+L +P ++  +F      L+  C  C    L+  D   +  +L+
Sbjct: 67  QDEKFCPGHQGHIELPVPCYNPLFFNQLFIYLRSSCLYCHHFRLKSLDTHLYSCKLK 123

>SAKL0B10736g Chr2 (925889..930841) [4953 bp, 1650 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341W RPA190 RNA polymerase I subunit largest subunit
            of RNA polymerase I
          Length = 1650

 Score =  417 bits (1071), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 313/977 (32%), Positives = 494/977 (50%), Gaps = 122/977 (12%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLIK------AGLE 304
            + + +    +  PP   R PS +  +   + ++ L   L++++ TS LI+      + L+
Sbjct: 340  KADMFFMEVVVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 396

Query: 305  KG--------ISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLK 356
            K         +  N +M  +  +Q  V  +I+          G TGGKV PI G  Q L+
Sbjct: 397  KDKVSVDDRKVIFNRLMNAFVTIQNDVNAFIDVTKAQ-----GNTGGKV-PIPGVKQALE 450

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 451  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAELRQ 510

Query: 417  LVVNGPNEYPGANYLLKKDED--ARRNLRFGDRVKLAKNLR----------IGDLVERHL 464
             V+NGP+++PGA  +  +D    +   +    R  LA  L           +   V RH+
Sbjct: 511  AVINGPDKWPGATQIQNEDGSLVSLIGMTLEQRKALANQLMTPSTHNSTHILNKKVYRHI 570

Query: 465  EDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQSE 523
            ++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E
Sbjct: 571  KNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 630

Query: 524  EARAEAINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMM-- 581
             ARAEA NL    S  LTP SG P+    QD I+    ++ KDSFF +    Q +     
Sbjct: 631  NARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIR 690

Query: 582  -SDGAL---QFDIPPPTIWKPCYLWTGKQIFSLLIRPNKKSPVV--LNLDAKNKVYIPPK 635
              DG     +    PP + KP  LWTGKQI + ++  N   P +  +NL +KNK+     
Sbjct: 691  PEDGHATRNKIVTVPPAVVKPVPLWTGKQIITTVLL-NSTPPEMPGINLISKNKI----- 744

Query: 636  SKSLPNEM---SQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAM 692
                 NE      N+  V+ +  ++L G++DKS  G   K  + +++   YG   A + +
Sbjct: 745  ----KNEYWGEGSNESEVIFKNGELLCGILDKSQYG-ASKFGIVHSLHEVYGPDIAGKVL 799

Query: 693  NRMAKLCARYVGNRGFSIGISDVTPAXXXXXXXXXMVESAY----AKCDELIDLFSKGKL 748
            + + +L   Y+    F+ G+ D+            +++++     A   E+ +L    K 
Sbjct: 800  SVLGRLFTNYITATAFTCGMDDLRLTEEGNKWRTEILKTSVDIGRAAAAEVTNLEGDVKA 859

Query: 749  ----------ETQPGCNEEQTLEAKIGGLLSKVREEVGEVCINELDNMNAPL----IMAT 794
                      E     N+   L+A     ++ +  +V   C+ +      P      MA 
Sbjct: 860  DDPELLKRLEEILRDDNKLGILDAVTSSKVNVITSQVVSKCVPDGTMKKFPYNSMQAMAL 919

Query: 795  CGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGL 854
             G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+
Sbjct: 920  SGAKGSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDARAGGYIKGRFYSGI 979

Query: 855  TPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTY 914
             P E+ +H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     ++QF Y
Sbjct: 980  RPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNTVRDGDGTLIQFLY 1039

Query: 915  GGDGLDPLEMEGNAQPVNFNRTWDHATNVTF--NNMDRGLLPYQIMQVTEEILQPLENRL 972
            GGD +D  +               H T   F  +N D  L  Y    + E +   +E+ L
Sbjct: 1040 GGDAVDVTK-------------ESHMTEFKFCVDNYDALLKKYNPSALIEHL--DVESAL 1084

Query: 973  VRYDNLGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELMDE 1032
             +Y    ++   +NR + E I        + H+++        +L+K+  SK +  + + 
Sbjct: 1085 -KY----SKKAMKNRKKNEKIPH------YAHNIK-----YDPVLSKYNPSKYLGSVSEN 1128

