Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F09768g5.423ON37337320020.0
ZYRO0F15664gsingletonON37337318460.0
NCAS0F032905.423ON40437314400.0
Suva_15.3085.423ON37837413930.0
YHR112C5.423ON37837413880.0
Skud_8.1735.423ON37837413850.0
Kpol_1031.235.423ON37937413850.0
KAFR0E038605.423ON37837413810.0
Smik_8.1905.423ON42037413820.0
NDAI0B055905.423ON38037413570.0
CAGL0I01276g5.423ON38037213510.0
CAGL0K05665gsingletonON37937413420.0
SAKL0G02222g5.423ON37837413400.0
TBLA0A036805.423ON38437013011e-180
KNAG0C049905.423ON38037612791e-176
NDAI0F00140singletonON37837512771e-176
TBLA0B03020singletonON37937212591e-173
TDEL0G04970singletonON38137512261e-168
KLLA0E21319g5.423ON38037512141e-166
KNAG0F01580singletonON37937312061e-165
TDEL0G00140singletonON38137512031e-165
TPHA0A06070na 1ON37335911801e-161
Ecym_55235.423ON38137511551e-157
NDAI0B00595singletonON37837511541e-157
AER250C5.423ON37437411221e-153
Kwal_55.222215.423ON38036611211e-152
KLTH0E16566g5.423ON38136910631e-144
Kpol_1044.107.97ON3913833715e-40
NCAS0F015207.97ON4293853701e-39
KAFR0K007607.97ON3923853602e-38
KLLA0F07909g7.97ON3913913593e-38
NDAI0H024007.97ON3933463567e-38
TPHA0L005707.97ON3913483541e-37
SAKL0B09614g7.97ON3923463523e-37
CAGL0H06369g7.97ON3913973505e-37
Suva_1.567.97ON3953903498e-37
TDEL0H035307.97ON3913473489e-37
Smik_1.557.97ON3943893453e-36
YAL012W (CYS3)7.97ON3943893428e-36
Skud_1.497.97ON3943893428e-36
ZYRO0D05742g7.97ON3913833233e-33
AEL341W7.97ON3933863225e-33
KLTH0D02728g7.97ON3924013209e-33
TBLA0E022407.97ON3873513139e-32
KNAG0D047407.97ON3904003112e-31
Ecym_26297.97ON3923503112e-31
CAGL0L06094g8.145ON4503932603e-24
YGL184C (STR3)8.145ON4654082472e-22
Smik_7.898.145ON4654082454e-22
Skud_7.888.145ON4654082439e-22
TDEL0B046608.145ON4643842322e-20
ZYRO0G19162g8.145ON4553612294e-20
Suva_7.798.145ON4654082286e-20
Kwal_47.172218.145ON4634072252e-19
KLTH0E06644g8.145ON4603902182e-18
SAKL0H24882g8.145ON4593982144e-18
Ecym_84058.145ON4724092074e-17
Ecym_83654.53ON4444422064e-17
NCAS0A058104.53ON4473952031e-16
ACL059C8.145ON4532491985e-16
KLLA0C17028g8.145ON4603011932e-15
KNAG0I029204.53ON4453111871e-14
KAFR0F030704.53ON4453051871e-14
TBLA0C044004.53ON4453091834e-14
Skud_19.6singletonON4013871817e-14
TPHA0F004204.53ON4423101772e-13
NDAI0D028804.53ON4473041772e-13
TDEL0D06630singletonON4023571754e-13
SAKL0H23892g4.53ON4423081745e-13
Smik_7.375na 1ON4013371701e-12
KLTH0G00418gsingletonON5682511702e-12
Kpol_1041.444.53ON4443111665e-12
Suva_17.6singletonON4013871641e-11
ADL031W4.53ON4672961641e-11
Kwal_26.74374.53ON4443001586e-11
YFR055W (IRC7)na 1ON3402881541e-10
Ecym_51694.354ON6812641552e-10
TDEL0E056204.53ON4463071542e-10
SAKL0G18172g4.354ON6732631542e-10
ZYRO0G22198g4.53ON4453931533e-10
Suva_10.3974.53ON4443471523e-10
AER164C4.354ON6453171533e-10
TDEL0E05710singletonON5563201533e-10
Skud_12.3844.53ON4443051514e-10
KLTH0D03652g4.53ON4442971514e-10
Smik_12.3834.53ON4443051506e-10
YLR303W (MET17)4.53ON4442981497e-10
Kpol_1028.804.354ON6892721508e-10
Suva_13.684.354ON6882391462e-09
Smik_10.4234.354ON6392421453e-09
Suva_12.2214.354ON6392421443e-09
KLLA0D04037g4.53ON4443131434e-09
Skud_12.10na 2ON5712501435e-09
Skud_10.3534.354ON6402421427e-09
KLTH0D17930g4.354ON6522611428e-09
YML082W4.354ON6492391418e-09
Smik_13.554.354ON6992431419e-09
CAGL0D06402g4.53ON4423121401e-08
Kwal_14.791na 2ON5712431391e-08
NCAS0A062704.354ON6592581392e-08
YJR130C (STR2)4.354ON6392471392e-08
ZYRO0B08338g4.354ON6402491372e-08
Skud_13.594.354ON6492431373e-08
CAGL0M00550g4.354ON5692431355e-08
YLL058Wna 2ON5752671355e-08
TDEL0D006104.354ON6522731311e-07
Suva_10.8na 2ON5722651302e-07
Kwal_47.166444.354ON6522561293e-07
NDAI0D032604.354ON6962661266e-07
TPHA0L003304.354ON7172751259e-07
KNAG0M003304.354ON6312861231e-06
KLLA0B04378g4.354ON6882591178e-06
Smik_12.3na 2ON5662531141e-05
Kwal_26.7197singletonOFF87681005e-05
KAFR0B068304.354ON6672441034e-04
KAFR0E043904.370ON1431101731.7
KAFR0E04410na 3ON1436101696.0
KLLA0E11507g5.271ON98562687.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F09768g
         (373 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {...   775   0.0  
ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} high...   715   0.0  
NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {O...   559   0.0  
Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {...   541   0.0  
YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON} P...   539   0.0  
Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON...   538   0.0  
Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {O...   538   0.0  
KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {O...   536   0.0  
Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON...   536   0.0  
NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa] ...   527   0.0  
CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {...   525   0.0  
CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa] ...   521   0.0  
SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {...   520   0.0  
TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {O...   505   e-180
KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.4...   497   e-176
NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON}                496   e-176
TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {O...   489   e-173
TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {O...   476   e-168
KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} high...   472   e-166
KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {O...   469   e-165
TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON}      468   e-165
TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa] ...   459   e-161
Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {O...   449   e-157
NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}              449   e-157
AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}...   436   e-153
Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR1...   436   e-152
KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} simi...   414   e-144
Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON} (19232....   147   5e-40
NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {O...   147   1e-39
KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7....   143   2e-38
KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly...   142   3e-38
NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {O...   141   7e-38
TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97...   140   1e-37
SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {...   140   3e-37
CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly...   139   5e-37
Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W (...   139   8e-37
TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {O...   138   9e-37
Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W (...   137   3e-36
YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}  CYS3Cystat...   136   8e-36
Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W (...   136   8e-36
ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly...   129   3e-33
AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homol...   128   5e-33
KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly...   127   9e-33
TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.9...   125   9e-32
KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {O...   124   2e-31
Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {O...   124   2e-31
CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} simil...   104   3e-24
YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}  ...   100   2e-22
Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}...    99   4e-22
Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}...    98   9e-22
TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {O...    94   2e-20
ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} simi...    93   4e-20
Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}...    92   6e-20
Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {...    91   2e-19
KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {...    89   2e-18
SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} high...    87   4e-18
Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar t...    84   4e-17
Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}...    84   4e-17
NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4...    83   1e-16
ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON} S...    81   5e-16
KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]...    79   2e-15
KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.5...    77   1e-14
KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.5...    77   1e-14
TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4...    75   4e-14
Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON} YF...    74   7e-14
TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {O...    73   2e-13
NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53      73   2e-13
TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa] ...    72   4e-13
SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} high...    72   5e-13
Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W ...    70   1e-12
KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON...    70   2e-12
Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON} (1173...    69   5e-12
Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)    68   1e-11
ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic ho...    68   1e-11
Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {O...    65   6e-11
YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}  IRC7Beta-l...    64   1e-10
Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}...    64   2e-10
TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa] ...    64   2e-10
SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]...    64   2e-10
ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]...    64   3e-10
Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303...    63   3e-10
AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON} S...    64   3e-10
TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa] ...    64   3e-10
Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303...    63   4e-10
KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {...    63   4e-10
Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303...    62   6e-10
YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}  MET17Meth...    62   7e-10
Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON} (1796...    62   8e-10
Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W...    61   2e-09
Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {...    60   3e-09
Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {...    60   3e-09
KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly...    60   4e-09
Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W (...    60   5e-09
Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {...    59   7e-09
KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} simi...    59   8e-09
YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative p...    59   8e-09
Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C ...    59   9e-09
CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly...    59   1e-08
Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON} ...    58   1e-08
NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa] ...    58   2e-08
YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON} ...    58   2e-08
ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {...    57   2e-08
Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W...    57   3e-08
CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar...    57   5e-08
YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative pro...    57   5e-08
TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.3...    55   1e-07
Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)    55   2e-07
Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON...    54   3e-07
NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {O...    53   6e-07
TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.35...    53   9e-07
KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.35...    52   1e-06
KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} simila...    50   8e-06
Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)     49   1e-05
Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W ...    43   5e-05
KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa] ...    44   4e-04
KAFR0E04390 Chr5 complement(879422..883717) [4296 bp, 1431 aa] {...    33   1.7  
KAFR0E04410 Chr5 complement(886158..890468) [4311 bp, 1436 aa] {...    31   6.0  
KLLA0E11507g Chr5 (1011380..1014337) [2958 bp, 985 aa] {ON} simi...    31   7.1  

>ZYRO0F09768g Chr6 complement(793824..794945) [1122 bp, 373 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 373

 Score =  775 bits (2002), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/373 (100%), Positives = 373/373 (100%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60
           MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG
Sbjct: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60

Query: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120
           HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN
Sbjct: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120

Query: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180
           YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP
Sbjct: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180

Query: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240
           LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL
Sbjct: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240

Query: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTEEFVKKQLSGGYTP 300
           LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTEEFVKKQLSGGYTP
Sbjct: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTEEFVKKQLSGGYTP 300

Query: 301 VFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESAD 360
           VFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESAD
Sbjct: 301 VFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESAD 360

Query: 361 DLINDLSTVLSQL 373
           DLINDLSTVLSQL
Sbjct: 361 DLINDLSTVLSQL 373

>ZYRO0F15664g Chr6 (1286078..1287199) [1122 bp, 373 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 373

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/373 (90%), Positives = 358/373 (95%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60
           MVDL TLLLHGDDEHNRVTDVAPPINVASTFRYDNDNL+PWRD  NLD LDE PVYSREG
Sbjct: 1   MVDLATLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLVPWRDITNLDCLDEYPVYSREG 60

Query: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120
           HPNGVRLEALFSRFLGGHA+CYSCGLGGFL  MVHFNPKRVFMDQCYHGVQGIVGI+KRN
Sbjct: 61  HPNGVRLEALFSRFLGGHAVCYSCGLGGFLSAMVHFNPKRVFMDQCYHGVQGIVGIMKRN 120

Query: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180
           YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAH+KGALLMVDSTFAPPP
Sbjct: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHAKGALLMVDSTFAPPP 180

Query: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240
           LQNAWDFGADMIMHSATKYF GHSDLLSGVLVVKDKE ASKLKEDRI LGSNI+NL+SYL
Sbjct: 181 LQNAWDFGADMIMHSATKYFGGHSDLLSGVLVVKDKETASKLKEDRICLGSNISNLDSYL 240

Query: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTEEFVKKQLSGGYTP 300
           LLRSLRTYDLRI+RQ+E+ATK+V+YLNDHK+ +PAL +LYHSSLQ+++FVKKQLSGGY P
Sbjct: 241 LLRSLRTYDLRIKRQSESATKIVQYLNDHKNDFPALDKLYHSSLQSDDFVKKQLSGGYGP 300

Query: 301 VFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESAD 360
           VFSLT KTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA+
Sbjct: 301 VFSLTLKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESAE 360

Query: 361 DLINDLSTVLSQL 373
           DL NDL+TVLSQL
Sbjct: 361 DLTNDLTTVLSQL 373

>NCAS0F03290 Chr6 complement(667618..668832) [1215 bp, 404 aa] {ON}
           Anc_5.423 YHR112C
          Length = 404

 Score =  559 bits (1440), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 259/373 (69%), Positives = 311/373 (83%), Gaps = 1/373 (0%)

Query: 2   VDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGH 61
           + L T L+HGDD+ NRV+DVAPPINV +TFRYD ++LIPW ++ NLDF+D+ P+YSR GH
Sbjct: 28  IHLSTTLIHGDDKDNRVSDVAPPINVTTTFRYDPNDLIPWSERENLDFMDKTPIYSRLGH 87

Query: 62  PNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRNY 121
           PN  RLE++FS  L GHA+ YS G+  F   MVH+NPKR+FM Q YHG + I  IL RNY
Sbjct: 88  PNSTRLESIFSEVLNGHAVIYSSGVSAFFAAMVHYNPKRLFMGQSYHGCRAIANILTRNY 147

Query: 122 GVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPL 181
            VE++ L DIEK+AQKGDIVH+ETP+NP+GTSLDISE ARRAH+KGALL VDSTFAPPPL
Sbjct: 148 NVEQHPLEDIEKYAQKGDIVHLETPVNPYGTSLDISEFARRAHAKGALLCVDSTFAPPPL 207

Query: 182 QNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLL 241
           Q+ W+F AD++MHSATKYF GHSDLLSGVLVVKD++VA +L++DRIYLG+N+ANLESYLL
Sbjct: 208 QDVWEFDADIVMHSATKYFGGHSDLLSGVLVVKDEDVARQLRDDRIYLGTNVANLESYLL 267

Query: 242 LRSLRTYDLRIRRQAENATKVVKYLNDHKDKY-PALVELYHSSLQTEEFVKKQLSGGYTP 300
           LRSLRT+ +RI RQ+ENATKVVK+LND+K K+   L ++YHSSLQTE FVKKQL GGY P
Sbjct: 268 LRSLRTFKMRIERQSENATKVVKFLNDNKGKFGNVLDKIYHSSLQTEPFVKKQLKGGYDP 327

Query: 301 VFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESAD 360
           VFS+T K +EQCKKF   LK F HATSLGG+ESLVEWRAM D  IDQ L+R+SIGCE AD
Sbjct: 328 VFSITLKNKEQCKKFPLLLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRISIGCEDAD 387

Query: 361 DLINDLSTVLSQL 373
           DLINDLS  L++L
Sbjct: 388 DLINDLSAALNKL 400

>Suva_15.308 Chr15 complement(536926..538062) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/374 (64%), Positives = 313/374 (83%), Gaps = 1/374 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60
           MVDL T L+H DD+ NRVTDVAPPINV++TFRYD+D+LIPW ++ NLDF+++ PVYSR  
Sbjct: 1   MVDLSTALIHADDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKRPVYSRLA 60

Query: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120
           HPN  RLE++FS  L G+A+ YS GL  F   MVH+NPK++F+ Q YHGV+ I  IL RN
Sbjct: 61  HPNSTRLESVFSDILDGYAVVYSSGLAAFFAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120

