Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F09812g5.425ON41641618160.0
Suva_2.5345.425ON4522887472e-94
Smik_4.6285.425ON4582877463e-94
Skud_4.6315.425ON4582887378e-93
YDR363W (ESC2)5.425ON4562877334e-92
NCAS0F033105.425ON4422987021e-87
KAFR0E038705.425ON3962726892e-86
NDAI0B056005.425ON4572826872e-85
TBLA0A037105.425ON4612776072e-73
SAKL0G02266g5.425ON4842765701e-67
TDEL0E020005.425ON4362535373e-63
Kpol_1027.265.425ON4432975271e-61
TPHA0E018105.425ON4533005122e-59
KLTH0F16280g5.425ON4732755081e-58
Kwal_55.214685.425ON4652724843e-55
CAGL0A02706g5.425ON3692654451e-50
Ecym_55245.425ON4152444062e-44
AER251W5.425ON4072843913e-42
KNAG0C049805.425ON3452693621e-38
KLLA0E21275g5.425ON3922453123e-31
Kpol_2002.451.51ON10466810.034
TBLA0A071401.51ON9666760.15
CAGL0K05731g1.51ON10883760.15
NDAI0A006501.51ON10666760.19
TPHA0E036501.51ON10565740.27
Ecym_10571.51ON9865740.30
ZYRO0F17424g1.51ON9965730.36
KLTH0F01650g1.51ON9465720.42
SAKL0C01694g1.51ON9765720.48
KAFR0D041101.51ON10265710.76
AFR697C1.51ON9265700.78
NCAS0B085901.51ON10265710.78
Skud_4.7851.51ON10165700.86
YDR510W (SMT3)1.51ON10165700.87
Suva_2.6891.51ON10165700.90
AER359W3.515ON1651115761.0
Smik_4.7911.51ON10165691.2
TDEL0C065001.51ON9765691.3
KLLA0F17974g8.311ON7771652.8
KLLA0C01628g1.51ON9366663.0
Kpol_1011.88.63ON37687713.1
Kpol_2002.301.31ON55090686.8
KLTH0F11968g3.432ON879108688.8
SAKL0H02332g5.76ON81760679.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F09812g
         (416 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly...   704   0.0  
Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W ...   292   2e-94
Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363...   291   3e-94
Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363...   288   8e-93
YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}  ESC2Sumo...   286   4e-92
NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.4...   275   1e-87
KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.4...   270   2e-86
NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON} Anc_5...   269   2e-85
TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.4...   238   2e-73
SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some s...   224   1e-67
TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {O...   211   3e-63
Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {O...   207   1e-61
TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {O...   201   2e-59
KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]...   200   1e-58
Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {...   191   3e-55
CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} simila...   176   1e-50
Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar...   160   2e-44
AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic ...   155   3e-42
KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {O...   144   1e-38
KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]...   124   3e-31
Kpol_2002.45 s2002 (93655..93969) [315 bp, 104 aa] {ON} (93655.....    36   0.034
TBLA0A07140 Chr1 (1774301..1774591) [291 bp, 96 aa] {ON} Anc_1.5...    34   0.15 
CAGL0K05731g Chr11 complement(561289..561615) [327 bp, 108 aa] {...    34   0.15 
NDAI0A00650 Chr1 (120882..121202) [321 bp, 106 aa] {ON} Anc_1.51...    34   0.19 
TPHA0E03650 Chr5 complement(773947..774264) [318 bp, 105 aa] {ON...    33   0.27 
Ecym_1057 Chr1 (104604..104900) [297 bp, 98 aa] {ON} similar to ...    33   0.30 
ZYRO0F17424g Chr6 complement(1449658..1449957) [300 bp, 99 aa] {...    33   0.36 
KLTH0F01650g Chr6 (126388..126672) [285 bp, 94 aa] {ON} highly s...    32   0.42 
SAKL0C01694g Chr3 (142861..143154) [294 bp, 97 aa] {ON} highly s...    32   0.48 
KAFR0D04110 Chr4 complement(813551..813859) [309 bp, 102 aa] {ON...    32   0.76 
AFR697C Chr6 complement(1725916..1726194) [279 bp, 92 aa] {ON} S...    32   0.78 
NCAS0B08590 Chr2 (1648641..1648949) [309 bp, 102 aa] {ON} Anc_1....    32   0.78 
Skud_4.785 Chr4 (1389558..1389863) [306 bp, 101 aa] {ON} YDR510W...    32   0.86 
YDR510W Chr4 (1469400..1469705) [306 bp, 101 aa] {ON}  SMT3Ubiqu...    32   0.87 
Suva_2.689 Chr2 (1222165..1222470) [306 bp, 101 aa] {ON} YDR510W...    32   0.90 
AER359W Chr5 (1298989..1303944) [4956 bp, 1651 aa] {ON} Syntenic...    34   1.0  
Smik_4.791 Chr4 (1392239..1392544) [306 bp, 101 aa] {ON} YDR510W...    31   1.2  
TDEL0C06500 Chr3 complement(1195140..1195433) [294 bp, 97 aa] {O...    31   1.3  
KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 7...    30   2.8  
KLLA0C01628g Chr3 (126942..127223) [282 bp, 93 aa] {ON} highly s...    30   3.0  
Kpol_1011.8 s1011 complement(21657..22787) [1131 bp, 376 aa] {ON...    32   3.1  
Kpol_2002.30 s2002 complement(61251..62903) [1653 bp, 550 aa] {O...    31   6.8  
KLTH0F11968g Chr6 (1008620..1011259) [2640 bp, 879 aa] {ON} simi...    31   8.8  
SAKL0H02332g Chr8 (233859..236312) [2454 bp, 817 aa] {ON} some s...    30   9.7  

>ZYRO0F09812g Chr6 (797169..798419) [1251 bp, 416 aa] {ON} weakly
           similar to uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 416

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/416 (86%), Positives = 359/416 (86%)

Query: 1   MVDSTYRSNXXXXXXXXXXXMGNIGDANDESPPIENVYVDAEPSNKDQQKLDKTXXXXXX 60
           MVDSTYRSN           MGNIGDANDESPPIENVYVDAEPSNKDQQKLDKT      
Sbjct: 1   MVDSTYRSNSFSDDDDDDFFMGNIGDANDESPPIENVYVDAEPSNKDQQKLDKTSDNEEE 60

Query: 61  XXXXXXXPIQNKRKSEAVSDAESDDNVIVLDSSESDEDNAKPSPXXXXXXXXXXXXXXXG 120
                  PIQNKRKSEAVSDAESDDNVIVLDSSESDEDNAKPSP               G
Sbjct: 61  DSDSSDEPIQNKRKSEAVSDAESDDNVIVLDSSESDEDNAKPSPRNRRTRITRNSSKTTG 120

Query: 121 VVXXXXXXXXXXXXXXXXXXNIANNFLEPDENDEFFKQIAKDFNHTPLGTRETTPEQPRR 180
           VV                  NIANNFLEPDENDEFFKQIAKDFNHTPLGTRETTPEQPRR
Sbjct: 121 VVPSRSPTPPRRTKRSRTTPNIANNFLEPDENDEFFKQIAKDFNHTPLGTRETTPEQPRR 180

Query: 181 IYNVRFLSKLDGSIDKAVQIKVLGKYDFASMLPSVLNGFIREYKIPNVMKKIYSQENVTL 240
           IYNVRFLSKLDGSIDKAVQIKVLGKYDFASMLPSVLNGFIREYKIPNVMKKIYSQENVTL
Sbjct: 181 IYNVRFLSKLDGSIDKAVQIKVLGKYDFASMLPSVLNGFIREYKIPNVMKKIYSQENVTL 240

Query: 241 YWKTAKLLNFMTCNSLKIPQAFENEISDIDITVIPKEKENEFEQMINSRLLEDEQNPPDT 300
           YWKTAKLLNFMTCNSLKIPQAFENEISDIDITVIPKEKENEFEQMINSRLLEDEQNPPDT
Sbjct: 241 YWKTAKLLNFMTCNSLKIPQAFENEISDIDITVIPKEKENEFEQMINSRLLEDEQNPPDT 300