Query: 1033 PALELQSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGA 1092
               +L+   +D N    +  S D V    +K  R  ++   LKY R+ + PG AVG I +
Sbjct: 1129 FQDKLEKF-IDSN--SKLLKSKDNV---NEKKFRALMQ---LKYMRSLINPGEAVGIIAS 1179

Query: 1093 QSIGEPGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIIN-AVLVNESDER 1150
            QS+GEP TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   +L + +D++
Sbjct: 1180 QSVGEPSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVTDDQ 1239

Query: 1151 AARVVKGRIEKTLLSDV 1167
            A    K  I K +LS+V
Sbjct: 1240 ADTFCKS-ITKVMLSEV 1255

 Score = 84.7 bits (208), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVT-NHILEVYSVLGIE 1327
            V+  + +I R V    ++GKR L+ EG   + +   +  +    +T N +  V    G+E
Sbjct: 1483 VITEVPNIDRCVHPEPENGKRVLVTEGVNFQSMWDQEAFIDVNGITSNDVASVLKTYGVE 1542

Query: 1328 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1543 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1601

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            E T   L  A    +++ ++  S  I++G+   +GTG+F ++
Sbjct: 1602 ETTCQFLTKAVLDNEREELKSPSAKIVMGKLNGVGTGSFDIL 1643

 Score = 51.2 bits (121), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 3/124 (2%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +I  ++FS L+A +I   S  +I+   + D  N   P +GG  D  +G    +
Sbjct: 3   ISKPIGSEIISVDFSVLTAQEIRKLSAKQITNPTVLD--NLGHPISGGLYDLSLGAFLRN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           + C TC  +   C GH GHI+L +P ++  +F      L+  C  C    L+ ++   + 
Sbjct: 61  L-CATCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLYCHHFRLKTSEVHRYA 119

Query: 125 SELR 128
            +L+
Sbjct: 120 CKLK 123

>ADR374C Chr4 complement(1372609..1377531) [4923 bp, 1640 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YOR341W
            (RPA190)
          Length = 1640

 Score =  411 bits (1057), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 302/971 (31%), Positives = 484/971 (49%), Gaps = 110/971 (11%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLI----------- 299
            + + +    +  PP   R PS +  +   + ++ L   L++++ TS LI           
Sbjct: 331  KADMFFMEVIVVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNEEMSKLQ 387

Query: 300  --KAGLE-KGISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLK 356
              K  LE + I  N +M  +  +Q  V  +I+S         G TGGKV PI G  Q L+
Sbjct: 388  KDKVSLEDRKIIFNRLMNAFVTIQNDVNAFIDSTKAQ-----GSTGGKV-PIPGVKQALE 441

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +++Q
Sbjct: 442  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTAYNIAEMRQ 501

Query: 417  LVVNGPNEYPGANYLLKKDED--ARRNLRFGDRVKLAKNL----------RIGDLVERHL 464
             V+NGP+++PGA  +  +D    +   +    R  LA  L           +   V RH+
Sbjct: 502  AVINGPDKWPGATQIQNEDGSLVSLVGMTSDQRKALANQLMTPSTHGSTHTLNKKVYRHI 561

Query: 465  EDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQSE 523
            ++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E
Sbjct: 562  KNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 621

Query: 524  EARAEAINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMM-- 581
             AR+EA  L    S  LTP SG P+    QD I+    +++KDSFF +    Q +     
Sbjct: 622  NARSEAFTLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTNKDSFFTREQYQQYIYGCIR 681

Query: 582  -SDGAL---QFDIPPPTIWKPCYLWTGKQIF-SLLIRPNKKSPVVLNLDAKNKVYIPPKS 636
              DG     +    PP + KP  LWTGKQI  ++L+         +NL +KNK+    K+
Sbjct: 682  PEDGHASRSKIITVPPAVVKPVPLWTGKQIITTVLLNATPADIPGINLVSKNKI----KN 737

Query: 637  KSLPNEMSQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAMNRMA 696
            +       +N+  V+ +   +L G++DKS  G   K+ + +++   YG   +++ ++ + 
Sbjct: 738  EYWGKSSYENE--VIFKNGALLCGILDKSQYG-ASKYGIVHSLHELYGPDVSSKVLSILG 794

Query: 697  KLCARYVGNRGFSIGISDVTPAXXXXXXXXXMVESAY----AKCDELIDL---------- 742
            +L   Y+ +  F+ G+ D+            +++ +     A   E+ +L          
Sbjct: 795  RLFTNYITSTAFTCGMDDLRLTDEGNKWRIDILKKSTDIGRAAAAEVTNLGGDVRPDDAE 854