Query: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180
           Y ++++ L DIE++A +GDIVH+E+P+NP+GTS DI   ARRAH+KGALL++DSTFA PP
Sbjct: 121 YDIKQHPLEDIERYAAEGDIVHLESPVNPYGTSYDIESFARRAHAKGALLILDSTFASPP 180

Query: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240
           LQ AW+FGAD++++SATKYF GHSDLLSGVLVVKD+ V+ +LK+DRIYLG+N+ANLES++
Sbjct: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKDEAVSRRLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVE-LYHSSLQTEEFVKKQLSGGYT 299
           LLRSLRTY+LRI +Q+ENATK+VK+L+DH+ ++  +++ +YHSSLQTEEFVKKQL GGY 
Sbjct: 241 LLRSLRTYELRINKQSENATKIVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359
           PVF++T +T+EQCK F   LK F HATSLGG+ESLVEWRAM D  IDQ L+RVS+GCESA
Sbjct: 301 PVFAITLRTKEQCKVFPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 360 DDLINDLSTVLSQL 373
           DDLI DL++ L +L
Sbjct: 361 DDLIRDLASALKEL 374

>YHR112C Chr8 complement(334527..335663) [1137 bp, 378 aa] {ON}
           Protein of unknown function; localizes to the cytoplasm
           and nucleus; overexpression affects protein trafficking
           through the endocytic pathway
          Length = 378

 Score =  539 bits (1388), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/374 (64%), Positives = 313/374 (83%), Gaps = 1/374 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60
           MVDL T L+HGDD+ NRVTDVAPPINV++TFRYD+D+LIPW ++ NLDF+++ PVYSR  
Sbjct: 1   MVDLSTALIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60

Query: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120
           HPN  RLE++FS  L G+A+ YS GL  F   MVH+NPK++F+ Q YHGV+ I  IL RN
Sbjct: 61  HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAIANILTRN 120

Query: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180
           YG+E++ L DIEK A +GDIVH+E+P+NP+GTS DI  LARRAH+KGALL+VDSTFA PP
Sbjct: 121 YGIEQHPLEDIEKCASEGDIVHLESPVNPYGTSSDIESLARRAHAKGALLIVDSTFASPP 180

Query: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240
           LQ AW+FGAD++++SATKYF GHSDLLSGVLVVK++  + +LK+DRIYLG+N+ANLES++
Sbjct: 181 LQYAWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEATSRQLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVE-LYHSSLQTEEFVKKQLSGGYT 299
           LLRSLRTY++RI +Q+ENATK+V++L+DH+ ++  +++ +YHSSLQTEEFVKKQL GGY 
Sbjct: 241 LLRSLRTYEMRITKQSENATKLVRFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359
           PVF++T  T+EQCK+    LK F HATSLGG+ESLVEWRAM D  IDQ L+RVS+GCESA
Sbjct: 301 PVFAITLYTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 360 DDLINDLSTVLSQL 373
           +DLI DL++ L +L
Sbjct: 361 NDLIKDLASALKEL 374

>Skud_8.173 Chr8 complement(308322..309458) [1137 bp, 378 aa] {ON}
           YHR112C (REAL)
          Length = 378

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/374 (64%), Positives = 312/374 (83%), Gaps = 1/374 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60
           MV+L T+L+HGDD+ NRVTDVAPPINV++TFRYD+D+LIPW ++ NLDF+++ PVYSR  
Sbjct: 1   MVNLSTVLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLIPWTERENLDFMEKKPVYSRLA 60

Query: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120
           HPN  RLE++FS  L G+A+ YS GL  F   MVH+NPK++F+ Q YHGV+ I  IL RN
Sbjct: 61  HPNSTRLESVFSEILDGYAVIYSSGLAAFYAAMVHYNPKKIFIGQSYHGVRAITNILARN 120

Query: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180
           Y V++Y L DIEK+A +GDIVH+E+P+NP+GTS DI  LA RAH+KGALL+VDSTFA PP
Sbjct: 121 YDVKQYPLEDIEKYASEGDIVHLESPVNPYGTSYDIESLAHRAHTKGALLIVDSTFASPP 180

Query: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240
           LQ AW+FGAD++++SATKYF GHSDLLSGVLVVKD+ V+ +LK+DRIYLG+N+ANLES++
Sbjct: 181 LQYAWNFGADVVLYSATKYFGGHSDLLSGVLVVKDEAVSRQLKDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVE-LYHSSLQTEEFVKKQLSGGYT 299
           LLRSLRTY++RI +Q+ENATK+VK+L+DH+ ++  +++ +YHSSLQTEEFVKKQL GGY 
Sbjct: 241 LLRSLRTYEMRITKQSENATKLVKFLSDHQSEFDKVLKTIYHSSLQTEEFVKKQLVGGYG 300

Query: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359
           PVF++    +EQCK+    LK F HATSLGG+ESLVEWRAM D  IDQ L+RVS+GCESA
Sbjct: 301 PVFAIILHNKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 360

Query: 360 DDLINDLSTVLSQL 373
           +DLI DLS+ L +L
Sbjct: 361 EDLIKDLSSALKEL 374

>Kpol_1031.23 s1031 complement(55637..56776) [1140 bp, 379 aa] {ON}
           complement(55637..56776) [1140 nt, 380 aa]
          Length = 379

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 250/374 (66%), Positives = 302/374 (80%), Gaps = 1/374 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60
           MV+L TLL+H DD++NRVTDVAPPINV +TFRY+  +LIP  ++ ++ FLDE PVYSREG
Sbjct: 1   MVELSTLLIHADDKNNRVTDVAPPINVTTTFRYEEQDLIPIIEREDMSFLDERPVYSREG 60

Query: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120
           HPNG RLE LFS +LGGHA+ YS GL  +   ++ FNPKR+FM Q YHG   I  + +RN
Sbjct: 61  HPNGTRLETLFSEYLGGHAVIYSSGLSAYFAAIMSFNPKRIFMSQNYHGCIAIAEMFQRN 120

Query: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180
             V++Y L +IE++A+KGDIVH+E+P+NPFGTS DI   A+RAH+KGALL+VD TFAPPP
Sbjct: 121 GMVKKYTLDEIEQYAEKGDIVHLESPVNPFGTSYDIEAFAKRAHAKGALLLVDGTFAPPP 180

Query: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240
           LQN WDFGAD++MHSATKYF GHSDLL GVLVVKDK+    LKEDRI LG+NIANLESYL
Sbjct: 181 LQNVWDFGADIVMHSATKYFGGHSDLLGGVLVVKDKKRQELLKEDRINLGTNIANLESYL 240

Query: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKY-PALVELYHSSLQTEEFVKKQLSGGYT 299
           LLRSLRT+++RI +Q+EN TK+VKYL+++K KY   L ++ HSSLQ E+FVKKQL GGY 
Sbjct: 241 LLRSLRTFEMRIMKQSENVTKIVKYLDENKGKYGKVLRDITHSSLQKEDFVKKQLKGGYN 300

Query: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359
           PVFS+T  T EQCK F S LK FQHATSLGGVESLVEWRA+ D  IDQ LVRVS+GCESA
Sbjct: 301 PVFSITLNTVEQCKSFASQLKYFQHATSLGGVESLVEWRALSDPHIDQTLVRVSVGCESA 360

Query: 360 DDLINDLSTVLSQL 373
           DDLI DL++ L  L
Sbjct: 361 DDLIKDLASALQNL 374

>KAFR0E03860 Chr5 complement(766029..767165) [1137 bp, 378 aa] {ON}
           Anc_5.423 YHR112C
          Length = 378

 Score =  536 bits (1381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/374 (65%), Positives = 306/374 (81%), Gaps = 1/374 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60
           M  L T L+H DD+ NRV+DVAPPINV++T+RYD  +LIPWR++ NLDF+++ PVYSR  
Sbjct: 1   MTHLGTSLIHADDKDNRVSDVAPPINVSTTYRYDETDLIPWRERENLDFMEKKPVYSRLA 60

Query: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120
           HPN  RLE+LFS  L GHA+ YS G   F   MVH+NPK++FM QCYHG++ I  I+ RN
Sbjct: 61  HPNATRLESLFSEILEGHAVIYSSGCAAFYAAMVHYNPKKIFMGQCYHGLRAIANIMTRN 120

Query: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180
           YGVE+Y L DIEK+AQ+GDIV VE+P+NP+GTS+DI  +A +AHSKGA+++VDSTFAPPP
Sbjct: 121 YGVEQYTLDDIEKYAQEGDIVEVESPMNPYGTSIDIKSIAEKAHSKGAIVLVDSTFAPPP 180

Query: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240
           LQ AWD GAD+++HSATKYF GHSDLLSGV+VVKD+EV  KL++DRIYLG+N+ NLESY+
Sbjct: 181 LQYAWDLGADVVLHSATKYFGGHSDLLSGVIVVKDEEVCKKLRDDRIYLGTNVGNLESYM 240

Query: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKY-PALVELYHSSLQTEEFVKKQLSGGYT 299
           LLRSLR+Y+LRI +Q+ENATKVV++LN +K+++   L E+YHSSLQ E FVKKQL GGY 
Sbjct: 241 LLRSLRSYELRILKQSENATKVVEFLNLNKERFDKVLKEVYHSSLQKEAFVKKQLVGGYG 300

Query: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359
           PVFS++ +T +QCKKF   LK F HATSLGGVESLVEWRAM D  IDQ L+RVSIG E+A
Sbjct: 301 PVFSMSLQTIDQCKKFPGKLKYFHHATSLGGVESLVEWRAMTDPYIDQTLIRVSIGVENA 360

Query: 360 DDLINDLSTVLSQL 373
           DDLI DL T L +L
Sbjct: 361 DDLIKDLETALQEL 374

>Smik_8.190 Chr8 complement(310892..312154) [1263 bp, 420 aa] {ON}
           YHR112C (REAL)
          Length = 420

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/374 (64%), Positives = 311/374 (83%), Gaps = 1/374 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60
           MVDL T L+HGDD+ NRVTDVAPPINV++TFRYD+D+L+PW ++ NLDF+++ P+YSR  
Sbjct: 43  MVDLSTSLIHGDDKDNRVTDVAPPINVSTTFRYDDDDLVPWTERENLDFMEKKPIYSRLA 102

Query: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120
           HPN  RLE++FS  L G+A+ YS GL  F   MVH+NPKR+F+ Q YHGV+ I  IL RN
Sbjct: 103 HPNSTRLESIFSEILDGYAVIYSSGLAAFYAAMVHYNPKRIFIGQSYHGVRAIANILSRN 162

Query: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180
           Y +++Y L DIEK+A +GDIVH+ETP+NP+GTS DI  LA RAH+KGALL+VDSTFA PP
Sbjct: 163 YDIKQYPLEDIEKYASEGDIVHLETPVNPYGTSSDIESLAHRAHAKGALLIVDSTFASPP 222

Query: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240
           LQ  W+FGAD++++SATKYF GHSDLLSGVLVVK++E + +LK+DRIYLG+N+ANLES++
Sbjct: 223 LQYVWNFGADIVLYSATKYFGGHSDLLSGVLVVKEEETSRQLKDDRIYLGTNVANLESFM 282

Query: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKY-PALVELYHSSLQTEEFVKKQLSGGYT 299
           LLRSLRTY++RI +Q+ENATK+VK+L+DH+ ++   L ++YHSSLQ EEFVKKQL GGY 
Sbjct: 283 LLRSLRTYEMRITKQSENATKLVKFLSDHQSEFGKVLKKIYHSSLQREEFVKKQLVGGYG 342

Query: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359
           PVF++T +T+EQCK+    LK F HATSLGG+ESLVEWRAM D  IDQ L+RVS+GCESA
Sbjct: 343 PVFAITLQTKEQCKQLPLKLKYFHHATSLGGIESLVEWRAMTDPYIDQTLIRVSVGCESA 402

Query: 360 DDLINDLSTVLSQL 373
           +DLI DL++ L +L
Sbjct: 403 NDLIKDLASALKEL 416

>NDAI0B05590 Chr2 complement(1367293..1368435) [1143 bp, 380 aa]
           {ON} Anc_5.423
          Length = 380

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 236/374 (63%), Positives = 299/374 (79%), Gaps = 1/374 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60
           M  L T L+H DD+ NRV+DVAPPINV +TFRYDND+L+PW ++ NLDF+++ P+YSR  
Sbjct: 1   MAHLSTALIHSDDKDNRVSDVAPPINVTTTFRYDNDDLVPWTERENLDFMEKTPIYSRLA 60

Query: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120
           HPN  RLE++FS  L GHA+ YS GL  F   M+H+NPKR+F+ Q YHGV+ I  IL RN
Sbjct: 61  HPNSTRLESIFSEILDGHAVIYSSGLAAFFAAMIHYNPKRIFIGQSYHGVRAIANILTRN 120

Query: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180
           +  +++ L +IE+ AQ GDIVH+ETP+NPFGTSLD+ + A++AH KGALL+VDSTFAPPP
Sbjct: 121 FQTKQHTLDEIEQFAQPGDIVHLETPVNPFGTSLDLEDFAKKAHEKGALLLVDSTFAPPP 180

Query: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240
           LQN WDF  D+IMHSATKYF GHSDLLSGVLVVK++ VA +L++DRIYLG+N+ANLES++
Sbjct: 181 LQNVWDFNVDIIMHSATKYFGGHSDLLSGVLVVKEEAVARQLRDDRIYLGTNVANLESFM 240

Query: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKY-PALVELYHSSLQTEEFVKKQLSGGYT 299
           LLRSLRT+++R+ +Q+ENATK+V +L+ ++DKY   L  + HSSLQ E FVKKQL GGY 
Sbjct: 241 LLRSLRTFEMRMLKQSENATKIVSFLDSNRDKYDKVLKSITHSSLQKESFVKKQLKGGYG 300

Query: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359
           PVFS++   +EQCKKF   LK F HATSLGG+ESLVEWRAM D  I+Q L+RVSIGCE+A
Sbjct: 301 PVFSISLMNKEQCKKFPPMLKYFHHATSLGGIESLVEWRAMTDPYIEQTLIRVSIGCENA 360

Query: 360 DDLINDLSTVLSQL 373
           DDLI DL+  L  L
Sbjct: 361 DDLIQDLANALETL 374

>CAGL0I01276g Chr9 complement(104391..105533) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 380

 Score =  525 bits (1351), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 242/372 (65%), Positives = 298/372 (80%), Gaps = 1/372 (0%)

Query: 3   DLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHP 62
           DL T L+HGDD  NRV DVAPPINVA+TFRYD ++L+PW ++ +L+F+D  P+YSR GHP
Sbjct: 5   DLATTLIHGDDIKNRVPDVAPPINVATTFRYDENDLVPWNEREDLEFMDRTPIYSRLGHP 64

Query: 63  NGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRNYG 122
           N  RLE++FS  L GHA+ YS GL  F   M HFNPK++F+ Q YHGV GI  IL RNYG
Sbjct: 65  NATRLESIFSEILEGHAVIYSSGLAAFHAAMTHFNPKQLFIGQSYHGVHGIADILSRNYG 124

Query: 123 VERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQ 182
           + +  L DIE++AQKGDIVH+ETP+NPFGTS D+   A +AHS+GALLMVDSTFAPPPLQ
Sbjct: 125 LIQRSLDDIEEYAQKGDIVHIETPVNPFGTSYDLQSFADKAHSRGALLMVDSTFAPPPLQ 184