Query: 301 AETGNLDARVEEFEKELKNVDNSTTNHETTELIDLEDEGDTDLMKIALVGEDNKKIFVNV 360
           AETGNLDARVEEFEKELKNVDNSTTNHETTELIDLEDEGDTDLMKIALVGEDNKKIFVNV
Sbjct: 301 AETGNLDARVEEFEKELKNVDNSTTNHETTELIDLEDEGDTDLMKIALVGEDNKKIFVNV 360

Query: 361 RNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDEDMIEVLTK 416
           RNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDEDMIEVLTK
Sbjct: 361 RNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDEDMIEVLTK 416

>Suva_2.534 Chr2 (956062..957420) [1359 bp, 452 aa] {ON} YDR363W
           (REAL)
          Length = 452

 Score =  292 bits (747), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 149/288 (51%), Positives = 201/288 (69%), Gaps = 24/288 (8%)

Query: 150 DENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGKYDFA 209
           DEND+FFK++AK+   T   ++E+TP+QP+R+YN++F SKL+G+I+KAVQ+KVLGKY+F+
Sbjct: 164 DENDDFFKELAKEAKKTTSISKESTPDQPKRVYNIKFFSKLEGTINKAVQVKVLGKYEFS 223

Query: 210 SMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEISDI 269
            +LP+ L+G ++ YKIP VMK IY +ENVTLYW  AKLL FMTCNSL IPQ FENEISDI
Sbjct: 224 RILPAALDGLMKSYKIPKVMKDIYKEENVTLYWNNAKLLKFMTCNSLHIPQDFENEISDI 283

Query: 270 DITVIPKEKENEFEQMINSRLLEDEQNPPDTAETGNLDARVE------------------ 311
           DIT++ KE E  FE  + S+L E E+      E   ++ ++E                  
Sbjct: 284 DITIVSKEYEKNFEATLESKLKE-EETALFAKERQEMEMKLEKKRNEREESEFREFEFEL 342

Query: 312 ---EFEKELKNVDNSTTNHETTELIDLEDE--GDTDLMKIALVGEDNKKIFVNVRNTTIL 366
              E  +ELK  +     H   E   +++   G+  +MKIAL+G+DNKKI+VNVRN+T  
Sbjct: 343 RNVEETEELKANETFMNEHSLREGNSVKENNGGNEKVMKIALMGQDNKKIYVNVRNSTPF 402

Query: 367 TKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDEDMIEVL 414
            KVAEYYRI+K+LP+   IKL+FDH+ELNLNE I DQDMEDEDM++V+
Sbjct: 403 FKVAEYYRIQKQLPQKARIKLLFDHDELNLNECIADQDMEDEDMVDVI 450

>Smik_4.628 Chr4 (1125627..1127003) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  291 bits (746), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 147/287 (51%), Positives = 203/287 (70%), Gaps = 22/287 (7%)

Query: 150 DENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGKYDFA 209
           DEND+FFK++AK+   T   ++E+TP+Q +R+YN++FLSKL+G+I+KAVQ+KVLGKY+F+
Sbjct: 170 DENDDFFKELAKEAKKTTSVSKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 229

Query: 210 SMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEISDI 269
            +LP+ L+G  + YKIP VMK IY  ENVTLYWK AKLL+FMTCNSL IPQ FENE+SDI
Sbjct: 230 RILPAALDGLTKSYKIPKVMKDIYKVENVTLYWKNAKLLDFMTCNSLHIPQDFENEVSDI 289

Query: 270 DITVIPKEKENEFEQMINSRLLEDE-----------QNPPDTAETGNLDARVEEFEKELK 318
           D+T++ KE E  FE  + S+L E+E           +   +       ++   EFE EL+
Sbjct: 290 DVTIVSKEYEKNFEASLESKLKEEEAALLVKEHEEIERKLERKRNEQEESEYREFEFELR 349

Query: 319 NVDNSTTNHETTELID----------LEDEGDTD-LMKIALVGEDNKKIFVNVRNTTILT 367
           NV       E   +I+          LE+  D++ +MKIAL G+DNKKI+VNVR +T  +
Sbjct: 350 NVKEKQERTENETVINIKNLQEDDNLLENNSDSEKVMKIALRGQDNKKIYVNVRRSTPFS 409

Query: 368 KVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDEDMIEVL 414
           KVAEYYRI+K+LP+   IKL+FDH++L+++E I DQDMEDEDMI+V+
Sbjct: 410 KVAEYYRIQKQLPQKARIKLLFDHDKLDMHECIADQDMEDEDMIDVI 456

>Skud_4.631 Chr4 (1128086..1129462) [1377 bp, 458 aa] {ON} YDR363W
           (REAL)
          Length = 458

 Score =  288 bits (737), Expect = 8e-93,   Method: Compositional matrix adjust.
 Identities = 147/288 (51%), Positives = 201/288 (69%), Gaps = 22/288 (7%)

Query: 150 DENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGKYDFA 209
           DEND+FFK++AK+       ++E TPEQP+R+YN++FLSKL+G+I+KAVQ+KVLGKY+F+
Sbjct: 170 DENDDFFKELAKEAKKITTISKEPTPEQPKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 229

Query: 210 SMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEISDI 269
            +LP+ L+G ++ YKIP VM  IY   NVTLYW  AKLLNFMTCNSL I Q FENEISDI
Sbjct: 230 RILPAALDGLVKSYKIPKVMISIYKVGNVTLYWNNAKLLNFMTCNSLNISQDFENEISDI 289

Query: 270 DITVIPKEKENEFEQMINSRLLEDE-----------QNPPDTAETGNLDARVEEFEKELK 318
           D+T++ KE E  FE  + S+L EDE           +   +       ++   EFE EL+
Sbjct: 290 DVTIVSKEYEKNFEATLESKLKEDEAALLVKQRQEIERKLEKKRNEQEESEYREFEFELR 349

Query: 319 NVDNSTTNHETTELIDLE----------DEGDTD-LMKIALVGEDNKKIFVNVRNTTILT 367
           NV  +    E   +I+ +          + GDT+ ++K+AL+G+DNKKI VNVRN+T L 
Sbjct: 350 NVKETQELEENEIIINTKPLQGNNSLKGNNGDTEKVIKLALMGQDNKKIHVNVRNSTPLF 409

Query: 368 KVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDEDMIEVLT 415
           KVAEYYRI+K+LP+   I+L+FDH+ELN++E + DQDMEDEDMI+V+ 
Sbjct: 410 KVAEYYRIQKRLPQKARIRLLFDHDELNMSECVADQDMEDEDMIDVIV 457

>YDR363W Chr4 (1199183..1200553) [1371 bp, 456 aa] {ON}
           ESC2Sumo-like domain protein; prevents accumulation of
           toxic intermediates during replication-associated
           recombinational repair; roles in silencing, lifespan,
           chromatid cohesion and the intra-S-phase DNA damage
           checkpoint; RENi family member
          Length = 456

 Score =  286 bits (733), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 141/287 (49%), Positives = 204/287 (71%), Gaps = 22/287 (7%)

Query: 150 DENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGKYDFA 209
           DEND+FFK++AK+   +   ++E+TP+Q +R+YN++FLSKL+G+I+KAVQ+KVLGKY+F+
Sbjct: 168 DENDDFFKELAKEAKKSTTISKESTPDQRKRVYNIKFLSKLEGTINKAVQVKVLGKYEFS 227

Query: 210 SMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEISDI 269
            +LP+ L+G ++ YKIP VMK IY  ENVTLYW  AKLL FMTCNSL IPQ FENE+SDI
Sbjct: 228 KILPAALDGLMKSYKIPKVMKDIYKVENVTLYWNNAKLLTFMTCNSLHIPQDFENEVSDI 287

Query: 270 DITVIPKEKENEFEQMINSRLLEDE-----------QNPPDTAETGNLDARVEEFEKELK 318
           D+T++ KE E  FE  + S+L E+E           +   +       ++   EFE ELK
Sbjct: 288 DVTIVSKEYEKNFEATLESKLKEEEAALLIKERQEMERKLEKKRNEQEESEYREFESELK 347