Query: 743  FSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCINELDNMNAPL----IMATCGSK 798
              K   E     N+   L+A     ++ +  EV   C+ +      P      MA  G+K
Sbjct: 855  LLKRLEEILRDDNKLGILDAVTSSKVNTITSEVVSKCVPDGTMKKFPYNSMQAMALSGAK 914

Query: 799  GSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSGLTPPE 858
            GS +NVSQ++ ++GQQ + G RVP     ++LP F       ++ G+++  F+SG+ P E
Sbjct: 915  GSNVNVSQIMCLLGQQALEGRRVPVMVSGKTLPSFKPFETDAKAGGYIKGRFYSGIKPQE 974

Query: 859  FLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTYGGDG 918
            + +H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDNTVR     +VQF YGGD 
Sbjct: 975  YYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNTVRDGDGTLVQFLYGGDA 1034

Query: 919  LDPLEMEGNAQPVNFNRTWDHATNVTFNNMDRGLLPYQIMQVTEEILQPLE-NRLVRYDN 977
            +D +  E +     F            +N D  L  Y        ++Q L+    ++Y  
Sbjct: 1035 ID-VTKESHMSEFKF----------CVDNYDALLKRYN----PSALIQHLDVESALKYSK 1079

Query: 978  LGNEITKENRDRIEYIDQNDAERGFYHSLRDFIWAKAQLLAKFRGSKDMKELMDEPALEL 1037
               +  K+N +   Y   +  +                +L+K+  SK +  + +    +L
Sbjct: 1080 KAMKNRKKNLNLPHYARHDKYD---------------PVLSKYNPSKFLGSVSENFQDKL 1124

Query: 1038 QSVDLDENVPEDIRHSVDQVYRITDKMVREFLRVAILKYRRAKVEPGTAVGAIGAQSIGE 1097
            +S  +D N       +      + +K  R  ++   LKY R+ + PG AVG I +QS+GE
Sbjct: 1125 ESF-IDSNASLFKGQAT-----VNEKKFRALMQ---LKYMRSLINPGEAVGIIASQSVGE 1175

Query: 1098 PGTQMTLKTFHFAGVASMNVTLGVPRIKEII-NASKVISTPIINAVLVNESDERAARVVK 1156
            P TQMTL TFHFAG  + NVTLG+PR++EII  AS  I TP +   ++ +  +  A +  
Sbjct: 1176 PSTQMTLNTFHFAGHGAANVTLGIPRMREIIMTASAAIKTPQMTLPILPDVTDETADIFC 1235

Query: 1157 GRIEKTLLSDV 1167
                K +LS+V
Sbjct: 1236 KNTTKVILSEV 1246

 Score = 86.7 bits (213), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 50/162 (30%), Positives = 89/162 (54%), Gaps = 2/162 (1%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVT-NHILEVYSVLGIE 1327
            V+K + +I R V    ++GKR L+ EG   + +   +  +    +T N +  V    G+E
Sbjct: 1473 VIKEVPNIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIDVNGITSNDVSAVLKTYGVE 1532

Query: 1328 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1533 AARNTIVNEINNVFSRYAISVSYRHLDLIADMMTRQGTYLAFNRQGMESSTSSLMKM-SY 1591

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            E T   L  A    +++ ++  S  ++LG+  ++GTGAF ++
Sbjct: 1592 ETTCQFLTKAVLDNEREELKSPSAKLVLGKLNSVGTGAFDIL 1633

 Score = 53.5 bits (127), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 59/124 (47%), Gaps = 3/124 (2%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +IS ++FS +SAA+I A S  +I+   + D  +   P  GG  D  +G    +
Sbjct: 3   ISKPVGAEISSVDFSVMSAAEIRALSVKQITNPTVLD--HLGHPIRGGLYDLSLGAFLRN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           + C TC  +   C GH GHI+L +P +   +F      L+  C  C    L+  +   + 
Sbjct: 61  L-CATCGLDEKFCSGHQGHIELPVPCYSPLFFNQLYIYLRSSCLYCHHFRLKAVEVHRYA 119

Query: 125 SELR 128
            +L+
Sbjct: 120 CKLK 123

>Kpol_1040.3 s1040 complement(6642..11612) [4971 bp, 1656 aa] {ON}
            complement(6642..11612) [4971 nt, 1657 aa]
          Length = 1656