Query: 183 NAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLL 242
            AW+FGAD+IMHSATK+F GHSDLLSGVLV KD+EV+ +LK+DRIYLG+N+ANLES+LLL
Sbjct: 185 YAWNFGADIIMHSATKFFGGHSDLLSGVLVTKDEEVSKRLKDDRIYLGTNVANLESHLLL 244

Query: 243 RSLRTYDLRIRRQAENATKVVKYLNDHKDKYP-ALVELYHSSLQTEEFVKKQLSGGYTPV 301
           RSLRT+++RI +Q++N TK+V++L  ++DKY   L +++HSSLQ E FVKKQL GGYTPV
Sbjct: 245 RSLRTFEMRILKQSQNVTKIVEHLVSNRDKYSKVLRQVFHSSLQDESFVKKQLIGGYTPV 304

Query: 302 FSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESADD 361
           FS+T   +EQCK+    LK F HATSLGGVESL+EWRAM D  IDQ L+R SIGCESADD
Sbjct: 305 FSITLMNKEQCKQLPLKLKYFHHATSLGGVESLIEWRAMTDPYIDQTLIRFSIGCESADD 364

Query: 362 LINDLSTVLSQL 373
           LI DL     +L
Sbjct: 365 LIADLDAAFIEL 376

>CAGL0K05665g Chr11 complement(552804..553943) [1140 bp, 379 aa]
           {ON} highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112c
          Length = 379

 Score =  521 bits (1342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 238/374 (63%), Positives = 297/374 (79%), Gaps = 1/374 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60
           MV+L T L+H DD+HNRV+DVAPPINV++T+RY  ++LIPW  + N DF+DE PVYSREG
Sbjct: 1   MVELATKLIHDDDKHNRVSDVAPPINVSTTYRYAEEDLIPWAQRENFDFMDEAPVYSREG 60

Query: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120
           HPN  RLE +FS  L GHA+ Y+ GL  F   M+H+NPK+VF+ QCYHGV  I  +  RN
Sbjct: 61  HPNCTRLETIFSDILEGHAVLYASGLAAFFAAMMHYNPKQVFLGQCYHGVHCISDMFTRN 120

Query: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180
           + V++  L DI + A+KGD+VH+E+P+NPFGT +D+ +LA  AHSKGA++++DSTFAPPP
Sbjct: 121 FNVQQRTLEDIAEFAKKGDVVHLESPVNPFGTVIDVKKLADLAHSKGAIVIIDSTFAPPP 180

Query: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240
           LQ AWD GADMIMHSATKYF GHSDLL G+LV KDKE++  LKEDRI LGS I NLESYL
Sbjct: 181 LQYAWDLGADMIMHSATKYFGGHSDLLGGILVTKDKEISRALKEDRINLGSMIGNLESYL 240

Query: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYP-ALVELYHSSLQTEEFVKKQLSGGYT 299
           L+RSLRTY++RI +Q+EN  K+VKYLND+K+KYP  L ++YHSS+Q++ FVK QL GGY 
Sbjct: 241 LMRSLRTYEMRIMKQSENVVKIVKYLNDNKEKYPNVLGDIYHSSIQSDAFVKDQLVGGYN 300

Query: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359
            VFS   K+EEQCKKF   LK F HATSLGG+ESL+EWRA+ D  IDQ L+RVS+GCESA
Sbjct: 301 SVFSFCLKSEEQCKKFPDKLKYFHHATSLGGIESLIEWRALSDDKIDQKLMRVSVGCESA 360

Query: 360 DDLINDLSTVLSQL 373
            DLI+DLS  L +L
Sbjct: 361 KDLIDDLSQALQEL 374

>SAKL0G02222g Chr7 complement(186449..187585) [1137 bp, 378 aa] {ON}
           highly similar to uniprot|P38716 Saccharomyces
           cerevisiae YHR112C Hypothetical ORF
          Length = 378

 Score =  520 bits (1340), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 239/374 (63%), Positives = 297/374 (79%), Gaps = 1/374 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60
           MV L T L+H DD+ NRVTD+  PINVA+TFRYDN+NLI W D+ N DFL+  PVYSR  
Sbjct: 1   MVSLPTTLIHADDKDNRVTDIVSPINVATTFRYDNNNLIAWNDRENYDFLETTPVYSRLA 60

Query: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120
           HPN  RLE++FS  LGGHA+ YS GL  +   + H+NPK++F+ Q YHG  GI  I  RN
Sbjct: 61  HPNATRLESIFSEILGGHAVIYSSGLAAYFATLTHYNPKKLFIGQSYHGCHGIADIFTRN 120

Query: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180
            G+++Y L  IE+ A +GDIVH+ETP+NPFGTS DI + AR+AH+KGALL++DSTFAPPP
Sbjct: 121 NGMKQYPLDRIEELASEGDIVHLETPVNPFGTSYDIEDFARKAHAKGALLVIDSTFAPPP 180

Query: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240
           LQ+ W FGAD+++HS TKYF GHSDLLSGV+VVK  EVA K+K DRIYLG+NIANLESYL
Sbjct: 181 LQDVWKFGADVVIHSCTKYFGGHSDLLSGVVVVKSLEVAKKMKNDRIYLGTNIANLESYL 240

Query: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKY-PALVELYHSSLQTEEFVKKQLSGGYT 299
           LLRSLRT+++R+R+Q+ENAT +VKYL+DHK ++   L ++YHSSLQTE+FVKKQL GGY 
Sbjct: 241 LLRSLRTFEMRVRKQSENATALVKYLDDHKSEFNKVLDKIYHSSLQTEDFVKKQLEGGYG 300

Query: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359
           PVFS+  K++ QCKK    L+LFQHATSLGGVESLVEWRA+ D  I+Q L+RVS+GCE  
Sbjct: 301 PVFSIVLKSKVQCKKLPGKLELFQHATSLGGVESLVEWRALTDPYIEQTLIRVSVGCEGV 360

Query: 360 DDLINDLSTVLSQL 373
           +DLI DL+  L QL
Sbjct: 361 EDLIKDLAGALKQL 374

>TBLA0A03680 Chr1 complement(919740..920894) [1155 bp, 384 aa] {ON}
           Anc_5.423 YHR112C
          Length = 384

 Score =  505 bits (1301), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 230/370 (62%), Positives = 294/370 (79%), Gaps = 1/370 (0%)

Query: 3   DLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHP 62
           DLETLL+HGDD +NRVTDVAPPIN+A+TFRYDN++LIPW ++ +L F++  P+YSR  HP
Sbjct: 8   DLETLLIHGDDVNNRVTDVAPPINIATTFRYDNEDLIPWNERGDLSFMETKPIYSRLAHP 67

Query: 63  NGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRNYG 122
           N  RLE LFS+ L G+A+ Y+ G+  F   M +FNPKRVF+ Q YHG    V IL+RN  
Sbjct: 68  NSSRLETLFSKILDGNAVIYNSGVSAFFAAMTYFNPKRVFLGQNYHGCTAAVNILERNGT 127

Query: 123 VERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQ 182
           ++++   +IE+ AQKGDIVH+E+P+NP+GTS DI E  ++AHSKG L+M+DSTFAPPPLQ
Sbjct: 128 LKKHTHKEIEEFAQKGDIVHLESPVNPYGTSYDIEEFVKKAHSKGVLVMIDSTFAPPPLQ 187

Query: 183 NAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLL 242
             WDF  D++MHSATK+F GHSDLLSGVLVVKD+ +A  L+EDRIYLG+NIANLESYLLL
Sbjct: 188 YVWDFDVDIVMHSATKFFGGHSDLLSGVLVVKDENIAKDLREDRIYLGTNIANLESYLLL 247

Query: 243 RSLRTYDLRIRRQAENATKVVKYLNDHKDKY-PALVELYHSSLQTEEFVKKQLSGGYTPV 301
           RSLRT+++RI +Q+ +AT++VK+LND++ K+   L E+YHSSLQ E+FVKKQL GGYTPV
Sbjct: 248 RSLRTFEMRILKQSTSATQIVKFLNDNRHKFNKVLKEIYHSSLQKEDFVKKQLKGGYTPV 307

Query: 302 FSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESADD 361
           FS+    +EQCK   + LK F HATSLGGVESL+EWRA+ D  I Q L+RVS+GCE+  D
Sbjct: 308 FSIVLHNKEQCKALPNLLKYFIHATSLGGVESLIEWRALTDPYIIQTLIRVSVGCENTQD 367

Query: 362 LINDLSTVLS 371
           LINDL   L+
Sbjct: 368 LINDLDQALT 377

>KNAG0C04990 Chr3 (960378..961520) [1143 bp, 380 aa] {ON} Anc_5.423
           YHR112C
          Length = 380

 Score =  497 bits (1279), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 229/376 (60%), Positives = 297/376 (78%), Gaps = 3/376 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60
           M  L T L+H DD  NRV DVAPPINV++T+RYD D+L+PWRD+ +L+F+D+ P+YSR  
Sbjct: 1   MEHLATTLIHADDRDNRVPDVAPPINVSTTYRYDKDDLVPWRDRESLEFMDKRPIYSRLA 60

Query: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120
           HPN  RLE+LFS+ LGGHA+ Y+ GL  F   ++H+NPKR+F+DQ YHG + I  IL R 
Sbjct: 61  HPNSTRLESLFSQILGGHAVVYNSGLAAFFAALIHYNPKRLFIDQSYHGCRAIAHILTRT 120

Query: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGT-SLDISELARRAHSKGALLMVDSTFAPP 179
            G+++  L D+ + AQ GD+VH+E+P+NP GT   D+S LA +AH +GA+L+VDSTFAPP
Sbjct: 121 TGMQQCSLDDVPQMAQPGDVVHLESPVNPLGTVPRDMSLLAEQAHERGAVLIVDSTFAPP 180

Query: 180 PLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESY 239
           PLQ+ W FG DM+MHSATKYF GHSDLLSGVLV +D++ A  L++DRIYLG+N+ANLE+Y
Sbjct: 181 PLQDPWRFGCDMVMHSATKYFGGHSDLLSGVLVTRDQQTAGALRDDRIYLGTNVANLEAY 240

Query: 240 LLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVE-LYHSSLQT-EEFVKKQLSGG 297
           LLLRSLRT++LRI+RQ+ N T VV YLNDH+  +P +++ LYHSSLQT E +V +QL GG
Sbjct: 241 LLLRSLRTFELRIQRQSTNCTAVVAYLNDHRGDWPLVLDKLYHSSLQTGEPWVAEQLEGG 300

Query: 298 YTPVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCE 357
           + PVF+LT ++ +QCK+F   L  FQHATSLGGVESLVEWRAM D  IDQ LVRVS+GCE
Sbjct: 301 HPPVFALTLRSIDQCKRFPQLLHYFQHATSLGGVESLVEWRAMTDPHIDQTLVRVSVGCE 360

Query: 358 SADDLINDLSTVLSQL 373
           +A+DLI DL+T L+ L
Sbjct: 361 NAEDLIADLTTALNAL 376

>NDAI0F00140 Chr6 (15124..16260) [1137 bp, 378 aa] {ON} 
          Length = 378

 Score =  496 bits (1277), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 236/375 (62%), Positives = 293/375 (78%), Gaps = 2/375 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPN-LDFLDENPVYSRE 59
           M  L T L+HGDD+ NRVTDVAPPINV++TFR+DN+NLIP  +  + L  +DENPVY+RE
Sbjct: 1   MAHLSTALIHGDDKLNRVTDVAPPINVSTTFRFDNNNLIPANEVKDFLQSIDENPVYARE 60

Query: 60  GHPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKR 119
            HPN  R++A+ S  LGGHA+ Y+ G   F  +M H+NPKR FMD  Y GV  I  ++ R
Sbjct: 61  SHPNSSRVQAVLSDLLGGHAVIYNSGCSAFHALMCHYNPKRFFMDGGYFGVHAIADLITR 120

Query: 120 NYGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPP 179
           NYG+E++ L +IE+ AQ GDIVH+ETP+NPFGTS DI  LA+R H KGA+L +D+T APP
Sbjct: 121 NYGLEQHSLDEIEEFAQAGDIVHLETPLNPFGTSSDIEALAKRVHDKGAILSIDATLAPP 180

Query: 180 PLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESY 239
           PLQ+AW FGAD+I+HSATKYF GHSDLL+GVLVVK KE A +L EDRI+LG+NI NLESY
Sbjct: 181 PLQDAWKFGADIILHSATKYFGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESY 240

Query: 240 LLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKY-PALVELYHSSLQTEEFVKKQLSGGY 298
           LLLRSLRTY++RI +Q  N  KV+ YLN++K K+   L ++YHSSLQ ++FV+KQLSG Y
Sbjct: 241 LLLRSLRTYEMRIMKQENNTRKVITYLNENKSKFNKVLNKIYHSSLQDDDFVQKQLSGLY 300

Query: 299 TPVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCES 358
            PVF++T  + +QCK+    LK FQHATSLGGVESL+EWRAM DSDIDQCL+RVSIGCE+
Sbjct: 301 CPVFAITLHSIDQCKELPLYLKYFQHATSLGGVESLIEWRAMSDSDIDQCLIRVSIGCEN 360

Query: 359 ADDLINDLSTVLSQL 373
           ADDLI DL   L  L
Sbjct: 361 ADDLIKDLENALQIL 375

>TBLA0B03020 Chr2 complement(700483..701622) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  489 bits (1259), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 227/372 (61%), Positives = 291/372 (78%), Gaps = 2/372 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPN-LDFLDENPVYSRE 59
           MV L T L+H DD++NRVTDVAPPINV+STFRYDN+NLIP  +  + L  ++++PVYSRE
Sbjct: 1   MVHLATTLIHSDDKNNRVTDVAPPINVSSTFRYDNNNLIPANEVDDFLASIEQSPVYSRE 60

Query: 60  GHPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKR 119
            HPN  R++++ S  LGGHA+ Y+ G   F  VM H+NPKR FMD  Y GV  I  ++ R
Sbjct: 61  SHPNSSRVQSILSDLLGGHAVIYNSGCSAFHAVMCHYNPKRFFMDGGYFGVHAIADLITR 120

Query: 120 NYGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPP 179
           NYG+E++ L +IE+ AQ GD+VH+E+P+NPFGT+ DI  LA R HSKGA+L +DST APP
Sbjct: 121 NYGLEQHSLDEIEEFAQPGDLVHLESPLNPFGTASDIKALADRVHSKGAILSIDSTLAPP 180

Query: 180 PLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESY 239
           PLQN W+FGAD+++HSATKYF GHSDLL+GVL VK KE A++L EDRI+LG+NI NLESY
Sbjct: 181 PLQNVWNFGADIVLHSATKYFGGHSDLLAGVLAVKTKEQANELIEDRIHLGTNIGNLESY 240

Query: 240 LLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYP-ALVELYHSSLQTEEFVKKQLSGGY 298
           LLLRSLRTY++RI +Q++NATK+VKYL++HK+    +L E++H+SLQ E F+ KQLSGG+
Sbjct: 241 LLLRSLRTYEMRIMKQSDNATKIVKYLHNHKESLKGSLKEIFHTSLQNESFINKQLSGGH 300

Query: 299 TPVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCES 358
             VFS+   +  QCKK    LK FQHATSLGG+ESL+EWRAM D  IDQCL+RVS+GCE+
Sbjct: 301 GAVFSIILNSINQCKKLPLHLKYFQHATSLGGIESLIEWRAMSDDKIDQCLIRVSVGCEN 360