Query: 319 NVDNSTTNHETTELID---LEDEGDT--------DLMKIALVGEDNKKIFVNVRNTTILT 367
           NV+ +    E   +++   L++ G          ++M+IAL+G+DNKKI+V+VR +T  +
Sbjct: 348 NVEETQEIKENDTVMNTKLLQEGGSLSGNSSSMEEVMRIALMGQDNKKIYVHVRRSTPFS 407

Query: 368 KVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDEDMIEVL 414
           K+AEYYRI+K+LP+   +KL+FDH+EL++NE I DQDMEDEDM++V+
Sbjct: 408 KIAEYYRIQKQLPQKTRVKLLFDHDELDMNECIADQDMEDEDMVDVI 454

>NCAS0F03310 Chr6 (670533..671861) [1329 bp, 442 aa] {ON} Anc_5.425
           YDR363W
          Length = 442

 Score =  275 bits (702), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 150/298 (50%), Positives = 199/298 (66%), Gaps = 28/298 (9%)

Query: 147 LEPDENDEFFKQIAKDFNHTPLGT---RETTPE-QPRRIYNVRFLSKLDGSIDKAVQIKV 202
           L PDENDEFFK+IAK+    P  T   +E TP+ QP+R+Y++RFLS+LDG+I+K VQ+KV
Sbjct: 145 LGPDENDEFFKEIAKEAKKLPSITDRSKEATPDKQPKRVYSIRFLSQLDGTINKTVQVKV 204

Query: 203 LGKYDFASMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAF 262
           LGK+ F  +LP  L G I+ Y IP V++K Y  +NVTLYW   KLLNFMTCNSL IPQAF
Sbjct: 205 LGKFQFVKILPPTLEGLIKSYSIPTVLQKFYKVDNVTLYWNNTKLLNFMTCNSLNIPQAF 264

Query: 263 ENEISDIDITVIPKEKENEFEQMINSRLLEDEQNP------------------PDTAETG 304
           ENE++++DI ++ KEKE E E  +  +LL +E+                    P  ++  
Sbjct: 265 ENEVTNVDIVIMSKEKEIENENELRKKLLLEEKAAQMKLDLEKEREKEGEKNKPKESKNT 324

Query: 305 NLDARVEEFEKELKNV----DNSTTNHET--TELIDLEDEGDTDLMKIALVGEDNKKIFV 358
                + EFEKELK+     D+     E      ID  D   + +MKIALVG DNKKI+V
Sbjct: 325 EYAKAIAEFEKELKDATELKDSQVHGGENDGNMNIDGSDNEKSSIMKIALVGHDNKKIYV 384

Query: 359 NVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDEDMIEVLTK 416
           NVRN+T  +K+AEYYR++K+LP+   I+L+FDH+ELNL E++GDQDMEDEDMIEV+ K
Sbjct: 385 NVRNSTPFSKLAEYYRLQKQLPQAAKIQLMFDHDELNLEETVGDQDMEDEDMIEVVIK 442

>KAFR0E03870 Chr5 (768042..769232) [1191 bp, 396 aa] {ON} Anc_5.425
           YDR363W
          Length = 396

 Score =  270 bits (689), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 132/272 (48%), Positives = 195/272 (71%), Gaps = 8/272 (2%)

Query: 148 EPDENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGKYD 207
           + DEND+FFK++A       +   E+  ++P+RIYN+RF+SKLDGSI+K+V++KVLGK+ 
Sbjct: 128 DSDENDDFFKELATVAQKKSVTGTESAAKRPKRIYNIRFISKLDGSINKSVKVKVLGKFP 187

Query: 208 FASMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEIS 267
           F+ +LP+ L G I  YKIP++M +IY  ENV LYW  AKLLNFMTC+SL IP AFENEIS
Sbjct: 188 FSKILPAALKGLIDAYKIPSIMSEIYDVENVGLYWNNAKLLNFMTCDSLSIPLAFENEIS 247

Query: 268 DIDITVIPKEKENEFEQMINSRLLEDEQNPPDTAETGNLDAR----VEEFEKELKNVDNS 323
           ++DI ++ KE   + E++   + L++E       E  ++D      ++EFE EL++V  S
Sbjct: 248 NVDILIVSKEFGEKLEKLDQMKTLQEEAKLERQEEIKDVDEGDDFVLKEFEAELRDVAPS 307

Query: 324 TTNHETTELIDLEDEGDTDLMKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDI 383
             N      +D + E    LMK+AL+G+DNKKI+VNVR++T ++K+ EYY+ +K L +++
Sbjct: 308 NANLS----LDTDGEDSEPLMKLALMGQDNKKIYVNVRSSTQISKLVEYYKKQKNLARNV 363

Query: 384 NIKLIFDHEELNLNESIGDQDMEDEDMIEVLT 415
            +KL+FDH+EL+LNE++GDQDMEDEDMI+V+ 
Sbjct: 364 KVKLLFDHDELDLNETVGDQDMEDEDMIDVVV 395

>NDAI0B05600 Chr2 (1369512..1370885) [1374 bp, 457 aa] {ON}
           Anc_5.425 YDR363W
          Length = 457

 Score =  269 bits (687), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 144/282 (51%), Positives = 193/282 (68%), Gaps = 32/282 (11%)

Query: 147 LEPDENDEFFKQIAKDFNHTPLGTRETTPEQ-PRRIYNVRFLSKLDGSIDKAVQIKVLGK 205
           +EPDENDEFFK+IAK+    P  T+E+TP++ P+RIYN+RF+SKLDG+++K VQ+KVLGK
Sbjct: 162 MEPDENDEFFKEIAKEAKKIPSLTKESTPDKLPKRIYNIRFISKLDGTMNKCVQVKVLGK 221

Query: 206 YDFASMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENE 265
           + F  +LP+ L G I+ Y IP+V++K YS +NV+LYW  AKLL+FMTCNSL IPQAFENE
Sbjct: 222 FQFQKILPAALTGLIKAYSIPSVLQKYYSVDNVSLYWNHAKLLDFMTCNSLNIPQAFENE 281

Query: 266 ISDIDITVIPKEKENEFEQMINSRLLEDEQNPPDTAETGNLDARVEE-FEKELK------ 318
           ++++DI +I K+ E E E+ I  +LL+DE+      E    +  ++E   KEL       
Sbjct: 282 VTNVDIELISKDDEIENEKAITEKLLKDEREVSLKLEAAKKEKEIQEKLAKELAKEEKEN 341

Query: 319 ---------------------NVDNSTTNHETTELIDLEDEGDTDLMKIALVGEDNKKIF 357
                                + D ST N E  EL  LE EG+ D+MKIALVG+DNKKI 
Sbjct: 342 EVFEEFEHELENVSELKTNGYDADASTVN-EANELA-LE-EGNADVMKIALVGQDNKKIH 398

Query: 358 VNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNES 399
           VNVR TT  +KVAEYYRI+K+LP++  IKL+FDHEEL+L E+
Sbjct: 399 VNVRGTTPFSKVAEYYRIQKQLPQNAKIKLVFDHEELSLYET 440

>TBLA0A03710 Chr1 (928023..929408) [1386 bp, 461 aa] {ON} Anc_5.425
           YDR363W
          Length = 461

 Score =  238 bits (607), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 134/277 (48%), Positives = 185/277 (66%), Gaps = 19/277 (6%)

Query: 155 FFKQIAKDFNHTPLGTRE----TTPEQ--PRRIYNVRFLSKLDGSIDKAVQIKVLGKYDF 208
           FFK +    +  P  T +    TT +Q  P+RIYNVRF+SK++G++DK VQ+KVLGK+ F
Sbjct: 185 FFKALKHSSSVPPSSTMKSDIKTTKDQGNPKRIYNVRFISKIEGTLDKKVQVKVLGKFPF 244

Query: 209 ASMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEISD 268
           + +LP  L  F  EYKIPNV+K+ Y   NVTLYW  +KLLNFMTCNSL IPQ +ENEISD
Sbjct: 245 SKILPPALKAFSEEYKIPNVLKQYYRVNNVTLYWNDSKLLNFMTCNSLNIPQIYENEISD 304