 Score =  368 bits (944), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 235/727 (32%), Positives = 381/727 (52%), Gaps = 79/727 (10%)

Query: 252  RPETYIWRYLPAPPVCIR-PSVMMQDSPASNEDDLTVKLTEVVWTSSLIK------AGLE 304
            + +T+    +  PP   R PS +  +   + ++ L   L++++ TS LI+      + L+
Sbjct: 346  KADTFFMEVVLVPPTRFRLPSKLGDEVHENTQNQL---LSKILTTSLLIRDLNDEMSKLQ 402

Query: 305  KG--------ISINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTGGKVKPIRGFCQRLK 356
            K         +  + +M  +  +Q  V  +I+S         G TGGKV PI G  Q L+
Sbjct: 403  KDKVSLQDRRVIFSRLMNAFVTIQNDVNAFIDSTKA-----QGNTGGKV-PIPGVKQALE 456

Query: 357  GKQGRFRGNLSGKRVDFSGRTVISPDPNLSVDEVAVPDRVAKVLTYPERVTRYNKGKLQQ 416
             K+G FR ++ GKRV+++ R+VISPDPN+  +E+ VP   A  LTYPE VT YN  +L+Q
Sbjct: 457  KKEGLFRKHMMGKRVNYAARSVISPDPNIETNEIGVPPVFATKLTYPEPVTSYNIAELRQ 516

Query: 417  LVVNGPNEYPGANYLLKKDED--ARRNLRFGDRVKLAKNL----------RIGDLVERHL 464
             V+NGP+++PGA+ +  +D    +   +    R  LA  L           +   V RH+
Sbjct: 517  AVINGPDKWPGASQIQNEDGSLVSLIGMTLEQRKALANQLMTPSSNIATHTLNKKVYRHI 576

Query: 465  EDGDVVLFNRQPSLHRLSILSHYAKIRPW-RTFRLNECVCTPYNADFDGDEMNLHVPQSE 523
            ++ D+V+ NRQP+LH+ S++ H  ++ P  +T RL+      YNADFDGDEMN+H PQ+E
Sbjct: 577  KNRDIVIMNRQPTLHKASMMGHKVRVLPGEKTLRLHYANTGAYNADFDGDEMNMHFPQNE 636

Query: 524  EARAEAINLMGVKSNLLTPKSGEPIIAATQDFITGSYLISHKDSFFDKYDMTQLLSMMSD 583
             ARAEA NL    S  LTP SG P+    QD I+    ++ KDSFF +    Q +     
Sbjct: 637  NARAEAFNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIY---- 692

Query: 584  GALQFD----------IPPPTIWKPCYLWTGKQIF-SLLIRPNKKSPVVLNLDAKNKVYI 632
            G ++ +            PP ++KP  LWTGKQI  ++L+         +NL++ NK+  
Sbjct: 693  GCIRPEHGHTTRSKIVTVPPAVFKPVPLWTGKQIITTVLLNVTPSDMPGINLNSSNKI-- 750

Query: 633  PPKSKSLPNEMSQNDGFVLIRGSQILSGVMDKSVLGDGKKHSVFYTILRDYGSQEAAEAM 692
              K++   N  ++ND  V+ +  ++L G++DKS  G   K+ + +++   YG   AA+ +
Sbjct: 751  --KNEYWGNGSTEND--VIFKNGELLCGILDKSQYG-ASKYGIVHSLHEVYGPDVAAKVL 805

Query: 693  NRMAKLCARYVGNRGFSIGISDVTPAXXXXXXXXXMVESAY-----AKCDELIDL----- 742
            + + +L   Y+    F+ G+ D+            +++++      A C E+ +L     
Sbjct: 806  SVLGRLFTNYITATAFTCGMDDLRLTDEGNKWRKDILKTSVDTGRQAAC-EVTNLEKETA 864

Query: 743  -----FSKGKLETQPGCNEEQTLEAKIGGLLSKVREEVGEVCINELDNMNAPL----IMA 793
                   K   E     N+   L+A     ++ +  +V   C+ +      P      MA
Sbjct: 865  SDDSELLKRLEEILRDDNKSGILDAVTSSKVNSITSKVVSKCVPDGTMKKFPYNSMQAMA 924