Query: 359 ADDLINDLSTVL 370
            +DLI DL   L
Sbjct: 361 VEDLIKDLENAL 372

>TDEL0G04970 Chr7 complement(925785..926930) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  476 bits (1226), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 223/375 (59%), Positives = 284/375 (75%), Gaps = 2/375 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPN-LDFLDENPVYSRE 59
           M  L T  +H DD HNRV+DVAPPINV +TFR+DNDNLIP  +  N ++ ++E+PVY+RE
Sbjct: 1   MTHLSTTSIHADDIHNRVSDVAPPINVTTTFRFDNDNLIPEAELENFIEAIEESPVYARE 60

Query: 60  GHPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKR 119
            HPN +R++++ S  LGGHA  Y+ G   F  +M   NPKRVFMD  Y GV+ I  ++K 
Sbjct: 61  THPNSIRVQSILSSILGGHAAVYNSGCSAFHALMFRLNPKRVFMDDAYGGVETIASLIKE 120

Query: 120 NYGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPP 179
            YG++ + L  IE+ A+KGD+VH+ETP+NPFG   +I  LA R H KGALL VDST APP
Sbjct: 121 KYGLKIFKLDQIEEFAEKGDLVHLETPLNPFGICTNIVALAERVHKKGALLSVDSTLAPP 180

Query: 180 PLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESY 239
           PLQNAWDFGAD++MHSATKY  GHSDLL+GVLVVKD E    L ++RIYLG+N+ NLES+
Sbjct: 181 PLQNAWDFGADIVMHSATKYLGGHSDLLAGVLVVKDVETQRALIKERIYLGTNLGNLESF 240

Query: 240 LLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALV-ELYHSSLQTEEFVKKQLSGGY 298
           LLLRSLRT+++R+ +Q+ENA KVV +L+++  KYP ++ +LYHSSLQ EEFV+KQL+GG+
Sbjct: 241 LLLRSLRTFEMRVTKQSENALKVVTFLHENSAKYPKVLDQLYHSSLQKEEFVQKQLAGGH 300

Query: 299 TPVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCES 358
             VFS+  K+ EQ KK  + L  FQHATSLGGVESL+EWRAM DS ID CLVR+S+GCE+
Sbjct: 301 GAVFSMILKSVEQAKKLPTKLVYFQHATSLGGVESLIEWRAMSDSTIDPCLVRLSVGCEN 360

Query: 359 ADDLINDLSTVLSQL 373
            DDLI DL   L  L
Sbjct: 361 VDDLIQDLDQGLQAL 375

>KLLA0E21319g Chr5 (1904841..1905983) [1143 bp, 380 aa] {ON} highly
           similar to uniprot|P38716 Saccharomyces cerevisiae
           YHR112C Hypothetical ORF
          Length = 380

 Score =  472 bits (1214), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 216/375 (57%), Positives = 288/375 (76%), Gaps = 3/375 (0%)

Query: 2   VDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGH 61
           + L T L+H DD+HNRVTD+  PINVA+TFRY+  +LIPW ++ +   L++ P+YSR  H
Sbjct: 1   MSLSTELVHADDKHNRVTDIVSPINVATTFRYEEVDLIPWNEREDFSVLEKKPIYSRLAH 60

Query: 62  PNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRNY 121
           PN +R+E++ S+ L G A+ Y+ GL  +  ++ ++NPKR+F+ + YHG + I  I  RN+
Sbjct: 61  PNSLRVESVLSKVLEGEAVVYANGLAAYFAMLTYYNPKRLFIGEGYHGCRSIADIHTRNW 120

Query: 122 GVERYGLA--DIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPP 179
            +E++ L   +I +HA KGD+VH+ETP+NP+GTS DI   A   HSKGA+L++DSTFAPP
Sbjct: 121 NLEQHKLEIDEILQHAGKGDVVHIETPVNPYGTSFDIKAFADATHSKGAILVIDSTFAPP 180

Query: 180 PLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESY 239
           PLQN WDFG D+I+HSATKYF GHSDLL+GVL VKDKEVASKL+ DRIYLG+NIANLE++
Sbjct: 181 PLQNPWDFGVDVILHSATKYFGGHSDLLAGVLAVKDKEVASKLRTDRIYLGTNIANLEAF 240

Query: 240 LLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVE-LYHSSLQTEEFVKKQLSGGY 298
           LLLRSLRT+++RI+ Q+ENATK+V YL +HK  +  ++E ++HSSLQTE FVK+QL GGY
Sbjct: 241 LLLRSLRTFEMRIQTQSENATKLVSYLIEHKSDFEGVLEGVFHSSLQTEPFVKEQLKGGY 300

Query: 299 TPVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCES 358
            PVF++T  ++EQC+KF   L  FQHATSLGGVESLVEWRA+ D  I   L+RVS+G E+
Sbjct: 301 GPVFAVTLNSKEQCRKFPQLLTCFQHATSLGGVESLVEWRALTDPYIIPTLIRVSVGVEN 360

Query: 359 ADDLINDLSTVLSQL 373
            DDLI D +  L  L
Sbjct: 361 VDDLIKDFANALKTL 375

>KNAG0F01580 Chr6 complement(282872..284011) [1140 bp, 379 aa] {ON} 
          Length = 379

 Score =  469 bits (1206), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 216/373 (57%), Positives = 282/373 (75%), Gaps = 1/373 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60
           M    T  +H DD++NRV DVAPPINV+ T+RYDNDNL    ++  L+ +D  PVYSR  
Sbjct: 1   MTHFATSAIHADDQNNRVPDVAPPINVSVTYRYDNDNLKICDEKECLEEMDSVPVYSRTA 60

Query: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120
           HPN  RLE++ S  L GHA+ Y+ G   F   +VH+NPKR+F+++ Y G+  I  I+ RN
Sbjct: 61  HPNCTRLESVLSSILNGHAVVYNSGCSAFYAALVHYNPKRLFIEESYDGMHAIADIMTRN 120

Query: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180
           YG++++   +IEK+AQ GDIVH+E+P+NP+G S DI  LA RAH+KGALLMVDST APPP
Sbjct: 121 YGMQQHTFDNIEKYAQVGDIVHLESPLNPYGISSDIQALADRAHAKGALLMVDSTLAPPP 180

Query: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240
           LQN WDFG D+IMHSATKYF GHSDLL+G+LV KDK+V+ +LK DRIYLG+   NLES+L
Sbjct: 181 LQNTWDFGPDIIMHSATKYFGGHSDLLAGILVTKDKDVSIQLKGDRIYLGTIPGNLESFL 240

Query: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKY-PALVELYHSSLQTEEFVKKQLSGGYT 299
           LLRSLRT ++R+ +Q+ENATK+V+YL D+K+ +   L E+YHSSLQ E FV  Q+SGGYT
Sbjct: 241 LLRSLRTMEMRVLKQSENATKIVQYLVDNKETFDKVLGEIYHSSLQDEPFVAAQMSGGYT 300

Query: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359
           P+FS   +T +Q K F   LK+FQHATSLGG+ESL+EWR + + ++DQ L+R+S+GCE+ 
Sbjct: 301 PLFSFKLQTIDQAKHFPEKLKIFQHATSLGGIESLIEWRVLSEPELDQTLLRISVGCENV 360

Query: 360 DDLINDLSTVLSQ 372
           DDLI DL   L Q
Sbjct: 361 DDLIADLQNALQQ 373

>TDEL0G00140 Chr7 complement(20315..21460) [1146 bp, 381 aa] {ON} 
          Length = 381

 Score =  468 bits (1203), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 215/375 (57%), Positives = 287/375 (76%), Gaps = 2/375 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPN-LDFLDENPVYSRE 59
           M  L T  +H DD HNRVTDVAPPINV++TFRYDN+NL+P  +  N ++ +++ PVYSRE
Sbjct: 1   MTHLSTACIHADDIHNRVTDVAPPINVSTTFRYDNENLVPEVEIENFIETIEQTPVYSRE 60

Query: 60  GHPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKR 119
            HPN +RL+ + S  LGGHA  Y+ G+  F  ++ H+NPKR FMD  Y GV+GI  + + 
Sbjct: 61  SHPNSLRLQTVLSDILGGHATVYNSGVSAFHALIFHYNPKRFFMDDGYSGVRGIATLYQE 120

Query: 120 NYGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPP 179
            +G+E Y L  IE+ A+KGD++H+E P+NP+GT  DI+ LA+R H KGA+L +DST APP
Sbjct: 121 KHGLETYKLHQIEEFAEKGDLIHLEVPLNPYGTCRDIAALAKRVHKKGAILSIDSTLAPP 180

Query: 180 PLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESY 239
           PLQ+AWDFGAD++MHSATKY  GHSDLL+GV+VVK  E   KL  +RI+LG+N+ NLES+
Sbjct: 181 PLQDAWDFGADVVMHSATKYLGGHSDLLAGVVVVKTMEQQRKLIRERIFLGTNVGNLESF 240

Query: 240 LLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALV-ELYHSSLQTEEFVKKQLSGGY 298
           LLLRSLRT+++R+ +Q+ENA K+V +L+++K KY  ++ E+YHSSLQ E FV++QL+GG+
Sbjct: 241 LLLRSLRTFEMRVLKQSENAAKIVSFLHENKAKYSKVLNEVYHSSLQKEAFVQRQLAGGH 300

Query: 299 TPVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCES 358
             VFS+T ++ EQCKK  + L  FQHATSLGGVESL+EWRA+ D+ ID  LVR+SIGCE+
Sbjct: 301 GAVFSVTLRSVEQCKKLPAKLVYFQHATSLGGVESLIEWRALSDTKIDPFLVRLSIGCEN 360

Query: 359 ADDLINDLSTVLSQL 373
           ADDLI DL   L  L
Sbjct: 361 ADDLIQDLDNALQVL 375

>TPHA0A06070 Chr1 complement(1370008..1371129) [1122 bp, 373 aa]
           {ON}  YFR055W
          Length = 373

 Score =  459 bits (1180), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 207/359 (57%), Positives = 281/359 (78%), Gaps = 2/359 (0%)

Query: 17  RVTDVAPPINVASTFRYDNDNLIPWRDQPN-LDFLDENPVYSREGHPNGVRLEALFSRFL 75
           +++D+APPINV++T+RYD  NLIP  +  + L  ++ENPVYSRE H N  R++ + S+ L
Sbjct: 8   KISDIAPPINVSTTYRYDEHNLIPAAEVKDFLSSIEENPVYSRESHANSSRVQKVLSKVL 67

Query: 76  GGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRNYGVERYGLADIEKHA 135
            GHA+ Y+ G   F  +M H+NPKR+F D+ Y G++ I  ++ RNYG+++Y L DI+K A
Sbjct: 68  NGHAVIYNSGCSAFHALMCHYNPKRIFFDESYFGIKAIANLITRNYGLKQYSLKDIDKFA 127

Query: 136 QKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHS 195
           Q+GDI+H+ETP+NPFGT+++I E+A +AH+K ALL VDST APPPLQNA+DFGAD+++HS
Sbjct: 128 QEGDIIHIETPLNPFGTAINIKEIAVKAHAKKALLSVDSTLAPPPLQNAFDFGADIVLHS 187

Query: 196 ATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQ 255
           ATKY  GHSDLL+GVLVVK ++ A  L EDRI+LG+NI NLES+LLLRSLRTY++R+  Q
Sbjct: 188 ATKYLGGHSDLLAGVLVVKTEKEARALIEDRIHLGTNIGNLESFLLLRSLRTYEMRLSTQ 247

Query: 256 AENATKVVKYLNDHKDKYPALVE-LYHSSLQTEEFVKKQLSGGYTPVFSLTFKTEEQCKK 314
           ++N  K+V +L  ++ +Y  +++ +YHSSLQ E FV +QLS G+T VF++ FK++EQCK 
Sbjct: 248 SQNVVKIVNFLETNRCQYKNVIQHIYHSSLQKEVFVSEQLSKGHTAVFAVIFKSQEQCKN 307

Query: 315 FCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESADDLINDLSTVLSQL 373
           F   LK FQHATSLGGVESLVEWRAM D DID CL+R SIGCE+A+DLI DL + L +L
Sbjct: 308 FVQYLKYFQHATSLGGVESLVEWRAMSDPDIDPCLIRFSIGCENAEDLIEDLKSALCRL 366

>Ecym_5523 Chr5 complement(1060537..1061682) [1146 bp, 381 aa] {ON}
           similar to Ashbya gossypii AER250C
          Length = 381

 Score =  449 bits (1155), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 213/375 (56%), Positives = 276/375 (73%), Gaps = 2/375 (0%)

Query: 1   MVDLETLLLHGDDE-HNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSRE 59
           M  L TLL+H DD   + VTDVAPPINV++TFRYDNDNL+      +    +  PVYSRE
Sbjct: 1   MAGLSTLLIHADDGVSDHVTDVAPPINVSTTFRYDNDNLVLPEGDCDGYATEGAPVYSRE 60

Query: 60  GHPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKR 119
           GHPN  R  ++ S  L G+A+ Y+ GL  F   + H+NPKR+F+ Q YHG   +  I  R
Sbjct: 61  GHPNSNRCGSILSHALNGYAVAYNSGLSAFGAALTHYNPKRLFIGQSYHGCHKLADIWVR 120

Query: 120 NYGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPP 179
           NYG+ + GL +IE+ AQ GD+VH+E+P+NP+GT++DI E   + H KGA++M+DSTFAPP
Sbjct: 121 NYGLLKLGLDEIEERAQPGDMVHIESPMNPYGTAVDIEEYVSKGHKKGAIVMIDSTFAPP 180

Query: 180 PLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESY 239
           PLQNAW+FG D++MHS TKY  GHSDLL GVLVVKDK V  +L  DRIYLG+NIANL+SY
Sbjct: 181 PLQNAWEFGVDILMHSCTKYLGGHSDLLGGVLVVKDKAVFRQLVADRIYLGTNIANLDSY 240

Query: 240 LLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYP-ALVELYHSSLQTEEFVKKQLSGGY 298
           LL+RSLRT +LR+ +Q++ ATK+V YL  H  ++   L E+ H+SLQ EEFVKKQL+GG+
Sbjct: 241 LLIRSLRTLELRVMKQSDTATKLVAYLKQHISEFSDVLSEIRHTSLQQEEFVKKQLAGGH 300

Query: 299 TPVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCES 358
           TPVFS+  KT +QC++    LK F HATS GGVESL+EWRA+ D +I++ LVRVS+GCE 
Sbjct: 301 TPVFSIMLKTVDQCRELPKKLKFFHHATSFGGVESLIEWRALSDPEIEKTLVRVSVGCED 360

Query: 359 ADDLINDLSTVLSQL 373
            +DLINDL+  L  L
Sbjct: 361 HNDLINDLANALRYL 375

>NDAI0B00595 Chr2 (131225..132361) [1137 bp, 378 aa] {ON}
          Length = 378

 Score =  449 bits (1154), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 221/375 (58%), Positives = 284/375 (75%), Gaps = 2/375 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPN-LDFLDENPVYSRE 59
           MV L T L+HGDD+ NRVT VAPPINV++TFR+D++NLIP  +  + L  +DENPVY++E
Sbjct: 1   MVHLSTTLIHGDDKLNRVTYVAPPINVSTTFRFDSNNLIPANEVKDFLQSIDENPVYAKE 60