Query: 269 IDITVIPKEKENEFEQMINSRLLED-EQNPPDTA----ETGNLDAR------VEEFEKEL 317
           ++I VI K  E  +E  IN  L ++ EQN    +    E   L         ++EFEKEL
Sbjct: 305 VEIIVITKTNEKSYEDKINMSLKQNIEQNLAQKSNEIKELRKLKVESFEHNSIQEFEKEL 364

Query: 318 KNVDNSTTNHETTELIDLEDEGDTDLMKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKK 377
           K +  S    +T +  +++D  +   +KIAL+ +DNKK++V VRN+T  +++  Y+R +K
Sbjct: 365 KEL--SQDGVDTKQTANIDDIPNESHIKIALLTQDNKKLYVKVRNSTPFSELVNYFREQK 422

Query: 378 KLPKDINIKLIFDHEELNLNESIGDQDMEDEDMIEVL 414
           +L +   IKLIFD+EEL+LNE++GDQDMEDEDMIEV+
Sbjct: 423 QLGETQQIKLIFDNEELDLNETVGDQDMEDEDMIEVV 459

>SAKL0G02266g Chr7 (190967..192421) [1455 bp, 484 aa] {ON} some
           similarities with uniprot|Q06340 YDR363W Saccharomyces
           cerevisiae ESC2 Protein involved in mating- type locus
           silencing interacts with Sir2p
          Length = 484

 Score =  224 bits (570), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 115/276 (41%), Positives = 174/276 (63%), Gaps = 11/276 (3%)

Query: 142 IANNFLEPDENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIK 201
           I+   +E D+ D FF +I ++ N T    RE++PE  +R Y + F+SKL GSIDK +++K
Sbjct: 213 ISKPVVEEDDTDAFFTEITRNANRTSTVIRESSPELDKRTYKISFISKLKGSIDKKIEVK 272

Query: 202 VLGKYDFASMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQA 261
             GK  F  +LPS L+  ++ Y+IP  ++ +Y  +NVTLYW  AK+LNFMTCNSL+IPQ 
Sbjct: 273 AWGKSPFTKILPSTLDAIVKAYRIPKAIQNVYKMDNVTLYWNGAKILNFMTCNSLRIPQN 332

Query: 262 FENEISDIDITVIPKE----KENEFEQMINSRLLEDEQNPPDTAETGNLDARVEEFEKEL 317
           + +EI+D+DIT++ KE     E EF++M+ + L     +  D       D    E+E +L
Sbjct: 333 YGDEITDVDITLVSKEYEMKYEAEFKEMVENEL---SGSSVDVKNVKKDDFATNEYELQL 389

Query: 318 KNVDNSTTNHETTELIDLEDEGDTDLMKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKK 377
           +  +++    E + L   E+  D   +K+ALVG+DNKK+FV  R++T+  K+A+YY+  K
Sbjct: 390 EKSESA----EPSLLKSSENIRDGSFIKLALVGQDNKKMFVKARSSTLFKKIADYYKDVK 445

Query: 378 KLPKDINIKLIFDHEELNLNESIGDQDMEDEDMIEV 413
            LP    +KL FDH  L+L + + D +MEDEDMIEV
Sbjct: 446 NLPSFTKLKLTFDHVNLSLEDRVEDHEMEDEDMIEV 481

>TDEL0E02000 Chr5 complement(379082..380392) [1311 bp, 436 aa] {ON}
           Anc_5.425 YDR363W
          Length = 436

 Score =  211 bits (537), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 171/253 (67%), Gaps = 22/253 (8%)

Query: 179 RRIYNVRFLSKLDGSIDKAVQIKVLGKYDFASMLPSVLNGFIREYKIPNVMKKIYSQENV 238
           ++I+N+ FLSKL+G++D+A+Q+KVLGKYDFAS+L SVL   + E+KIP  +   Y+ +NV
Sbjct: 188 QKIFNLMFLSKLEGTVDRAIQLKVLGKYDFASILESVLERVVEEFKIPYPVMHQYTVDNV 247

Query: 239 TLYWKTAKLLNFMTCNSLKIPQAFENEISDIDITVIPKEKENEFEQMINSRLLEDEQNP- 297
           TLYW   KLL FMTC+SLKI     NE+++I++T++ K  E  FE+   +RLL  E+   
Sbjct: 248 TLYWNGGKLLKFMTCDSLKISNIDNNEVTEIEVTMVSKSDEERFEEEERARLLRVEKEAM 307

Query: 298 -----PDTAET------GNLDARVEEFEKELKNVDNSTTNHETTE-----LIDLEDEGDT 341
                P T E       G  D  +E  E     +D+S+   E  E      +DLEDE + 
Sbjct: 308 SKAKLPTTFEADPSDDNGEADCSIEIIE-----MDDSSRESEMKEGSKLAPVDLEDEDEL 362

Query: 342 DLMKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIG 401
           +++K+ALVG+DN +++VNVR +T  +KVAEYY++ K LP ++ + L FDHE+L+LNE++G
Sbjct: 363 EVIKLALVGQDNARLYVNVRRSTPFSKVAEYYKLHKPLPMEVKLNLYFDHEKLDLNETVG 422

Query: 402 DQDMEDEDMIEVL 414
           DQ++EDEDM+EV+
Sbjct: 423 DQELEDEDMLEVV 435

>Kpol_1027.26 s1027 complement(53549..54880) [1332 bp, 443 aa] {ON}
           complement(53549..54880) [1332 nt, 444 aa]
          Length = 443

 Score =  207 bits (527), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 121/297 (40%), Positives = 182/297 (61%), Gaps = 28/297 (9%)

Query: 146 FLEPDENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGK 205
           + E +END+F K I  + N        T+   P RIYN+ F SKLDGS+DK +Q +VLGK
Sbjct: 144 YEEEEENDDFSKAIRMNSNTLTNVPSPTSDMAPNRIYNITFTSKLDGSVDKKLQARVLGK 203

Query: 206 YDFASMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENE 265
             F+ ++  +L+ + + YK+  V K+ Y  + VT+YW  AKLL FMTCNSLKIP  F++E
Sbjct: 204 QQFSEIMQPILDSYSKIYKVSRVKKRNYKTDLVTVYWDRAKLLPFMTCNSLKIPLEFQSE 263

Query: 266 ISDIDITVIPKEKENEFEQMINSRLLEDEQNPPDTAETGN-----LDARVEEFEKE---- 316
           IS I++T+I KE E +FE  I ++L  D++   +  E G+     ++++++E +K+    
Sbjct: 264 ISHIELTIISKENEQQFEADIKAQLEVDQKENTNKTEVGSSKNFGIESQIDENKKKYEEY 323

Query: 317 ----LKNVDNSTTNHETTE-----------LIDLEDEGDTDL----MKIALVGEDNKKIF 357
                +++  S  +  T E            +D+  +  TDL    +K+ALVG DNKKIF
Sbjct: 324 ENELNESIPISVPSQGTAEDPMHIDGDEENAVDIIGKATTDLQQNIVKLALVGNDNKKIF 383

Query: 358 VNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDEDMIEVL 414
           VN R TT   K+AEYY + +KLPK   +KLIFD E+++L+  + DQD+ED+DMIEV+
Sbjct: 384 VNARETTRFFKLAEYYILHRKLPKSTKVKLIFDDEQIDLDSMVKDQDVEDDDMIEVV 440

>TPHA0E01810 Chr5 complement(364173..365534) [1362 bp, 453 aa] {ON}
           Anc_5.425 YDR363W
          Length = 453

 Score =  201 bits (512), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 121/300 (40%), Positives = 184/300 (61%), Gaps = 35/300 (11%)

Query: 150 DENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGKYDFA 209
           D +DEFFK I +        +   TPE   R YN+ ++SKL+GS ++ +Q KVLG   FA
Sbjct: 152 DADDEFFKAIREASKRPSTLSNSGTPEILNRKYNIMYISKLNGSEERRIQAKVLGTQTFA 211

Query: 210 SMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEISDI 269
            +LP +LN  ++  KIP+ ++ +Y  ENVTLYW  +KLLNFM C+SLKIPQ ++NEIS++
Sbjct: 212 KVLPPILNTLLKVNKIPSKLRSLYKAENVTLYWNKSKLLNFMNCDSLKIPQTYQNEISEL 271