Query: 794  TCGSKGSTLNVSQMVAVVGQQIISGSRVPDGFQDRSLPHFPKNSKTPQSKGFVRNSFFSG 853
              G+KGS +NVSQ++ ++GQQ + G RVP     ++LP F        + G+++  F+SG
Sbjct: 925  LSGAKGSNVNVSQIMCLLGQQALEGRRVPTMVSGKTLPSFKPFETDAMAGGYIKGRFYSG 984

Query: 854  LTPPEFLYHAISGREGLVDTAVKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFT 913
            + P E+ +H ++GREGL+DTAVKT+ +GY+ R L K LE +   YDN+VR     ++QF 
Sbjct: 985  IKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHISYDNSVRDGDGTLIQFL 1044

Query: 914  YGGDGLD 920
            YGGD +D
Sbjct: 1045 YGGDSVD 1051

 Score = 86.3 bits (212), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/162 (32%), Positives = 87/162 (53%), Gaps = 2/162 (1%)

Query: 1269 VVKGLSDISRAVINIRDDGKRELLVEGYGLRDVMSTDGVVGHKTVT-NHILEVYSVLGIE 1327
            V++ +  I R V    ++GKR L+ EG   + +   +  +G   +T N +  V    G+E
Sbjct: 1489 VIRQVPFIDRCVHPEPENGKRVLVTEGVNFQAMWDQEAFIGVDGITSNDVSAVLKTYGVE 1548

Query: 1328 AARASIVGEIDYTMSNHGMSVDPRHIQLLGDVMTYKGEILGITRFGLSKMRDSVLQLASF 1387
            AAR +IV EI+   S + +SV  RH+ L+ D+MT +G  L   R G+     S++++ S+
Sbjct: 1549 AARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNRQGMETSTSSLMKM-SY 1607

Query: 1388 EKTTDHLFDAAFYMKKDAVEGVSECIILGQTMAIGTGAFKVV 1429
            E T   L  A    + + ++  S  I+LG+   +GTGAF V+
Sbjct: 1608 ETTCQFLTKAVLDNENEELKSPSARIVLGKLNNVGTGAFDVL 1649

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 58/124 (46%), Gaps = 3/124 (2%)

Query: 5   VSSEAPKKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSS 64
           +S     +I+ ++FS L+A +I   S  +I+   + D  N   P +GG  D  +G    +
Sbjct: 3   ISKPVGSEITSIDFSILTAQEIRNLSAKQITNPTVLD--NLGHPISGGLYDLALGAFLRN 60

Query: 65  MECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKKHFL 124
           + C TC  +   C GH GHI+L +P ++  +F      L+  C  C    L   +   + 
Sbjct: 61  L-CSTCGLDEKFCPGHQGHIELPVPCYNPLFFNQLYIYLRSSCLFCHHFRLRSIEVHRYT 119

Query: 125 SELR 128
            +L+
Sbjct: 120 CKLK 123

>Kpol_1019.27 s1019 complement(51067..52161) [1095 bp, 364 aa] {ON}
           complement(51067..52161) [1095 nt, 365 aa]
          Length = 364

 Score = 82.4 bits (202), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 65/116 (56%), Gaps = 2/116 (1%)

Query: 7   SEAP-KKISGLEFSALSAADIVAQSEVEISTRDLFDLENGRAPKTGGALDPKMGVSSSSM 65
           S AP + I  ++F   S  ++ A S  +I   +  D    RA K GG  DP++G    ++
Sbjct: 7   SSAPVRTIKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRA-KIGGLNDPRLGSIDRNV 65

Query: 66  ECQTCHGNLASCHGHFGHIKLALPVFHIGYFKATIQILQGICKECSSILLEDTDKK 121
           +CQTC   +  C GHFGHI LA PVFHIG+     ++ + +C  C  +LL++ +++
Sbjct: 66  KCQTCQEGMNECPGHFGHIDLAKPVFHIGFISKIKKVCECVCMHCGKLLLDEHNEQ 121

>TPHA0N01160 Chr14 complement(245187..246524) [1338 bp, 445 aa] {ON}
           Anc_6.144 YGL111W
          Length = 445

 Score = 36.2 bits (82), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 55/192 (28%), Positives = 83/192 (43%), Gaps = 32/192 (16%)