Query: 60  GHPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKR 119
            +PN  R++A+ S  LGGHA+ Y+ G   F  +M H+NPKR FMD  Y GV  I  +L R
Sbjct: 61  SYPNSSRVQAVLSDLLGGHAVIYNSGCSFFHALMCHYNPKRFFMDGGYFGVHAIADLLTR 120

Query: 120 NYGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPP 179
           NYG+E+  L +IE+ AQ GDIVH+ETP+NPFGTS D+  L  R H+KGA+L +D+T A P
Sbjct: 121 NYGLEQQFLDEIEEFAQAGDIVHLETPLNPFGTSSDMEALGERVHTKGAILSIDATLASP 180

Query: 180 PLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESY 239
           PLQ+AW FGAD+I+HSATKY  GHSDLL+GVLVVK KE A +L EDRI+LG+NI NLESY
Sbjct: 181 PLQDAWKFGADIILHSATKYSGGHSDLLAGVLVVKTKEQAYELIEDRIHLGTNIGNLESY 240

Query: 240 LLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALV-ELYHSSLQTEEFVKKQLSGGY 298
           LLLR L TY++RI +Q +N  KV+ YLN++K K+  +V ++YHSS Q ++F++KQLSG Y
Sbjct: 241 LLLRLLSTYEMRIMKQEKNTRKVIIYLNENKSKFNKVVNKIYHSSSQDDDFIQKQLSGLY 300

Query: 299 TPVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCES 358
            PVF++T  + +QCK+    LK FQHATSLG  ESL+EWRA+ D DIDQCL+ VSIGCE+
Sbjct: 301 CPVFAITLHSIDQCKELPLHLKYFQHATSLGAAESLIEWRAVSDVDIDQCLIGVSIGCEN 360

Query: 359 ADDLINDLSTVLSQL 373
           ADDLI DL   L  L
Sbjct: 361 ADDLIKDLENALQIL 375

>AER250C Chr5 complement(1098456..1099580) [1125 bp, 374 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR112C
          Length = 374

 Score =  436 bits (1122), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 201/374 (53%), Positives = 274/374 (73%), Gaps = 1/374 (0%)

Query: 1   MVDLETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREG 60
           MV+L T L+H DD  NRV DVAPPINV +TFRY  D+LIP  ++           YSR  
Sbjct: 1   MVELCTSLIHADDNSNRVNDVAPPINVTTTFRYSEDDLIPAVERTADTAGSNGHFYSRVS 60

Query: 61  HPNGVRLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRN 120
           HPNG R E L +  LGG A+ YS GL  F   + HFNPKR+F+ + YHG  G+  I  RN
Sbjct: 61  HPNGARCEVLLAEALGGEAVVYSSGLAAFGAALTHFNPKRLFIGRGYHGCHGVADIWVRN 120

Query: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPP 180
           +G+++  L ++ + ++ GD+VH+E+PINP+GT +D++ +A  AH KGA +++D+TFAPPP
Sbjct: 121 HGLQKLSLEEVSERSEPGDLVHIESPINPYGTLVDVAGIAAAAHEKGAYVVLDATFAPPP 180

Query: 181 LQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL 240
           LQ+ W+ GAD+++HS TKYF GHSDLL GV  V+D  VA +L++DR+YLG+NIANLE+YL
Sbjct: 181 LQDRWEQGADVVVHSCTKYFGGHSDLLGGVHAVRDAAVARQLRQDRVYLGTNIANLEAYL 240

Query: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPA-LVELYHSSLQTEEFVKKQLSGGYT 299
           L+RS+RT ++R+ RQ+ +ATKVV YL  HK ++   LV+++HSSLQTE +V++ L GG  
Sbjct: 241 LIRSMRTMEMRVVRQSTSATKVVAYLESHKAEFGGVLVKVFHSSLQTEPYVQQYLRGGNA 300

Query: 300 PVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESA 359
           PVFS+  +T EQCK+  S LKLF HATSLGGVESL+EWRAM D+ ++Q L+R+S+GCES 
Sbjct: 301 PVFSILLRTVEQCKRLPSLLKLFHHATSLGGVESLIEWRAMSDTTVEQNLLRISVGCESP 360

Query: 360 DDLINDLSTVLSQL 373
           +DLI DL+    QL
Sbjct: 361 EDLIADLAGAFRQL 374

>Kwal_55.22221 s55 (1160724..1161866) [1143 bp, 380 aa] {ON} YHR112C
           - Hypothetical ORF [contig 697] FULL
          Length = 380

 Score =  436 bits (1121), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 197/366 (53%), Positives = 273/366 (74%), Gaps = 1/366 (0%)

Query: 9   LHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPNGVRLE 68
           +H DD  NRV+DVAPPINV++TFRYDN++L+P   +  +   D   +YSR GHPN  RLE
Sbjct: 9   IHSDDYLNRVSDVAPPINVSTTFRYDNEHLVPATRETGMHTSDSPMIYSRLGHPNADRLE 68

Query: 69  ALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRNYGVERYGL 128
           A+ S+ L  HA+ Y+ GL  +  ++VHF PKR+F+  CYHG + +  I+ R  G+E   L
Sbjct: 69  AVLSQLLDSHAVVYASGLAAYHAILVHFKPKRLFLPHCYHGCKEVARIISRLNGMEILSL 128

Query: 129 ADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFG 188
            DIE   Q+GD+VH+E PINPFG ++D+++ A R HS G L+M+DST  PPPL+NAWD+G
Sbjct: 129 EDIEAKCQEGDLVHIEDPINPFGETVDLAQYASRIHSAGGLMMLDSTLGPPPLRNAWDYG 188

Query: 189 ADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRSLRTY 248
           AD+IMHS TKYF GHSDLLSG++ V D+ +A +LK DR YLG+  A+LES+LLLRSLRT 
Sbjct: 189 ADIIMHSGTKYFGGHSDLLSGIVCVSDEAIAEQLKNDRTYLGTIPASLESFLLLRSLRTM 248

Query: 249 DLRIRRQAENATKVVKYLNDHKDKYPALV-ELYHSSLQTEEFVKKQLSGGYTPVFSLTFK 307
           D+R+RRQ++N T++V YL ++ +K+ ++V E+ H+SLQTE FVK+Q+ GG+ PVF+L  K
Sbjct: 249 DIRVRRQSQNCTELVSYLANNSEKFSSVVQEIRHASLQTEAFVKQQMPGGFGPVFALILK 308

Query: 308 TEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESADDLINDLS 367
           +E+QC+K   ++  FQHATSLGGVESL+EWRAM D    + L+RVS+G E+ +DLI DL+
Sbjct: 309 SEDQCRKVVKNVSFFQHATSLGGVESLIEWRAMSDPTALKTLIRVSVGLENIEDLIADLA 368

Query: 368 TVLSQL 373
             L ++
Sbjct: 369 GSLEKI 374

>KLTH0E16566g Chr5 (1468783..1469928) [1146 bp, 381 aa] {ON} similar
           to uniprot|P38716 Saccharomyces cerevisiae YHR112C
           Hypothetical ORF
          Length = 381

 Score =  414 bits (1063), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 192/369 (52%), Positives = 264/369 (71%), Gaps = 1/369 (0%)

Query: 6   TLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPNGV 65
           T  +HGDD  NRV+DVAPPINV++TFRYD+++L P          D   +YSR GHPN  
Sbjct: 6   TATIHGDDRLNRVSDVAPPINVSTTFRYDDEHLEPATISTGTHTSDSPMIYSRLGHPNAD 65

Query: 66  RLEALFSRFLGGHAICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRNYGVER 125
           RLE + +  L G  + Y+ GL  +  +++H NPKR+F   CYHG + +  I+ R  G+E 
Sbjct: 66  RLEVVLTEILDGPTVVYASGLAAYHAILIHVNPKRLFQPHCYHGCEAVAKIISRISGMEI 125

Query: 126 YGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAW 185
             L ++E   Q GD+VH+E P NP+G  +++ E A + H  GAL++VDST APPPL+N W
Sbjct: 126 LPLENLEDKCQSGDLVHLEDPGNPYGEVVNLDEFAEKIHRAGALMLVDSTLAPPPLRNTW 185

Query: 186 DFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRSL 245
           +FGAD++MHS TKYF GHSDLLSG++ V+D++VA +L+ DR YLG+  A+LESYLLLRSL
Sbjct: 186 EFGADIVMHSGTKYFGGHSDLLSGIVSVRDEKVAQQLRNDRTYLGTIPASLESYLLLRSL 245

Query: 246 RTYDLRIRRQAENATKVVKYLNDHKDKYPALV-ELYHSSLQTEEFVKKQLSGGYTPVFSL 304
           RT ++R+ +Q+ N T++V+YL  HKD+Y ++V ++ H+SLQ EEFVKKQL GGY PVFSL
Sbjct: 246 RTMEIRVLKQSSNCTRLVEYLASHKDRYNSVVKDIRHASLQKEEFVKKQLPGGYGPVFSL 305

Query: 305 TFKTEEQCKKFCSSLKLFQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESADDLIN 364
              ++EQCK    +  LFQHATSLGG ESL+EWRAM D   ++ L+RVS+G E+A+DLI 
Sbjct: 306 LLFSQEQCKLLVKNTVLFQHATSLGGAESLIEWRAMSDPFANRNLIRVSVGLENAEDLIE 365

Query: 365 DLSTVLSQL 373
           DL+  L ++
Sbjct: 366 DLAGTLEKI 374

>Kpol_1044.10 s1044 (19232..20407) [1176 bp, 391 aa] {ON}
           (19232..20407) [1176 nt, 392 aa]
          Length = 391

 Score =  147 bits (371), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 119/383 (31%), Positives = 194/383 (50%), Gaps = 55/383 (14%)

Query: 21  VAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPNGVRLE-ALFSRFLGGHA 79
           V  PI++++TF+           QP  ++      YSR  +PN   LE A+ +   G + 
Sbjct: 26  VIEPISLSTTFKQSAP------AQPIGEY-----EYSRSQNPNRKNLEDAIAALENGKYG 74

Query: 80  ICYSCGLGGFLGVMVHFNPK---RVFMDQCYHGVQGIVGILKRNYGVERYGLADIEKH-- 134
           + +S G      V++   P+    V +   Y G       +   +GVE     ++ +   
Sbjct: 75  LAFSSG-SATTSVILQSLPQGSHAVSIGDVYGGTHRYFTKVANTHGVETTFTNNLVEELP 133

Query: 135 ---AQKGDIVHVETPINPFGTSLDISELARRAHS--KGALLMVDSTFAPPPLQNAWDFGA 189
               +   +V +E+P NP     DI  +++   S  K  +L+VD+TF  P L N  +FGA
Sbjct: 134 QLIKENTRLVWIESPTNPTLKVTDIGLVSQTIKSLKKDIILVVDNTFLSPYLSNPLNFGA 193

Query: 190 DMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRSLRTYD 249
           D+++HSATKY  GHSD++ GVL   DK++  +L+  +  +G+  +  +S+L+ R L+T  
Sbjct: 194 DIVVHSATKYINGHSDVVLGVLATNDKDIYERLQFLQNAIGAIPSPFDSWLVHRGLKTLH 253

Query: 250 LRIRRQAENATKVVKYLNDHKD----KYPALVELYHSSLQTEEFVKKQ----LSGGYTPV 301
           LR+R+ A NATK+ ++L  +++     YP L      S +  E VKKQ    L GG    
Sbjct: 254 LRVRQAALNATKIAEFLASNENVIAVNYPGL-----PSSENFEVVKKQHRDALGGGM--- 305

Query: 302 FSLTFKTE---EQCKKFCSSLKLFQHATSLGGVESLVEWRAMCD-----------SDIDQ 347
             ++F+ +   E   KF SS +LF  A SLGG+ESL+E  A+             S +  
Sbjct: 306 --ISFRIKGGAEAASKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEQREASGVFD 363

Query: 348 CLVRVSIGCESADDLINDLSTVL 370
            L+R+S+G E +DDL++D+   L
Sbjct: 364 DLIRLSVGIEDSDDLLDDIKQAL 386

>NCAS0F01520 Chr6 complement(303410..304699) [1290 bp, 429 aa] {ON}
           Anc_7.97 YAL012W
          Length = 429

 Score =  147 bits (370), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 121/385 (31%), Positives = 188/385 (48%), Gaps = 59/385 (15%)

Query: 21  VAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPV----YSREGHPNGVRLE-ALFSRFL 75
           V  PI++++TF+         +  P       NPV    YSR  +PN   LE A+ +   
Sbjct: 63  VIEPISLSTTFK---------QSSP------ANPVGIYEYSRSQNPNRENLENAIAALEN 107

Query: 76  GGHAICYSCGLGGFLGVMVHF--NPKRVFMDQCYHGVQGIVGILKRNYGVERYGLADIEK 133
           G + + +S G      V+         + +   Y G       +   +GVE     D+ K
Sbjct: 108 GKYGLAFSSGSATTATVLQSLPQGSHAISIGDVYGGTHRYFTKVANAHGVETTFTNDLLK 167

Query: 134 H-----AQKGDIVHVETPINPFGTSLDISELAR--RAHSKGALLMVDSTFAPPPLQNAWD 186
                  +   +V +E+P NP     DI  +A   ++ +K  +L+VD+TF  P L N  D
Sbjct: 168 ELPNLVKENTKLVWIESPTNPTLKVTDIQAVADAIKSLNKDIILVVDNTFLSPYLSNPLD 227

Query: 187 FGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRSLR 246
           FGAD+++HSATKY  GHSD++ GVL   DK +  KL+  +  +G+  +  +S+L  R L+
Sbjct: 228 FGADIVVHSATKYINGHSDVVLGVLATNDKALYEKLQFLQNAIGAIPSPFDSWLAHRGLK 287

Query: 247 TYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTEE---FVKKQ----LSGGYT 299
           T  LR+R+ + NATK+ ++L       P +  + +  L T E    V+KQ    L GG  
Sbjct: 288 TLHLRVRQASLNATKIAQFLQSS----PLVKAVNYPGLPTHENYAVVQKQHREALGGGM- 342

Query: 300 PVFSLTFKTE---EQCKKFCSSLKLFQHATSLGGVESLVEWRAMCD-----------SDI 345
               ++F+ +   E   KF SS +LF  A SLGG+ESL+E  A+             S +
Sbjct: 343 ----ISFRIQGGSEAASKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEAREASGV 398

Query: 346 DQCLVRVSIGCESADDLINDLSTVL 370
              LVR+S+G E  DDL++D+   L
Sbjct: 399 YDDLVRLSVGIEDGDDLLDDIKQAL 423

>KAFR0K00760 Chr11 (171591..172769) [1179 bp, 392 aa] {ON} Anc_7.97
           YAL012W
          Length = 392

 Score =  143 bits (360), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 120/385 (31%), Positives = 194/385 (50%), Gaps = 55/385 (14%)

Query: 21  VAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPNGVRLE-ALFSRFLGGHA 79
           V  PI++++TFR           QP   +      YSR  +PN   LE A+ S   G + 
Sbjct: 26  VIEPISLSTTFRQSAP------AQPIGTY-----EYSRSQNPNRENLEVAIASLENGKYG 74

Query: 80  ICYSCGLGGFLGVMVHFNPK---RVFMDQCYHGVQGIVGILKRNYGVERYG----LADIE 132
           + +S G      V++   P+    + +   Y G       +   +GVE       L D+ 
Sbjct: 75  LAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFTKVANAHGVETSFTNDLLNDLP 133