Query: 270 DITVIPKEKENEFEQMINSRLLEDEQNPPDTAETGN--------LDARVEEFEKELKNV- 320
           +I +I KE+E +FE+    +LLEDEQ      E  N        L+    E+EKEL+N  
Sbjct: 272 EIILISKEEEQKFEEQFKMQLLEDEQLSQKNIENFNDSNKPFDILNTSYNEYEKELENWN 331

Query: 321 ----------------DNSTTN---HETTELIDLED-------EGDTDLMKIALVGEDNK 354
                           +NS+ N   +++  LI++ D        G ++++KI+L+  DNK
Sbjct: 332 SKDFNVTNDVLDVSNDENSSNNVKGNDSMNLIEISDNESSIKEHGTSNVIKISLMSNDNK 391

Query: 355 KIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDEDMIEVL 414
           KIFVNVR++T + K+ +Y++  K L  +  IK+IFDH+ L+L+  IGD D+EDED++E++
Sbjct: 392 KIFVNVRSSTKIQKLVDYFKKCKNLTSNQRIKVIFDHDVLSLDSMIGDNDIEDEDIVEMI 451

>KLTH0F16280g Chr6 complement(1321305..1322726) [1422 bp, 473 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 473

 Score =  200 bits (508), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 108/275 (39%), Positives = 164/275 (59%), Gaps = 13/275 (4%)

Query: 148 EPDENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGKYD 207
           E DE+D+FF+++ ++ + T    +E++P   +RIYN++F+S L+GS  + + +KV GK  
Sbjct: 204 EKDEDDKFFEELEREASRTASTVKESSPAVAQRIYNIKFISDLEGSAGRRINVKVKGKQS 263

Query: 208 FASMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEIS 267
           F  +LP  L   I+EYKIP+ +  IY  + VTLY    K+LNFM CNSL+IP  F+ E+S
Sbjct: 264 FDQILPVALKTIIKEYKIPDALHPIYETDKVTLYRDGVKILNFMNCNSLQIPLEFKGEVS 323

Query: 268 DIDITVIPKEKENEFEQMINSRLLEDEQNPPDTAETG--NLDARVEEFEKELKNVD---- 321
           D+ +T+I K +E  FE +       + +  P   E G    D  VEE+EKEL+NVD    
Sbjct: 324 DVCLTIISKGQEQNFEALYEQSKHSNHELVPAFIEPGTETPDFTVEEYEKELRNVDFNKN 383

Query: 322 NSTTNHETTELIDLEDEGDTDLMKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPK 381
            S  N    + +D       D ++IAL+ +DNKKI V  R  T    +AE+Y+    LP 
Sbjct: 384 TSVQNQPPPQSVD-------DNIRIALMSQDNKKIIVTARPETTFAALAEHYQKLTSLPP 436

Query: 382 DINIKLIFDHEELNLNESIGDQDMEDEDMIEVLTK 416
              + L FD+EEL+L+  + D D+ED+D++EV+ K
Sbjct: 437 QQQVLLFFDNEELHLDSKVSDADVEDDDIVEVVIK 471

>Kwal_55.21468 s55 complement(851687..853084) [1398 bp, 465 aa] {ON}
           YDR363W (ESC2) - establishes silent chromatin [contig
           130] FULL
          Length = 465

 Score =  191 bits (484), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 103/272 (37%), Positives = 166/272 (61%), Gaps = 12/272 (4%)

Query: 148 EPDENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGKYD 207
           E +E+++FF+++ ++   T    +E +P   +R+YN++FLS L+GS++  + +KV GK+ 
Sbjct: 199 EDNEDEKFFEELQREAGRTTSTLKEGSPATAKRVYNIKFLSNLEGSLNDKINVKVKGKHA 258

Query: 208 FASMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEIS 267
           F+ +LP  L   I+EYK+   +K  Y  ENV+LY    K+LNFM CNSL IP  +E E+S
Sbjct: 259 FSEILPIALKTLIKEYKVSKDLKPFYQPENVSLYRNGLKILNFMNCNSLHIPLNYEGEVS 318

Query: 268 DIDITVIPKEKENEFEQMI-NSRL----LEDEQNPPDTAETGNLDARVEEFEKELKNVDN 322
           D+ +T++ +++E E+ + +  SR     L  E+  P           +EEFEK+L+  ++
Sbjct: 319 DVSMTLVSRDREQEYVKTLEQSRHATPDLSREETSPKIP-----GFSIEEFEKDLEGFES 373

Query: 323 STTNHETTELIDLEDEGDTDLMKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKD 382
             +N+   +    E+   T  +KIAL+ +DNKKI+VNVR TT +  + E+YR  K L   
Sbjct: 374 GESNNLLEDTPQTENNHGT--IKIALMAQDNKKIYVNVRQTTTIAMLGEHYRTTKNLSSI 431

Query: 383 INIKLIFDHEELNLNESIGDQDMEDEDMIEVL 414
              K +FD+E+L L+  I D DMED D+IEV+
Sbjct: 432 ERFKFVFDNEDLQLSTKIDDLDMEDGDIIEVV 463

>CAGL0A02706g Chr1 (290595..291704) [1110 bp, 369 aa] {ON} similar
           to uniprot|Q06340 Saccharomyces cerevisiae YDR363w ESC2
          Length = 369

 Score =  176 bits (445), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 94/265 (35%), Positives = 158/265 (59%), Gaps = 21/265 (7%)

Query: 150 DENDEFFKQIAKDFNHTPLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGKYDFA 209
           DEND FF+ IAK     P+        Q  ++Y V+F+S +DG+  K+VQ+K LG + F+
Sbjct: 122 DENDLFFQSIAKRSQSLPVQDGSGAVRQ-DKVYYVQFISHVDGTKGKSVQVKALGSHPFS 180

Query: 210 SMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEISDI 269
            ++ + L+G +R +++P+VM+ +Y  E+V  YW  AK+L FMTC++L++PQ + ++   +
Sbjct: 181 KLVAAALSGLMRAHRLPSVMRPLYQPESVVSYWNRAKVLGFMTCDTLRVPQRYGSDY--L 238

Query: 270 DITVIP-KEKENEFEQMINSRLLEDEQNPPDTAETGNLDARVEEFEKELKNVDNSTTNHE 328
           +I ++P KE+    EQ +     E E+ P    +      R     KE++          
Sbjct: 239 EIQLVPVKEEAQYLEQEV---FEEPERAPTPEEDAEEEFERELRDAKEVR---------- 285

Query: 329 TTELIDLEDEGDTDLMKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLI 388
              ++DLE E   +++++AL G+DNKK++VNV+ TT   ++ EYYR +K+LP+   I L 
Sbjct: 286 -APVVDLESE---EVLRVALQGQDNKKVYVNVKPTTTFARMIEYYRTQKQLPRSTQITLA 341

Query: 389 FDHEELNLNESIGDQDMEDEDMIEV 413
            D E L+ + ++  QD+EDEDM+EV
Sbjct: 342 LDDEPLDPHATVKSQDIEDEDMLEV 366

>Ecym_5524 Chr5 (1062240..1063487) [1248 bp, 415 aa] {ON} similar to
           Ashbya gossypii AER251W
          Length = 415

 Score =  160 bits (406), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 149/244 (61%), Gaps = 12/244 (4%)

Query: 181 IYNVRFLSKLDGSIDKAVQIKVLGKYDFASMLPSVLNGFIREYKIPNVMKKIYSQENVTL 240
           IYNV F+SKL+GS +K + +++ GK  F++ LP  L  F++EYKI   +   Y  +NV +
Sbjct: 170 IYNVGFISKLEGSTNKRINVRITGKKKFSAFLPIALKTFVKEYKIAASLHDKYQIDNVKI 229

Query: 241 YWKTAKLLNFMTCNSLKIPQAFENEISDIDITVIPKEKENEFE----QMINSRL--LEDE 294
           Y +  ++  FMTC+S  I +A+ +   DI++ ++P E  +EFE    Q I +++  +   
Sbjct: 230 YREGVEIFKFMTCDSFNIAEAYASSSIDIEVYIVPNELASEFEIQWKQKIETKMKRVSIS 289