Query: 823 DGFQDRS-LPHFPKNSK--TPQSKGFVRNSFFSGLTP-----PEFLYHAISGREGLVDTA 874
           DGF D S + H  KNSK  T  + GFV       L+P       F     SG   ++   
Sbjct: 105 DGFTDNSRIEHLFKNSKKRTRVNDGFV------TLSPMPHSVDTFFVATKSGLIHVIKVD 158

Query: 875 VKTAETGYMSRRLMKSLEDLSCLYDNTVRTSSNGIVQFTYGGDG--LDPLEMEGNAQPVN 932
            KT +   +S   +K+  + + LYD  +  +S+ IV F YGG+   +  +E+E +    +
Sbjct: 159 EKTNKLSKVSSLEVKAPLEFAQLYD--LDINSDRIV-FGYGGEENIVKLVELEKDFS--S 213

Query: 933 FNRTWDHATNVTFNNMD----------RGLLPYQIMQVTEEILQPLENRLVRYDNLGNEI 982
               W+ A NV  + +D          + LLPY         L      + RY +LG   
Sbjct: 214 LKEIWE-AKNVKNDRLDMRVPVWPVGLKFLLPYNGKDKDSTKLNYQFIIITRYSHLGKYR 272

Query: 983 TKENRDRIEYID 994
           T+  R  +EYID
Sbjct: 273 TQHGRKPMEYID 284

>TPHA0H01440 Chr8 complement(322547..325174) [2628 bp, 875 aa] {ON}
           Anc_5.359
          Length = 875

 Score = 36.6 bits (83), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 56/128 (43%), Gaps = 8/128 (6%)

Query: 267 CIRPSVMMQDSPASNEDDLTVKLTEVVWTSSLIKAGLEKGISINNMMEHWDYLQLAV--A 324
           C +   ++ + P  + + +    T   +TS L+   L     +   + H+DY++ +    
Sbjct: 160 CDKSLTVLSNMPEESVETIKNLSTTTFYTSPLMSTYL-----VAWAIGHYDYIEDSTEKK 214

Query: 325 MYINSDSVNPAILSGGTGGKVKPIRGFCQRLKGKQGRFRGNLSGKRVDFSGRTVISPDPN 384
           +Y   D  +    S GT G + PIR F  + K  QGRF  N++ + VD        P P 
Sbjct: 215 IYPTLDGYDIRDGSSGTKGSL-PIRLFTAKGKSHQGRFAMNVTRRVVDLFSELFEIPYPL 273

Query: 385 LSVDEVAV 392
             +D V V
Sbjct: 274 PKLDIVCV 281

>KLLA0E14477g Chr5 complement(1281791..1283941) [2151 bp, 716 aa]
           {ON} weakly similar to uniprot|Q08905 Saccharomyces
           cerevisiae YOR381w FRE3 protein Ferric reductase,
           reduces siderophore-bound iron prior to uptake by
           transporters
          Length = 716

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 45/167 (26%), Positives = 64/167 (38%), Gaps = 31/167 (18%)

Query: 199 GDWDSVLAHSPELERYVK-----RCMDDLNPLKTLNLFKQVKPEDCELLGIDSTIKSGRP 253
           G W  +   S +   YV       C D    +  L  F      DCEL   D+TIK   P
Sbjct: 396 GLWYHLRIFSGQWMEYVYASIAVWCADHFFRVCRLLWFGVFSKADCELFEEDNTIKIKVP 455

Query: 254 ETYIWRYLPAPPVCI---RPSVMMQDSPAS---NEDDLTVKLTEVVWTSSLIKAGLEKGI 307
               W+  P   V I   RP    Q  P +   ++DD   K    ++  + +K GL K +
Sbjct: 456 RPKTWKPFPGAFVYIYFMRPYGFWQSHPFTILAHDDDSDGKH---IYIYAKVKEGLTKSL 512

Query: 308 ------------SINNMMEHWDYLQLAVAMYINSDSVNPAILSGGTG 342
                       SIN ++E    L+  +  Y NS      I++GG G
Sbjct: 513 AKSLANTSNKSQSINVLVEGPYGLEAPLKNYSNS-----IIITGGNG 554

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 148,377,528
Number of extensions: 6459201
Number of successful extensions: 17409
Number of sequences better than 10.0: 67
Number of HSP's gapped: 17435
Number of HSP's successfully gapped: 184
Length of query: 1458
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1336
Effective length of database: 39,492,147
Effective search space: 52761508392
Effective search space used: 52761508392
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 72 (32.3 bits)