Query: 133 KHAQKG-DIVHVETPINPFGTSLDISELARRAHS--KGALLMVDSTFAPPPLQNAWDFGA 189
           K  ++   +V +E+P NP     DI  ++++  S  K  LL+VD+TF  P L N  +FGA
Sbjct: 134 KLVKENTKLVWIESPTNPTLKITDIEAVSQKVKSLNKDILLVVDNTFLSPYLSNPLNFGA 193

Query: 190 DMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRSLRTYD 249
           D+++HSATKY  GHSD++ GVL   +K++  +L+  +  +G+  +  +++L  R LRT  
Sbjct: 194 DIVVHSATKYINGHSDVVLGVLATNNKDIYERLQFLQNAIGAIPSPFDAWLTHRGLRTLH 253

Query: 250 LRIRRQAENATKVVKYLNDHKD----KYPALVELYHSSLQTEEFVKKQ----LSGGYTPV 301
           LR+R+ + +A K+ ++L ++++     YP L      + +  + VKKQ    L GG    
Sbjct: 254 LRVRQASLSAQKIAEFLQNNENVEAVNYPGL-----PTHKDYDVVKKQHREALGGGM--- 305

Query: 302 FSLTFKTE---EQCKKFCSSLKLFQHATSLGGVESLVEWRAMCD-----------SDIDQ 347
             ++F+ +   E   KF SS +LF  A SLGGVESL+E  A+             S +  
Sbjct: 306 --ISFRIKGGAEAAAKFSSSTRLFALAESLGGVESLLEVPAVMTHGGIPKEAREASGVYD 363

Query: 348 CLVRVSIGCESADDLINDLSTVLSQ 372
            LVR+S+G E  DDL+ D+   L +
Sbjct: 364 NLVRLSVGIEDGDDLLEDVKQALEK 388

>KLLA0F07909g Chr6 (742468..743643) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  142 bits (359), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 121/391 (30%), Positives = 195/391 (49%), Gaps = 56/391 (14%)

Query: 13  DEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPNGVRLE-ALF 71
           D H  V +   PI++++TF+           QP  ++      YSR  +PN   LE A+ 
Sbjct: 21  DVHGSVIE---PISLSTTFKQSAP------AQPIGEY-----EYSRSQNPNRKNLEDAIA 66

Query: 72  SRFLGGHAICYSCGLGGFLGVMVHFNPK---RVFMDQCYHGVQGIVGILKRNYGVERYGL 128
           +   G + + +S G      V++   P+    V +   Y G       +   +GVE    
Sbjct: 67  ALENGKYGLAFSSG-SATTAVILQSLPQGSHAVSIGDVYGGTHRYFTKVANAHGVETTFT 125

Query: 129 ADIEKH-----AQKGDIVHVETPINPFGTSLDISELARRAHS--KGALLMVDSTFAPPPL 181
            ++         +   +V +ETP NP     DI  +A+ A S  K  LL+VD+TF  P L
Sbjct: 126 NNLVAELPSLIKENTKLVWIETPTNPTLKVTDIELVAKTAKSINKDILLVVDNTFLSPYL 185

Query: 182 QNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLL 241
            N  +FGAD+++HSATKY  GHSD++ GVL   DK +  KL+  +  +G+  +  +S+L+
Sbjct: 186 SNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKVIYEKLQFLQNAIGAIPSPFDSWLV 245

Query: 242 LRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTEE---FVKKQ----L 294
            R ++T  LR+R+ + +A K+ ++L+ +++    ++ + +  L T E    VKKQ    L
Sbjct: 246 HRGVKTLHLRVRQASLSAHKIAEFLSSNEN----VIAVNYPGLPTHESYAVVKKQHRDAL 301

Query: 295 SGGYTPVFSLTFKTE---EQCKKFCSSLKLFQHATSLGGVESLVEWRAMCD--------- 342
            GG      ++F+ +   E    F SS +LF  A SLGG+ESL+E  A+           
Sbjct: 302 GGGM-----ISFRIKGGAEAASTFSSSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEQR 356

Query: 343 --SDIDQCLVRVSIGCESADDLINDLSTVLS 371
             S +   LVR+SIG E  DDL+ D+   L+
Sbjct: 357 EASGVYDDLVRLSIGIEDTDDLLEDIKQALA 387

>NDAI0H02400 Chr8 complement(582916..584097) [1182 bp, 393 aa] {ON}
           Anc_7.97
          Length = 393

 Score =  141 bits (356), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 109/346 (31%), Positives = 174/346 (50%), Gaps = 40/346 (11%)

Query: 56  YSREGHPNGVRLE-ALFSRFLGGHAICYSCGLGGFLGVMVHF--NPKRVFMDQCYHGVQG 112
           YSR  +PN   LE A+ +   G + + +S G      ++     N   + +   Y G   
Sbjct: 50  YSRSQNPNRENLENAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGTHR 109

Query: 113 IVGILKRNYGVERYGLADIEKH-----AQKGDIVHVETPINPFGTSLDISELARRAHS-- 165
               +   +GVE     D+ K       +   +V +E+P NP     DI  +++   S  
Sbjct: 110 YFTKVANAHGVETTFTNDLIKDLPNLVKENTKLVWIESPTNPTLKVTDIEAVSKSIKSLN 169

Query: 166 KGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKED 225
           K  LL+VD+TF  P L N  +FGAD+++HSATKY  GHSD++ GVL   ++E+  +L+  
Sbjct: 170 KDILLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNNQEIYERLQFL 229

Query: 226 RIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQ 285
           +  +G+  +  +S+L  R L+T  LR+R+ +  ATK+ ++L+ +    P +  + +  L 
Sbjct: 230 QNAVGAIPSPFDSWLTHRGLKTLHLRVRQASLTATKIAEFLSTN----PNVKAVNYPGLP 285

Query: 286 TEE---FVKKQ----LSGGYTPVFSLTFKT---EEQCKKFCSSLKLFQHATSLGGVESLV 335
           T E    VKKQ    L GG      ++F+     E   KF SS +LF  A SLGG+ESL+
Sbjct: 286 THENYDIVKKQHREALGGGM-----ISFRINGGSEAAAKFSSSTRLFTLAESLGGIESLL 340

Query: 336 EWRAMCD-----------SDIDQCLVRVSIGCESADDLINDLSTVL 370
           E  A+             S +   L+R+S+G E A DL++D+   L
Sbjct: 341 EVPAVMTHGGIPKESREASGVYDDLIRLSVGIEDAGDLLDDIKQAL 386

>TPHA0L00570 Chr12 (97933..99108) [1176 bp, 391 aa] {ON} Anc_7.97
           YAL012W
          Length = 391

 Score =  140 bits (354), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 110/348 (31%), Positives = 176/348 (50%), Gaps = 40/348 (11%)

Query: 56  YSREGHPNGVRLE-ALFSRFLGGHAICYSCGLGGFLGVMVHF--NPKRVFMDQCYHGVQG 112
           YSR  +PN   LE A+ +   G + + +S G      ++     N   + +   Y G   
Sbjct: 50  YSRSQNPNRKNLEDAIAALENGKYGLAFSSGSATTAIILQSLPQNSHAISIGDVYGGTHR 109

Query: 113 IVGILKRNYGVE----RYGLADIEKHAQKGD-IVHVETPINPFGTSLDISELARRAHS-- 165
               +   +GV+       +AD+ K  ++   +V +E+P NP     DI  +A+   S  
Sbjct: 110 YFSKVANTHGVDTDFTNDLVADLPKLVKENTRLVWIESPTNPTLKVTDIELVAKTIKSLN 169

Query: 166 KGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKED 225
           K  LL+VD+TF  P L N  +FGAD+++HSATKY  GHSD++ GVL    +++  +L+  
Sbjct: 170 KDILLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSRDIYERLQFL 229

Query: 226 RIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQ 285
           +  +G+  +  +++L  R L+T  LR+R+ A NATK+ ++L    +    +V + +  L 
Sbjct: 230 QNAVGAIPSPFDAWLTHRGLKTLHLRVRQAALNATKIAEFLAQSDN----VVAVNYPGLP 285

Query: 286 TE---EFVKKQ----LSGGYTPVFSLTFKTE---EQCKKFCSSLKLFQHATSLGGVESLV 335
           T      VKKQ    L GG      ++F+ +   E   KF SS +LF  A SLGG+ESL+
Sbjct: 286 TNPDYAIVKKQHRDALGGGM-----ISFRVKGGAEAASKFASSTRLFTLAESLGGIESLL 340

Query: 336 EWRAMCD-----------SDIDQCLVRVSIGCESADDLINDLSTVLSQ 372
           E  A+             S +   LVR+S+G E  DDL+ D+   L +
Sbjct: 341 EVPAVMTHGGIPKEQREASGVFDDLVRLSVGIEDGDDLLEDVKAALQK 388

>SAKL0B09614g Chr2 complement(813507..814685) [1179 bp, 392 aa] {ON}
           highly similar to uniprot|P31373 Saccharomyces
           cerevisiae YAL012W CYS3 Cystathionine gamma-lyase
           catalyzes one of the two reactions involved in the
           transsulfuration pathway that yields cysteine from
           homocysteine with the intermediary formation of
           cystathionine
          Length = 392

 Score =  140 bits (352), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 110/346 (31%), Positives = 176/346 (50%), Gaps = 40/346 (11%)

Query: 56  YSREGHPNGVRLE-ALFSRFLGGHAICYSCGLGGFLGVMVHFNPK---RVFMDQCYHGVQ 111
           YSR  +PN   LE A+ +     + + +S G      V++   P+    V +   Y G  
Sbjct: 50  YSRSQNPNRKNLEDAVAALENAKYGLAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGGTH 108

Query: 112 GIVGILKRNYGVERY-------GLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAH 164
                +   +GVE          LA + K   +  +V +E+P NP     DI  +++   
Sbjct: 109 RYFTKVANAHGVETTFTNNLVEDLAQLVKENTR--LVWIESPTNPTLKVTDIELVSKTIK 166

Query: 165 S--KGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKL 222
           S  K  LL+VD+TF  P L N  +FGAD+++HSATKY  GHSD++ GVL   DKE+  +L
Sbjct: 167 SINKDILLVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNDKEIYERL 226

Query: 223 KEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKD----KYPALVE 278
           +  +  +G+  +  +++L  R L+T  LR+R+ A  ATK+ ++L+  +D     YP L  
Sbjct: 227 QFLQNAIGAIPSPFDAWLSHRGLKTLHLRVRQAATTATKIAEFLSQSEDVVAVNYPGLPT 286

Query: 279 LYHSSLQTEEFVKKQLSGGYTPVFSLTFKTE---EQCKKFCSSLKLFQHATSLGGVESLV 335
             + ++  ++  +  L GG      ++F+ +   E   KF SS +LF  A SLGG+ESL+
Sbjct: 287 HPNHNVVLKQH-RDGLGGGM-----ISFRIKGGAEAAAKFSSSTRLFTLAESLGGIESLL 340

Query: 336 EWRAMCD-----------SDIDQCLVRVSIGCESADDLINDLSTVL 370
           E  A+             S +   L+R+SIG E  DDL++D+   L
Sbjct: 341 EVPAVMTHGGIPKDQREASGVFDDLIRLSIGIEDTDDLLDDIKQAL 386

>CAGL0H06369g Chr8 (627708..628883) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012w CYS3
          Length = 391

 Score =  139 bits (350), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 119/397 (29%), Positives = 195/397 (49%), Gaps = 64/397 (16%)

Query: 12  DDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPV----YSREGHPNGVRL 67
           +D H  V +   PI++++TF+         + +P        P+    YSR  +PN   L
Sbjct: 20  EDIHGSVIE---PISLSTTFK---------QSEP------AKPIGTYEYSRSQNPNRENL 61

Query: 68  EALFSRFLGG-HAICYSCGLGGFLGVMVHFNPK---RVFMDQCYHGVQGIVGILKRNYGV 123
           EA  +   GG + + +S G      V++   P+    V +   Y G       +   +GV
Sbjct: 62  EAAIASLEGGKYGLAFSSG-SATTAVILQSLPQGSHAVSIGDVYGGTHRYFTKVANAHGV 120

Query: 124 ERYG----LADIEKHAQKG-DIVHVETPINPFGTSLDISELARRAH--SKGALLMVDSTF 176
           +       + D+ K  +    +V +E+P NP     DI  +A      +K  LL+VD+TF
Sbjct: 121 DTSFTNNLIEDLPKLVKDNTKLVWIESPTNPTLKVTDIQLVAENVKKINKDILLVVDNTF 180

Query: 177 APPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANL 236
             P L N   FGAD+++HSATKY  GHSD++ GVL    K++  +L+  +  +G   +  
Sbjct: 181 LSPYLSNPLKFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNAIGCIPSPF 240

Query: 237 ESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTE---EFVKKQ 293
           +++L  R L+T  LR+R+ + NATK+  +L  +++    +V + +  LQ+    + VKKQ
Sbjct: 241 DAWLTHRGLKTLHLRVRQASLNATKIATFLESNEN----VVAVNYPGLQSHPNYDVVKKQ 296

Query: 294 ----LSGGYTPVFSLTFKTE---EQCKKFCSSLKLFQHATSLGGVESLVEWRAMCD---- 342
               L GG      ++F+ +   E   KF SS +LF  A SLGG+ESL+E  A+      
Sbjct: 297 HREALGGGM-----ISFRIKGGAEAAAKFSSSTRLFTLAESLGGIESLLEVPAVMTHGGI 351

Query: 343 -------SDIDQCLVRVSIGCESADDLINDLSTVLSQ 372
                  S +   LVR+S+G E  +DL+ D+   L +
Sbjct: 352 PKEAREASGVFDDLVRLSVGIEDGEDLLEDIKQALQK 388

>Suva_1.56 Chr1 (107030..108217) [1188 bp, 395 aa] {ON} YAL012W
           (REAL)
          Length = 395

 Score =  139 bits (349), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 117/390 (30%), Positives = 189/390 (48%), Gaps = 61/390 (15%)

Query: 21  VAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPV----YSREGHPNGVRLE-ALFSRFL 75
           V  PI++++TF+         +  P       NP+    YSR  +PN   LE A+ +   
Sbjct: 26  VIEPISLSTTFK---------QSSP------ANPIGTYEYSRSQNPNRENLERAVAALEN 70

Query: 76  GGHAICYSCGLGGFLGVMVHF--NPKRVFMDQCYHGVQGIVGILKRNYGVERYGLADIEK 133
             + + +S G      ++         V +   Y G       +   +GVE     D+ K
Sbjct: 71  AQYGLAFSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAHGVETSFTNDLLK 130

Query: 134 HAQK-----GDIVHVETPINPFGTSLDISELA-----RRAHSKGALLMVDSTFAPPPLQN 183
              +       +V +ETP NP     DI ++A       A S+  +L+VD+TF  P + N
Sbjct: 131 DLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADAIKKHTAASQDVILVVDNTFLSPYISN 190

Query: 184 AWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLR 243
             +FGAD+++HSATKY  GHSD++ GVL    K +  +L+  +  +G+  +  +++L  R
Sbjct: 191 PLNFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQNAIGAIPSPFDAWLTHR 250

Query: 244 SLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTE---EFVKKQ----LSG 296
            L+T  LR+R+ A +A K+ ++L   K+    +V + +  L+T    + V KQ    L G
Sbjct: 251 GLKTLHLRVRQAALSAIKIAEFLAADKEN---IVAVNYPGLKTHPNYDVVVKQHRDALGG 307