Query: 295 QNP----PDTAETGNLDARVEEFEKELKNVDN-STTNHETTELIDLEDEGDTDLMKIALV 349
            +P     D  E GN D RV E+EK+L N  +   T  + +  I   D+G+ +L+K+ L+
Sbjct: 290 ASPVDLDSDGIEFGNDDFRVNEYEKDLANARSLDETEIQYSNQISKPDDGN-ELIKVVLL 348

Query: 350 GEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDED 409
           G DNKK++VNV+ TT   K+AE+YR  KKLP    + L FDH++++ + +I    +ED+D
Sbjct: 349 GSDNKKVYVNVKPTTTFEKLAEHYRRIKKLPPTTKLILSFDHDDIDPSNTIFSAAIEDDD 408

Query: 410 MIEV 413
           ++EV
Sbjct: 409 IVEV 412

>AER251W Chr5 (1099999..1101222) [1224 bp, 407 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR363W (ESC2)
          Length = 407

 Score =  155 bits (391), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 97/284 (34%), Positives = 156/284 (54%), Gaps = 23/284 (8%)

Query: 151 ENDEFFKQIAKD--FNHTPLGTRETTPEQPR----RIYNVRFLSKLDGSIDKAVQIKVLG 204
           E + F  ++ +D   +  P G    T +  R    R+YNV F+S+++GS ++ V +KV G
Sbjct: 129 EANRFLAEMERDIELSAGPGGGETATGKGGRDTDARVYNVGFISRIEGSRNRRVNVKVTG 188

Query: 205 KYDFASMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFEN 264
           +  FA+ L   L  F +++ I   +K  Y  + V +Y +  ++  FMTC+S  I + +  
Sbjct: 189 QKQFATFLAIALAAFSKQHNIRKSLKPKYQADQVKIYREGVEVFKFMTCDSFNIEEPYNA 248

Query: 265 EISDIDITVIPKEKENEFEQ------------MINSRLLEDEQNPPDTAETGNLDARVEE 312
             +DI++ ++P ++   FEQ            + NS  LE      D  E  N D  V E
Sbjct: 249 SATDIEVYIVPVDEATAFEQEWKRKFEERVRMLSNSSFLE----VMDDIEDDNDDFLVNE 304

Query: 313 FEKELKNVDNSTTNHETTELIDLEDEGDTDLMKIALVGEDNKKIFVNVRNTTILTKVAEY 372
           +EK L N  +              DE  + L+KI L+G DNKK+F++VR TT L KVAE+
Sbjct: 305 YEKALVNARSLNETELAVREGTPADE-SSQLLKIVLLGSDNKKVFIHVRPTTTLLKVAEH 363

Query: 373 YRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDEDMIEVLTK 416
           YR+ K+LP  + + L+FDHEE++L+++I + D+ED D+IEV+ K
Sbjct: 364 YRVAKELPPTVQLSLMFDHEEIDLDDTICNIDIEDGDIIEVVVK 407

>KNAG0C04980 Chr3 complement(958989..960026) [1038 bp, 345 aa] {ON}
           Anc_5.425 YDR363W
          Length = 345

 Score =  144 bits (362), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 82/269 (30%), Positives = 140/269 (52%), Gaps = 27/269 (10%)

Query: 149 PDENDEFFKQIAKDFNHT--PLGTRETTPEQPRRIYNVRFLSKLDGSIDKAVQIKVLGKY 206
           PD+ ++FF+++ +    +  P  T  TT   P  +Y VRF S+L+G++ K+VQ+KV+G  
Sbjct: 98  PDDEEQFFQELLRARTQSVEPAET-ATTSTVPSPVYRVRFQSQLEGTLGKSVQVKVIGTR 156

Query: 207 DFASMLPSVLNGFIREYKIPNVMKKIYSQENVTLYWKTAKLLNFMTCNSLKIPQAFENEI 266
              ++LPSVL+  +R  ++P V++  Y++  V +Y   A++L FM CNSL + Q FENE+
Sbjct: 157 PLGTVLPSVLSALVRACRVPQVLQGGYTEGAVGMYRGGARVLPFMNCNSLGVVQEFENEV 216

Query: 267 SDIDITVIPKEKENEFEQMINSRLLEDEQNPPDTAETGNLDARVEEFEKELKNVDNSTTN 326
            ++D+ +               R L  E    D +         E        V    T 
Sbjct: 217 LEVDVVL---------------RALNLETPASDVSGGQEATNGTEAAASVPVPVPAPATA 261

Query: 327 HETTELIDLEDEGD--TDLMKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDIN 384
                    E  G+    LMKIAL+  DN++++V V   T  +++ EYYR+++ LP    
Sbjct: 262 AS-------ESPGNPAPALMKIALLSADNRRLYVKVHGGTPCSRLLEYYRMERGLPAGAP 314

Query: 385 IKLIFDHEELNLNESIGDQDMEDEDMIEV 413
           ++L  D E+++    I + D+ED D++E+
Sbjct: 315 LQLRLDDEQVSPETHISELDLEDGDVLEI 343

>KLLA0E21275g Chr5 complement(1900927..1902105) [1179 bp, 392 aa]
           {ON} some similarities with uniprot|Q06340 YDR363W
           Saccharomyces cerevisiae ESC2 Protein involved in
           mating- type locus silencing interacts with Sir2p
          Length = 392

 Score =  124 bits (312), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 136/245 (55%), Gaps = 12/245 (4%)

Query: 179 RRIYNVRFLSKLDGSIDKAVQIKVLGKYDFASMLPSVLNGFIREYKIPNVMKKIYSQENV 238
           +RIYN+ F+S L+GS DK V +KV G   F S+LP  +  FI+ YKIP  ++  Y+   +
Sbjct: 147 KRIYNINFISTLEGSQDKRVNVKVTGNKTFESILPITIRTFIQSYKIPRRLRIFYTPAEL 206

Query: 239 TLYWKTAKLLNFMTCNSLKIPQAFENEISDIDITVIPKEKEN----EFEQMINSRL--LE 292
            L+    ++L F  C+SL+IP+      + +D+ ++     N    E++++  SRL    
Sbjct: 207 VLFRAGVEVLPFSNCDSLRIPKTVSEYETTVDLVIVHSADANNYKTEYKRIRESRLQSFL 266

Query: 293 DEQN--PPDTAETGNLDARVEEFEKELKNVDNSTTNHETTELIDLEDEG--DTDLMKIAL 348
           DE N    D  E    D + + FEKEL++         T ++IDL D     ++ +++ L
Sbjct: 267 DESNIEEQDPLEQPARDEKFKLFEKELESA--PKLAERTDDVIDLLDSDIESSNSIRLTL 324

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDE 408
           + + NK+  ++V   T  T++A  Y+    L +D N+ LIFD+EELN   ++  + +E++
Sbjct: 325 IDKANKRTSISVWPNTTFTEIANRYKTISSLSEDANVLLIFDNEELNPAATVLSEGLEED 384

Query: 409 DMIEV 413
           D++E+
Sbjct: 385 DILEI 389

>Kpol_2002.45 s2002 (93655..93969) [315 bp, 104 aa] {ON}
           (93655..93969) [315 nt, 105 aa]
          Length = 104

 Score = 35.8 bits (81), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 39/66 (59%), Gaps = 3/66 (4%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDI-NIKLIFDHEELNLNESIGDQDMED 407
           V + + +IF  ++ TT L ++ E +   K+  KD+ +++ ++D   L  +++  D DMED
Sbjct: 30  VSDGSSEIFFKIKRTTPLKRLMEAF--AKRQGKDVDSLRFLYDGVRLQSDQTPDDLDMED 87

Query: 408 EDMIEV 413
            D+IE 
Sbjct: 88  NDIIEA 93

>TBLA0A07140 Chr1 (1774301..1774591) [291 bp, 96 aa] {ON} Anc_1.51
           YDR510W
          Length = 96

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 39/66 (59%), Gaps = 3/66 (4%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDI-NIKLIFDHEELNLNESIGDQDMED 407
           V + + +IF  ++ TT L ++ E +   K+  KD+ +++ ++D   +  +++  D DMED
Sbjct: 23  VSDGSSEIFFKIKRTTPLRRLMEAF--AKRQGKDVDSLRFLYDGVRIQPDQTPEDLDMED 80