Query: 297 GYTPVFSLTFKTE---EQCKKFCSSLKLFQHATSLGGVESLVEWRAMCD----------- 342
           G      ++F+ +   E   KF SS +LF  A SLGG+ESL+E  A+             
Sbjct: 308 GM-----ISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEAREA 362

Query: 343 SDIDQCLVRVSIGCESADDLINDLSTVLSQ 372
           S +   LVR+S+G E ADDL++D+   L Q
Sbjct: 363 SGVFDDLVRISVGIEDADDLLDDIKQALKQ 392

>TDEL0H03530 Chr8 complement(586031..587206) [1176 bp, 391 aa] {ON}
           Anc_7.97 YAL012W
          Length = 391

 Score =  138 bits (348), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 111/347 (31%), Positives = 172/347 (49%), Gaps = 40/347 (11%)

Query: 56  YSREGHPNGVRLE-ALFSRFLGGHAICYSCGLGGFLGVMVHFNPK---RVFMDQCYHGVQ 111
           YSR  +PN   LE AL +     + + +S G      V++   P+    V +   Y G  
Sbjct: 50  YSRSQNPNRKNLEEALAALENAKYGLAFSSG-SATTAVVLQSLPQGSHAVSIGDVYGGTH 108

Query: 112 GIVGILKRNYGVERYGLADIEKH-----AQKGDIVHVETPINPFGTSLDISELARRAH-- 164
                +   +GV+     D+ K       +   +V +E+P NP     DI+ + + A   
Sbjct: 109 RYFTKVANAHGVDTSFTNDLIKDLPSLIKENTKLVWIESPTNPTLKVTDIALVVKTAKQI 168

Query: 165 SKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKE 224
           +K  L++VD+TF  P L N  +FG D+++HSATKY  GHSD++ GVL   DK +  KL+ 
Sbjct: 169 NKEILVVVDNTFLSPYLSNPLNFGVDIVVHSATKYINGHSDVVLGVLATNDKAIYEKLQF 228

Query: 225 DRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKD----KYPALVELY 280
            +  +G+  +  +S+L  R L+T  LR+R+ A  ATK+ ++L    +     YP L    
Sbjct: 229 LQNAIGAIPSPFDSWLAHRGLKTLHLRVRQAALTATKIAEFLEQDSNVLAVNYPGL---- 284

Query: 281 HSSLQTEEFVKKQ----LSGGYTPVFSLTFKTEEQ-CKKFCSSLKLFQHATSLGGVESLV 335
            +S    E V++Q    L GG   + S   K   Q   KF SS +LF  A SLGG+ESL+
Sbjct: 285 -ASNPDREIVQRQHRDGLGGG---MISFRIKGGAQAAAKFSSSTRLFTLAESLGGIESLL 340

Query: 336 EWRAMCD-----------SDIDQCLVRVSIGCESADDLINDLSTVLS 371
           E  A+             S +   L+R+S+G E +DDL+ D+   L+
Sbjct: 341 EVPAVMTHGGIPKEQREASGVYDDLIRLSVGIEDSDDLLTDIKEALA 387

>Smik_1.55 Chr1 (113765..114949) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  137 bits (345), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 113/389 (29%), Positives = 186/389 (47%), Gaps = 60/389 (15%)

Query: 21  VAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPV----YSREGHPNGVRLEALFSRFLG 76
           V  PI++++TF+         +  P       NP+    YSR  +PN   LE   +    
Sbjct: 26  VIEPISLSTTFK---------QSSP------ANPIGTYEYSRSQNPNRENLEKAVAALEN 70

Query: 77  G-HAICYSCGLGGFLGVMVHF--NPKRVFMDQCYHGVQGIVGILKRNYGVERYGLADI-- 131
             + + +S G      ++         V +   Y G       +   +GVE     D+  
Sbjct: 71  AQYGLAFSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAHGVETSFTNDLLN 130

Query: 132 ---EKHAQKGDIVHVETPINPFGTSLDISELA----RRAHSKGALLMVDSTFAPPPLQNA 184
              +       +V +ETP NP     DI ++A    + A  +  +L+VD+TF  P + N 
Sbjct: 131 DLPQLLKNNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVILVVDNTFLSPYISNP 190

Query: 185 WDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRS 244
            +FGAD+++HSATKY  GHSD++ GVL   +K++  +L+  +  +G+  +  +++L  R 
Sbjct: 191 LNFGADIVVHSATKYINGHSDVVLGVLATNNKQLYERLQFLQNAIGAIPSPFDAWLTHRG 250

Query: 245 LRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTE---EFVKKQ----LSGG 297
           L+T  LR+R+ A +A K+ ++L   K+    +V + +  L+T    + V KQ    L GG
Sbjct: 251 LKTLHLRVRQAALSAIKIAEFLASDKEN---VVAVNYPGLKTHPNYDVVLKQHRDALGGG 307

Query: 298 YTPVFSLTFKTE---EQCKKFCSSLKLFQHATSLGGVESLVEWRAMCD-----------S 343
                 ++F+ +   E   KF SS +LF  A SLGG+ESL+E  A+             S
Sbjct: 308 M-----ISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEAREAS 362

Query: 344 DIDQCLVRVSIGCESADDLINDLSTVLSQ 372
            +   LVR+S+G E  DDL+ D+   L Q
Sbjct: 363 GVYDDLVRISVGIEDTDDLLEDVKQALKQ 391

>YAL012W Chr1 (130799..131983) [1185 bp, 394 aa] {ON}
           CYS3Cystathionine gamma-lyase, catalyzes one of the two
           reactions involved in the transsulfuration pathway that
           yields cysteine from homocysteine with the intermediary
           formation of cystathionine
          Length = 394

 Score =  136 bits (342), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 114/389 (29%), Positives = 188/389 (48%), Gaps = 60/389 (15%)

Query: 21  VAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPV----YSREGHPNGVRLE-ALFSRFL 75
           V  PI++++TF+         +  P       NP+    YSR  +PN   LE A+ +   
Sbjct: 26  VIEPISLSTTFK---------QSSP------ANPIGTYEYSRSQNPNRENLERAVAALEN 70

Query: 76  GGHAICYSCGLGGFLGVMVHF--NPKRVFMDQCYHGVQGIVGILKRNYGVERYGLADI-- 131
             + + +S G      ++         V +   Y G       +   +GVE     D+  
Sbjct: 71  AQYGLAFSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAHGVETSFTNDLLN 130

Query: 132 ---EKHAQKGDIVHVETPINPFGTSLDISELA----RRAHSKGALLMVDSTFAPPPLQNA 184
              +   +   +V +ETP NP     DI ++A    + A  +  +L+VD+TF  P + N 
Sbjct: 131 DLPQLIKENTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVILVVDNTFLSPYISNP 190

Query: 185 WDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRS 244
            +FGAD+++HSATKY  GHSD++ GVL   +K +  +L+  +  +G+  +  +++L  R 
Sbjct: 191 LNFGADIVVHSATKYINGHSDVVLGVLATNNKPLYERLQFLQNAIGAIPSPFDAWLTHRG 250

Query: 245 LRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTE---EFVKKQ----LSGG 297
           L+T  LR+R+ A +A K+ ++L   K+    +V + +  L+T    + V KQ    L GG
Sbjct: 251 LKTLHLRVRQAALSANKIAEFLAADKEN---VVAVNYPGLKTHPNYDVVLKQHRDALGGG 307

Query: 298 YTPVFSLTFKTE---EQCKKFCSSLKLFQHATSLGGVESLVEWRAMCD-----------S 343
                 ++F+ +   E   KF SS +LF  A SLGG+ESL+E  A+             S
Sbjct: 308 M-----ISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEAREAS 362

Query: 344 DIDQCLVRVSIGCESADDLINDLSTVLSQ 372
            +   LVR+S+G E  DDL+ D+   L Q
Sbjct: 363 GVFDDLVRISVGIEDTDDLLEDIKQALKQ 391

>Skud_1.49 Chr1 (106029..107213) [1185 bp, 394 aa] {ON} YAL012W
           (REAL)
          Length = 394

 Score =  136 bits (342), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 114/389 (29%), Positives = 186/389 (47%), Gaps = 60/389 (15%)

Query: 21  VAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPV----YSREGHPNGVRLE-ALFSRFL 75
           V  PI++++TF+         +  P       NP+    YSR  +PN   LE A+ +   
Sbjct: 26  VIEPISLSTTFK---------QSSP------ANPIGTYEYSRSQNPNRENLERAVAALEN 70

Query: 76  GGHAICYSCGLGGFLGVMVHF--NPKRVFMDQCYHGVQGIVGILKRNYGVERYGLADI-- 131
             + + +S G      ++         V +   Y G       +   +GVE     D+  
Sbjct: 71  AQYGLAFSSGSATTATILQSLPQGAHAVSIGDVYGGTHRYFTKVANAHGVETSFTNDLLT 130

Query: 132 ---EKHAQKGDIVHVETPINPFGTSLDISELA----RRAHSKGALLMVDSTFAPPPLQNA 184
              +       +V +ETP NP     DI ++A    + A  +  +L+VD+TF  P + N 
Sbjct: 131 DLPQLLKDNTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVILVVDNTFLSPYISNP 190

Query: 185 WDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRS 244
            DFGAD+++HSATKY  GHSD++ GVL    K +  +L+  +  +G+  +  +++L  R 
Sbjct: 191 LDFGADIVVHSATKYINGHSDVVLGVLATNSKPLYERLQFLQNAIGAIPSPFDAWLTHRG 250

Query: 245 LRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTE---EFVKKQ----LSGG 297
           L+T  LR+R+ A +A K+ ++L   K+    +V + +  L+T    + V KQ    L GG
Sbjct: 251 LKTLHLRVRQAALSAIKIAEFLASDKEN---IVAVNYPGLKTHPNYDVVLKQHRDALGGG 307

Query: 298 YTPVFSLTFKTE---EQCKKFCSSLKLFQHATSLGGVESLVEWRAMCD-----------S 343
                 ++F+ +   E   KF SS +LF  A SLGG+ESL+E  A+             S
Sbjct: 308 M-----ISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEAREAS 362

Query: 344 DIDQCLVRVSIGCESADDLINDLSTVLSQ 372
            +   L+R+S+G E  DDL+ D+   L Q
Sbjct: 363 GVFDDLIRISVGIEDTDDLLEDVKQALKQ 391

>ZYRO0D05742g Chr4 (489953..491128) [1176 bp, 391 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 391

 Score =  129 bits (323), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 110/383 (28%), Positives = 185/383 (48%), Gaps = 55/383 (14%)

Query: 21  VAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPNGVRLE-ALFSRFLGGHA 79
           V  PI++++TF+           QP  ++      YSR  +PN   LE A+ S   G H 
Sbjct: 26  VIEPISLSTTFKQSAPA------QPLGEY-----EYSRSQNPNRKNLEDAIASLENGKHG 74

Query: 80  ICYSCGLGGFLGVMVHFNPK---RVFMDQCYHGVQGIVGILKRNYGVERYGLADIEKH-- 134
           + +S G      V++   P+    + +   Y G       +   +GV+     ++ K   
Sbjct: 75  LAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTHRYFTKVANAHGVDVSFTNELVKDLP 133

Query: 135 ---AQKGDIVHVETPINPFGTSLDISELARRAH--SKGALLMVDSTFAPPPLQNAWDFGA 189
                   ++ +E+P NP     DI+ + +     +K  L++VD+TF  P L N  DFG 
Sbjct: 134 SLVKPNTKLLWIESPTNPTLQVTDIALVNKTVKELNKDILVVVDNTFLSPYLSNPLDFGV 193

Query: 190 DMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRSLRTYD 249
           D+++HSATKY  GHSD++ GVL     E+  +L+  +  +G+  +  +++L  R L+T  
Sbjct: 194 DVVVHSATKYINGHSDVVLGVLATNSTELYERLQFLQNAIGAIPSPFDAWLAHRGLKTLH 253

Query: 250 LRIRRQAENATKVVKYLNDHKD----KYPALVELYHSSLQTEEFVKKQ----LSGGYTPV 301
           LR+R+ A  ATK+ ++L  +       YP L     +S  + + V++Q    L GG    
Sbjct: 254 LRVRQAATTATKIAEFLQSNDRVIAVNYPGL-----ASHPSHDVVQRQHRDGLGGGM--- 305

Query: 302 FSLTFKTE---EQCKKFCSSLKLFQHATSLGGVESLVEWRAMCD-----------SDIDQ 347
             ++F+ +   E   KF S+ +LF  A SLGG+ESL+E  A+             S +  
Sbjct: 306 --ISFRIKGGAEGAAKFSSNTRLFTLAESLGGIESLLEVPAVMTHGGIPEDQREASGVYD 363

Query: 348 CLVRVSIGCESADDLINDLSTVL 370
            L+R+S+G E  +DL+ D+   L
Sbjct: 364 DLIRLSVGIEDTEDLLEDIKQAL 386

>AEL341W Chr5 (9428..10609) [1182 bp, 393 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YAL012W (CYS3)
          Length = 393

 Score =  128 bits (322), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 116/386 (30%), Positives = 182/386 (47%), Gaps = 59/386 (15%)

Query: 21  VAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPV----YSREGHPNGVRLE-ALFSRFL 75
           V  PI++++TF+  +                 NPV    YSR  +PN   LE A+ +   
Sbjct: 26  VIEPISLSTTFKQSSPG---------------NPVGAYEYSRGQNPNRQNLEEAIAALES 70

Query: 76  GGHAICYSCGLGGFLGVMVHFNPK---RVFMDQCYHGVQGIVGILKRNYGVERYG----L 128
             + + +S G      V+V   P+    + +   Y G       +   +GVE       L
Sbjct: 71  AKYGLAFSSG-SATTAVIVQSLPQGSHAISIGDVYGGTHRYFTKVANAHGVETSFTNSLL 129

Query: 129 ADIEKHAQKGD-IVHVETPINPFGTSLDISELAR--RAHSKGALLMVDSTFAPPPLQNAW 185
            D+ K  +    +V +E+P NP     DI ++A   +A ++  +L+VD+TF  P L N  
Sbjct: 130 EDLPKLVRDNTRLVWIESPTNPTLQVTDIQQVADTVKALNEDIILVVDNTFLSPYLSNPL 189

Query: 186 DFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRSL 245
           +FGAD+++HSATKY  GHSD++ G L      +  +L   +  +G+  +  +++L  R L
Sbjct: 190 NFGADIVIHSATKYINGHSDVVLGALATNSTSLYERLAFLQNAIGAIPSPFDAWLTHRGL 249

Query: 246 RTYDLRIRRQAENATKVVKYLNDHKD----KYPALVELYHSSLQTEEFVKKQ----LSGG 297
           +T  LR+R+ A++A K+ +YL   +      YP L      S +  +  +KQ    L GG
Sbjct: 250 KTLHLRVRQAAQSAQKIAEYLEQSEHVVSVNYPGL-----PSHRGYQIAQKQHRDGLGGG 304

Query: 298 YTPVFSLTFKTEEQCKKFCS-SLKLFQHATSLGGVESLVEWRAMCD-----------SDI 345
              + S   K   Q     S S +LF  A SLGG+ESL+E  A+             S +
Sbjct: 305 ---MISFRVKGGAQGAALLSQSTRLFTLAESLGGIESLLEVPAVMTHAGIPKEAREASGV 361