Query: 408 EDMIEV 413
            D+IE 
Sbjct: 81  NDIIEA 86

>CAGL0K05731g Chr11 complement(561289..561615) [327 bp, 108 aa] {ON}
           highly similar to uniprot|Q12306 Saccharomyces
           cerevisiae YDR510w SMT3 ubiquitin-like protein
          Length = 108

 Score = 33.9 bits (76), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 21/83 (25%), Positives = 45/83 (54%), Gaps = 4/83 (4%)

Query: 334 DLEDEGDTDLMKIAL---VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFD 390
           DL+ +GD    +  +   V + + +IF  ++ TT L ++ E +  ++    D +++ ++D
Sbjct: 18  DLQGQGDAPKSETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMD-SLRFLYD 76

Query: 391 HEELNLNESIGDQDMEDEDMIEV 413
              +  +++  D DMED D+IE 
Sbjct: 77  GLRIQADQTPEDLDMEDNDLIEA 99

>NDAI0A00650 Chr1 (120882..121202) [321 bp, 106 aa] {ON} Anc_1.51
           YDR510W
          Length = 106

 Score = 33.9 bits (76), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 39/66 (59%), Gaps = 3/66 (4%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDIN-IKLIFDHEELNLNESIGDQDMED 407
           V + + +IF  ++ TT L ++ E +   K+  K++N ++ ++D   +  +++  D DMED
Sbjct: 32  VSDGSSEIFFKIKRTTPLKRLMEAF--AKRQGKEMNSLRFLYDGIRVQADQTPEDLDMED 89

Query: 408 EDMIEV 413
            D+IE 
Sbjct: 90  NDIIEA 95

>TPHA0E03650 Chr5 complement(773947..774264) [318 bp, 105 aa] {ON}
           Anc_1.51 YDR510W
          Length = 105

 Score = 33.1 bits (74), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDE 408
           V + + +IF  ++ TT L ++ E +  ++    D +++ ++D   L  +++  D DMED 
Sbjct: 33  VSDGSSEIFFKIKRTTPLKRLMEAFAKRQGKEMD-SLRFLYDGIRLQADQTPEDLDMEDN 91

Query: 409 DMIEV 413
           D+IE 
Sbjct: 92  DIIEA 96

>Ecym_1057 Chr1 (104604..104900) [297 bp, 98 aa] {ON} similar to
           Ashbya gossypii AFR697C
          Length = 98

 Score = 33.1 bits (74), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDE 408
           V + + +I+  +R TT L ++ E +  ++    D +++ ++D   +  ++S  D DMED 
Sbjct: 21  VSDGSSEIYFKIRRTTPLRRLMEAFAKRQGKEMD-SLRFLYDGVRIQPDQSPDDLDMEDN 79

Query: 409 DMIEV 413
           D+IE 
Sbjct: 80  DIIEA 84

>ZYRO0F17424g Chr6 complement(1449658..1449957) [300 bp, 99 aa] {ON}
           highly similar to uniprot|Q12306 Saccharomyces
           cerevisiae YDR510W
          Length = 99

 Score = 32.7 bits (73), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDE 408
           V + + +IF  ++ TT L ++ E +  ++    D +++ ++D   +  +++  D DMED 
Sbjct: 26  VSDGSSEIFFKIKRTTPLRRLMEAFAKRQGKEMD-SLRFLYDGIRIQADQTPDDLDMEDN 84

Query: 409 DMIEV 413
           D+IE 
Sbjct: 85  DIIEA 89

>KLTH0F01650g Chr6 (126388..126672) [285 bp, 94 aa] {ON} highly
           similar to uniprot|Q12306 Saccharomyces cerevisiae
           YDR510W
          Length = 94

 Score = 32.3 bits (72), Expect = 0.42,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDE 408
           V + + +IF  ++ TT L ++ E +  ++    D +++ ++D   +  +++  D DMED 
Sbjct: 22  VSDGSSEIFFKIKRTTPLRRLMEAFAKRQGKEMD-SLRFLYDGVRIQADQTPEDLDMEDN 80

Query: 409 DMIEV 413
           D+IE 
Sbjct: 81  DIIEA 85

>SAKL0C01694g Chr3 (142861..143154) [294 bp, 97 aa] {ON} highly
           similar to uniprot|Q12306 Saccharomyces cerevisiae
           YDR510W
          Length = 97

 Score = 32.3 bits (72), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDE 408
           V + + +IF  ++ TT L ++ E +  ++    D +++ ++D   +  +++  D DMED 
Sbjct: 24  VSDGSSEIFFKIKRTTPLRRLMEAFAKRQGKEMD-SLRFLYDGVRIQPDQTPDDLDMEDN 82

Query: 409 DMIEV 413
           D+IE 
Sbjct: 83  DIIEA 87

>KAFR0D04110 Chr4 complement(813551..813859) [309 bp, 102 aa] {ON}
           Anc_1.51 YDR510W
          Length = 102

 Score = 32.0 bits (71), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDE 408
           V + + +IF  ++ TT L ++ E +  ++    D +++ ++D   +  +++  D DMED 
Sbjct: 30  VSDGSSEIFFKIKRTTPLRRLMEAFAKRQGKEMD-SLRFLYDGIRIQPDQTPDDLDMEDN 88

Query: 409 DMIEV 413
           D+IE 
Sbjct: 89  DIIEA 93

>AFR697C Chr6 complement(1725916..1726194) [279 bp, 92 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR510W
           (SMT3)
          Length = 92

 Score = 31.6 bits (70), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDE 408
           V + + +IF  ++ TT L ++ E +  ++    D +++ ++D   +  +++  D DMED 
Sbjct: 21  VSDGSSEIFFKIKRTTPLRRLMEAFAKRQGKEMD-SLRFLYDGVRIQPDQTPDDLDMEDN 79

Query: 409 DMIEV 413
           D+IE 
Sbjct: 80  DIIEA 84

>NCAS0B08590 Chr2 (1648641..1648949) [309 bp, 102 aa] {ON} Anc_1.51
           YDR510W
          Length = 102

 Score = 32.0 bits (71), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDE 408
           V + + +IF  ++ TT L ++ E +  ++    D +++ ++D   +  +++  D DMED 
Sbjct: 29  VSDGSSEIFFKIKRTTPLKRLMEAFAKRQGKEMD-SLRFLYDGIRVGADQTPEDLDMEDN 87

Query: 409 DMIEV 413
           D+IE 
Sbjct: 88  DIIEA 92

>Skud_4.785 Chr4 (1389558..1389863) [306 bp, 101 aa] {ON} YDR510W
           (REAL)
          Length = 101

 Score = 31.6 bits (70), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDE 408
           V + + +IF  ++ TT L ++ E +  ++    D +++ ++D   +  +++  D DMED 
Sbjct: 28  VSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMD-SLRFLYDGIRIQADQTPEDLDMEDN 86

Query: 409 DMIEV 413
           D+IE 
Sbjct: 87  DIIEA 91

>YDR510W Chr4 (1469400..1469705) [306 bp, 101 aa] {ON}
           SMT3Ubiquitin-like protein of the SUMO family,
           conjugated to lysine residues of target proteins;
           regulates chromatid cohesion, chromosome segregation,
           APC-mediated proteolysis, DNA replication and septin
           ring dynamics; phosphorylated at Ser2
          Length = 101

 Score = 31.6 bits (70), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDE 408
           V + + +IF  ++ TT L ++ E +  ++    D +++ ++D   +  +++  D DMED 
Sbjct: 28  VSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMD-SLRFLYDGIRIQADQTPEDLDMEDN 86

Query: 409 DMIEV 413
           D+IE 
Sbjct: 87  DIIEA 91

>Suva_2.689 Chr2 (1222165..1222470) [306 bp, 101 aa] {ON} YDR510W
           (REAL)
          Length = 101

 Score = 31.6 bits (70), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDE 408
           V + + +IF  ++ TT L ++ E +  ++    D +++ ++D   +  +++  D DMED 
Sbjct: 28  VSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMD-SLRFLYDGIRIQADQTPEDLDMEDN 86

Query: 409 DMIEV 413
           D+IE 
Sbjct: 87  DIIEA 91

>AER359W Chr5 (1298989..1303944) [4956 bp, 1651 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL206C (CHC1)
          Length = 1651

 Score = 33.9 bits (76), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 53/115 (46%), Gaps = 5/115 (4%)

Query: 242 WKTAKLLNFMTCNSLKIPQAFENEISDIDITVIPKEKENEFEQMIN---SRLLEDEQNPP 298
           W   ++L F+T NSL   +AF+ E++     +  +    +  Q+IN   +R L+      
Sbjct: 113 WLNDEVLGFVTANSLLTCRAFDGEVAQPPARLTARNANLKNTQVINFVANRALDWFAVVG 172

Query: 299 DTAETGNLDARVEEFEKELKNVDNSTTNHETTELIDLEDEGDTDLMKIALVGEDN 353
            T E G +  +++ F K  +N+  +   H  T    L  +G+   +++ + G  N
Sbjct: 173 ITQENGRIAGKIQLFSKA-RNISQAIDGHVAT-FASLMLDGNPQPVQVFVTGNRN 225

>Smik_4.791 Chr4 (1392239..1392544) [306 bp, 101 aa] {ON} YDR510W
           (REAL)
          Length = 101

 Score = 31.2 bits (69), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDE 408
           V + + +IF  ++ TT L ++ E +  ++    D +++ ++D   +  +++  D DMED 
Sbjct: 28  VSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMD-SLRFLYDGIRIQADQTPEDLDMEDN 86

Query: 409 DMIEV 413
           D+IE 
Sbjct: 87  DIIEA 91

>TDEL0C06500 Chr3 complement(1195140..1195433) [294 bp, 97 aa] {ON}
           Anc_1.51 YDR510W
          Length = 97

 Score = 31.2 bits (69), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 16/65 (24%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQDMEDE 408
           V + + +IF  ++ TT L ++ + +  ++    D +++ ++D   +  +++  D DMED 
Sbjct: 26  VSDGSSEIFFKIKRTTPLRRLMDAFAKRQGREMD-SLRFLYDGLRIQPDQTPDDLDMEDN 84

Query: 409 DMIEV 413
           D+IE 
Sbjct: 85  DIIEA 89

>KLLA0F17974g Chr6 (1644903..1645051,1645153..1645237) [234 bp, 77
           aa] {ON} similar to uniprot|Q03919 Saccharomyces
           cerevisiae YDR139C RUB1 Ubiquitin-like protein with
           similarity to mammalian NEDD8
          Length = 77

 Score = 29.6 bits (65), Expect = 2.8,   Method: Composition-based stats.
 Identities = 17/71 (23%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 344 MKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEELNLNESIGDQ 403
           M++ +     K+I V+V+++  +  + E    K+ +P     KLIF  ++++ N +IG  
Sbjct: 1   MQLKVKTLTGKEISVDVQSSETVYHIKELLEEKEGIPPSQQ-KLIFQGKQIDDNATIGSA 59

Query: 404 DMEDEDMIEVL 414
           D++D  ++ ++
Sbjct: 60  DLQDGSLLHLV 70

>KLLA0C01628g Chr3 (126942..127223) [282 bp, 93 aa] {ON} highly
           similar to uniprot|Q12306 Saccharomyces cerevisiae
           YDR510W
          Length = 93

 Score = 30.0 bits (66), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 39/66 (59%), Gaps = 3/66 (4%)

Query: 349 VGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDI-NIKLIFDHEELNLNESIGDQDMED 407
           V + + +IF  ++ TT L ++ E +   K+  K+I +++ ++D   +  +++  D DMED
Sbjct: 21  VSDGSSEIFFKIKKTTPLKRLMEAF--AKRQGKEIESLRFLYDGVRVLPDQTPEDLDMED 78

Query: 408 EDMIEV 413
            D+IE 
Sbjct: 79  NDIIEA 84

>Kpol_1011.8 s1011 complement(21657..22787) [1131 bp, 376 aa] {ON}
           complement(21657..22787) [1131 nt, 377 aa]
          Length = 376

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 43/87 (49%), Gaps = 15/87 (17%)

Query: 190 LDGSIDKAVQIKVLGKYDFASMLPSVLN-GFIREYKIPNVMKKIYSQE---------NVT 239
           +DG+    +QI++L KYD   +L   L   ++ EY  PNV  +I S+E          + 
Sbjct: 140 IDGA--SPLQIELLSKYDTLPLLNMDLRIRYLEEYLYPNVNVEIVSEELENIDVTNTTIK 197

Query: 240 LYWKTAK---LLNFMTCNSLKIPQAFE 263
           +YWK  K   +LN     +L+I   F+
Sbjct: 198 VYWKFTKIELILNLSYDTTLQILLKFD 224

>Kpol_2002.30 s2002 complement(61251..62903) [1653 bp, 550 aa] {ON}
           complement(61251..62903) [1653 nt, 551 aa]
          Length = 550

 Score = 30.8 bits (68), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 44/90 (48%), Gaps = 7/90 (7%)

Query: 261 AFENEISDIDITVIPKEKENEFEQMINS-RLLEDEQNPPDTAETGNLDARVEEFEKELKN 319
           A + +ISD    +I +  +N F+  IN+ RLL  E   P +     +  R+    KELK 
Sbjct: 22  ALQAKISD---EIILQLNDNNFDDAINNNRLLLAEFYAPWSIHAKTMSTRLLAAAKELKK 78

Query: 320 VDNSTTNHETTELIDLEDEGDTD---LMKI 346
           +D      + TE I+L  + + D   LMKI
Sbjct: 79  IDIVVGQIDCTESIELCAKYNIDAYPLMKI 108

>KLTH0F11968g Chr6 (1008620..1011259) [2640 bp, 879 aa] {ON} similar
           to uniprot|Q06106 Saccharomyces cerevisiae YPR112C MRD1
           Essential conserved protein that associates with 35S
           precursor rRNA and is required for its initial
           processing at the A(0)-A(2) cleavage sites shows partial
           nucleolar localization contains five consensus RNA-
           binding domains
          Length = 879

 Score = 30.8 bits (68), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 41/108 (37%), Gaps = 25/108 (23%)

Query: 249 NFMTCNSLKIPQAFENEISDIDIT--VIPKEKENEFEQMINSRLL-------EDEQNPPD 299
           +F    S+++P+ F+           ++PKE EN  EQ+    LL         EQ P D
Sbjct: 773 SFGQLKSVRVPKKFDKSTRGFAFVEFLLPKEAENAMEQLQGVHLLGRRLVMQHAEQEPQD 832

Query: 300 TAETGNLDARVEEFEKELKNVDNSTTNHETTEL-------IDLEDEGD 340
                      E+  +  K V +     E   L       +DLEDE D
Sbjct: 833 AE---------EQIARMTKKVRSQVATQELAALRNGGRRKVDLEDELD 871

>SAKL0H02332g Chr8 (233859..236312) [2454 bp, 817 aa] {ON} some
           similarities with uniprot|P53316 Saccharomyces
           cerevisiae YGR250C Hypothetical ORF
          Length = 817

 Score = 30.4 bits (67), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 18/60 (30%), Positives = 35/60 (58%), Gaps = 4/60 (6%)

Query: 335 LEDEGDTDLMKIALVGEDNKKIFVNVRNTTILTKVAEYYRIKKKLPKDINIKLIFDHEEL 394
           LE   +T+L+ I +   D     ++ + + +LT++ EY +IK+ +P  IN  +I ++E L
Sbjct: 56  LEQLANTNLLTIRVKWGDGS--LIDYKKSELLTRIHEYIQIKRGIP--INPPIIENYEYL 111

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.131    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 43,772,025
Number of extensions: 2010625
Number of successful extensions: 9409
Number of sequences better than 10.0: 208
Number of HSP's gapped: 9801
Number of HSP's successfully gapped: 214
Length of query: 416
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 304
Effective length of database: 40,638,807
Effective search space: 12354197328
Effective search space used: 12354197328
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 67 (30.4 bits)