Query: 346 DQCLVRVSIGCESADDLINDLSTVLS 371
              LVRVS+G E  DDL+ D+   LS
Sbjct: 362 YDDLVRVSVGIEDTDDLLEDIKQALS 387

>KLTH0D02728g Chr4 (267019..268197) [1179 bp, 392 aa] {ON} highly
           similar to uniprot|P31373 Saccharomyces cerevisiae
           YAL012W CYS3 Cystathionine gamma-lyase catalyzes one of
           the two reactions involved in the transsulfuration
           pathway that yields cysteine from homocysteine with the
           intermediary formation of cystathionine
          Length = 392

 Score =  127 bits (320), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 114/401 (28%), Positives = 187/401 (46%), Gaps = 57/401 (14%)

Query: 6   TLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPNGV 65
           TL +H     +    V  PI++++TF+           QP   +      YSR  +PN  
Sbjct: 11  TLAIHAGAHTDVHGSVIEPISLSTTFKQSAPA------QPIGAY-----EYSRSQNPNRA 59

Query: 66  RLEALFSRFLGGH-AICYSCGLGGFLGVMVHFNPK---RVFMDQCYHGVQGIVGILKRNY 121
            LEA  +        + +S G      V++   P     + +   Y G       +   +
Sbjct: 60  NLEAAVAALERAQFGLAFSSG-SATTAVVLQSLPTDSHAISIGDVYGGTHRYFTQVAHAH 118

Query: 122 GVERYGLADIEKHAQK-----GDIVHVETPINPFGTSLDISELARRAHSKGA--LLMVDS 174
           GV+     D+E+   +       +V +E+P NP     DI  +A  AH+     L++VD+
Sbjct: 119 GVQTSFTNDLERDLPQLVRPNTRLVWLESPTNPTLKVTDIRRVADAAHAANPDILVVVDN 178

Query: 175 TFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIA 234
           TF  P + N    GAD+++HSATKY  GHSD++ GVL   ++ +  +L+  +  +G+  +
Sbjct: 179 TFLSPYISNPLTHGADIVVHSATKYINGHSDVVLGVLATNNEPLYERLRFLQNAIGAVPS 238

Query: 235 NLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDK-----YPALVELYHSSLQTEEF 289
             +S+L  R L+T  LR+R  A++A ++ K+L +  D+     YP L     SS      
Sbjct: 239 PFDSWLTHRGLKTLHLRVRAAAQSAQRIAKFL-EASDRVEHVNYPGL-----SSHPAYAV 292

Query: 290 VKKQ----LSGGYTPVFSLTFKTE---EQCKKFCSSLKLFQHATSLGGVESLVEWRAMCD 342
           V+KQ    L GG      ++F+ +       +F S+ +LF  A SLGG+ESLVE  A+  
Sbjct: 293 VQKQHRDALGGGM-----ISFRIKGGAGAAARFTSTTRLFTLAESLGGIESLVEVPAVMT 347

Query: 343 -----------SDIDQCLVRVSIGCESADDLINDLSTVLSQ 372
                      S +   L+R+S+G E  DDL+ D+   L +
Sbjct: 348 HGGIPREQREASGVFDNLIRLSVGIEDIDDLLEDVRQALEK 388

>TBLA0E02240 Chr5 (554046..555209) [1164 bp, 387 aa] {ON} Anc_7.97
           YAL012W
          Length = 387

 Score =  125 bits (313), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 104/351 (29%), Positives = 168/351 (47%), Gaps = 48/351 (13%)

Query: 56  YSREGHPNGVRLEALFSRFLGG-HAICYSCGLGGFLGVMVHFNPK---RVFMDQCYHGVQ 111
           YSR  +PN   LE   +    G + + +S G      V++   P+    + +   Y G  
Sbjct: 50  YSRSQNPNRKNLEEAIATLENGKYGLAFSSG-SATTAVILQSLPQGSHSISIGDVYGGTH 108

Query: 112 GIVGILKRNYGVERY-------GLADIEKHAQKGDIVHVETPINPFGTSLDISELAR--R 162
                +   +GVE          L  + K   +  +V +E+P NP     DI  +    +
Sbjct: 109 RYFTKVANAHGVESTFSNNLIEELPTLVKPNTR--LVWIESPTNPTLKVTDIQLVVDTVK 166

Query: 163 AHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKL 222
             +K  L++VD+TF  P L N  +FGAD+++HSATKY  GHSD++ GVL    KE+  +L
Sbjct: 167 KLNKDILVVVDNTFLSPYLSNPLNFGADIVVHSATKYINGHSDVVLGVLATNSKEIYERL 226

Query: 223 KEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKD----KYPALVE 278
           +  +  +G+  +  +++L  R L+T  LR+R+ + +A K+ ++L    +     YP L  
Sbjct: 227 QFLQNAIGAIPSPFDAWLAHRGLKTLHLRVRQASLSAQKIAEFLAQDPNVIAVNYPGL-- 284

Query: 279 LYHSSLQTEEFVKKQ----LSGGYTPVFSLTFKTE---EQCKKFCSSLKLFQHATSLGGV 331
               S    + VKKQ    L GG      ++F+ +   E   KF    +LF  A SLGG+
Sbjct: 285 ---ESHPNRDIVKKQHRDGLGGGM-----ISFRIKGGAEGASKFTQKTRLFTLAESLGGI 336

Query: 332 ESLVEWRAMCD-----------SDIDQCLVRVSIGCESADDLINDLSTVLS 371
           ESL+E  A+             + +   LVR+S+G E  DDL+ D+   L+
Sbjct: 337 ESLLEVPAVMTHGGIPKEAREATGVYDDLVRLSVGIEDVDDLLADVKQALN 387

>KNAG0D04740 Chr4 complement(851405..852577) [1173 bp, 390 aa] {ON}
           Anc_7.97 YAL012W
          Length = 390

 Score =  124 bits (311), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 112/400 (28%), Positives = 187/400 (46%), Gaps = 59/400 (14%)

Query: 6   TLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPV----YSREGH 61
           TL +H  +  +    V  PI++++TF+         +  P       NP+    YSR  +
Sbjct: 9   TLAVHAGEHTDVHGSVIEPISLSTTFK---------QSSP------ANPIGVYEYSRSQN 53

Query: 62  PNGVRLE-ALFSRFLGGHAICYSCGLGGFLGVMVHF--NPKRVFMDQCYHGVQGIVGILK 118
           PN   LE A+ +     + + +S G      +M         V +   Y G       + 
Sbjct: 54  PNRDNLENAIAALEKAQYGLAFSSGSAATSVIMQSLPQGSHAVSIGDVYGGTHRYFTKVA 113

Query: 119 RNYGVERY-------GLADIEKHAQKGDIVHVETPINPFGTSLDISEL--ARRAHSKGAL 169
             +GVE          L ++ K   +  +V +E+P NP     DI  +  A +  +K  L
Sbjct: 114 NTHGVETTFTNNLLEELPNLVKDNTR--LVWIESPTNPTLKVTDIQAVSNAIKKINKDIL 171

Query: 170 LMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYL 229
           L+VD+TF  P L N   FGAD+++HSATKY  GHSD++ GVL    K++  +L+  +  +
Sbjct: 172 LVVDNTFLSPYLSNPLTFGADIVVHSATKYINGHSDVVLGVLATNSKDIYERLQFLQNAI 231

Query: 230 GSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKD----KYPAL-VELYHSSL 284
           G+  +  +++L  R L+T  LR+++ +  A K+ ++L+  K      YP L     H+ +
Sbjct: 232 GAIPSPFDAWLTHRGLKTLHLRVKQASVTAQKIAEFLSASKHVEAVNYPGLKTHPNHAVV 291

Query: 285 QTEEFVKKQLSGGYTPVFSLTFKT---EEQCKKFCSSLKLFQHATSLGGVESLVEWRAMC 341
           Q +   +  L GG      ++F+         KF S+ +LF  A SLGG+ESL+E  A+ 
Sbjct: 292 QRQH--RDALGGGM-----ISFRVKGGAAAAAKFSSTTRLFTLAESLGGIESLLEVPAVM 344

Query: 342 D-----------SDIDQCLVRVSIGCESADDLINDLSTVL 370
                       S +   L+R+S+G E  +DL+ D+   L
Sbjct: 345 THGGIPKESREASGVYDNLIRLSVGIEDTEDLLEDIKQAL 384

>Ecym_2629 Chr2 complement(1216179..1217357) [1179 bp, 392 aa] {ON}
           similar to Ashbya gossypii AEL341W
          Length = 392

 Score =  124 bits (311), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 102/350 (29%), Positives = 171/350 (48%), Gaps = 46/350 (13%)

Query: 56  YSREGHPNGVRLEALFSRFLGG-HAICYSCGLGGFLGVMVHFNPK---RVFMDQCYHGVQ 111
           YSR  +PN   LE   +      H + +S G      V++   P+    + +   Y G  
Sbjct: 50  YSRSQNPNRKNLEDAIAVLENAKHGLAFSSG-SATTAVILQSLPQGSHAISIGDVYGGTH 108

Query: 112 GIVGILKRNYGVERYGLADIEKH-----AQKGDIVHVETPINPFGTSLDISELAR--RAH 164
                +   +GVE     ++ +       +   +V +E+P NP     DI  +++  ++ 
Sbjct: 109 RYFNNVANAHGVETTFTNNLVEDLPTLIRENTKLVWIESPTNPTLKVTDIQLVSQIIKSS 168

Query: 165 SKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKE 224
           +K  +L+VD+TF  P L N  +FGAD+++HSATKY  GHSD++ GVL    + +  KL+ 
Sbjct: 169 NKDIILVVDNTFLSPYLSNPLNFGADIVIHSATKYINGHSDVVLGVLATNSQVLYDKLQY 228

Query: 225 DRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDK-----YPALVEL 279
            +  +G+  +  +++L  R L+T  LR+R  + +A ++ ++L    DK     YP L   
Sbjct: 229 LQNAIGAVPSPFDAWLTHRGLKTLHLRVRTASNSAQEIAEFLVK-SDKVISVNYPGL--- 284

Query: 280 YHSSLQTEEFVKKQ----LSGGYTPVFSLTFKTE---EQCKKFCSSLKLFQHATSLGGVE 332
             SS    + VKKQ    L GG      ++F+ +   +   KF +S +LF  A SLGG+E
Sbjct: 285 --SSHPNNDIVKKQHRDGLGGGM-----ISFRIKGGADGAAKFSASTRLFTLAESLGGIE 337

Query: 333 SLVEWRAMCD-----------SDIDQCLVRVSIGCESADDLINDLSTVLS 371
           SL+E  A+             S +   L+R+S+G E   DL+ D+   L+
Sbjct: 338 SLLEVPAVMTHGGIPKDQREASGVYDDLIRLSVGIEDTGDLLKDIEQALN 387

>CAGL0L06094g Chr12 (693250..694602) [1353 bp, 450 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184c
          Length = 450

 Score =  104 bits (260), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 105/393 (26%), Positives = 168/393 (42%), Gaps = 70/393 (17%)

Query: 24  PINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPNGVRLE----ALFSRFLGGHA 79
           P+ +++TF+ D +N     D            YSR G+P    L+     L+        
Sbjct: 11  PLYLSTTFKVDLENENNQYD------------YSRSGNPTRTLLQQQVAKLYDDIDPNFV 58

Query: 80  ICYSCGLGGFLGVMVHFNPKR------VFMDQCYHGVQGIVGILK-------------RN 120
              S G+     V+  F P        +  D  Y G Q ++ +LK              N
Sbjct: 59  FAVSSGMTALDVVLRSFLPSETNNHCIIAGDDLYGGTQRLLNLLKISIDTMHFDLSHTEN 118

Query: 121 YGVERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELAR--RAHSKGALLMVDSTFAP 178
           +  + Y L  I+K     DI+ +E+P NP    +DI  L +  R +S   L+++D+T   
Sbjct: 119 FKAKFYDLVTIKKTIV--DIIVLESPTNPLCKIIDIPHLIKFIRKYSPETLIVIDNTMMS 176

Query: 179 PPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLES 238
               N   FGAD++  SATKY  GH D+++GV++ K+K +A K+       GS +  ++S
Sbjct: 177 GLNCNPLKFGADVVYESATKYLNGHHDIMAGVIIAKNKLLAEKIYFLINSTGSGLNPMDS 236

Query: 239 YLLLRSLRTYDLRIRRQAENATKVVKYL------------NDHKDKYPALVELYHSSLQT 286
           +LL+R L+T  +R+ +Q  NA  +  +L            N+ K +Y  L    H   + 
Sbjct: 237 WLLIRGLKTLSIRLHKQQLNALAISHWLEEGCGFKTHNNNNNLKTRYIGLKS--HPDYE- 293

Query: 287 EEFVKKQLSGGYTPVFSLTFKTEEQCKKFCSS--LKLFQHATSLGGVESLVEWRA-MCDS 343
              + +  + G   V SL   +    KK  +S  LKL+    S G V SL+     M  +
Sbjct: 294 ---LHRSFNKGPGAVISLQTGSIPISKKIVASKLLKLWNVTVSFGCVNSLISMPCLMSHA 350

Query: 344 DID----------QCLVRVSIGCESADDLINDL 366
            ID          + L+R+  G E    L  DL
Sbjct: 351 SIDPELRKERQFPEDLIRLCCGIEDVKALQEDL 383

>YGL184C Chr7 complement(154615..156012) [1398 bp, 465 aa] {ON}
           STR3Peroxisomal cystathionine beta-lyase, converts
           cystathionine into homocysteine; may be redox regulated
           by Gto1p
          Length = 465

 Score = 99.8 bits (247), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 111/408 (27%), Positives = 182/408 (44%), Gaps = 58/408 (14%)

Query: 4   LETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPN 63
           L+T++++   ++++ +   PP+ +++TF+ D +N     D  N D       YSR G+P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EDAQNYD-------YSRSGNPT 54

Query: 64  GVRLE---ALFSRFLGGHAICYSCGLGGF---LGVMVHFN------PKRVFMDQCYHGVQ 111
              L+       R    + +  S G+      L  +V  N      P  +  D  Y G Q
Sbjct: 55  RSVLQHQIGKLYRVPQENVLAVSSGMTALDVILRGLVLLNGTDNHTPTIIAGDDLYGGTQ 114

Query: 112 GIVGILKR-NYGVERY-GLADIEKHAQ------KGDIVHVETPINPFGTSLDISELAR-- 161
            ++   K+ ++ V  +   +D EK         K D V +E+P NP    +DI  + R  
Sbjct: 115 RLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRFV 174

Query: 162 RAHSKGALLMVDSTFAP----PPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKE 217
           +  S    ++VD+T        PLQ   + G D++  SATKY  GH DL+ GV++ K  E
Sbjct: 175 KCISPDTTVVVDNTMMSGLNCNPLQ--LNPGCDVVYESATKYLNGHHDLMGGVIISKTPE 232

Query: 218 VASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPA-- 275
           +ASKL       G+ ++ ++S+LL+R L+T  +R+ +Q  NA  +  +L +     P   
Sbjct: 233 IASKLYFVINSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLENSCGFKPTRT 292

Query: 276 --LVELYHSSLQTEEFVK--KQLSGGYTPVFSLTFKTEEQCKKFCSSLKL--FQHATSLG 329
               +     L++    K  K  + G   V S    + E  K+  SS KL  +    S G
Sbjct: 293 NKATKTRFVGLRSNPDFKLHKSFNNGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFG 352

Query: 330 GVESLVEWRA-MCDSDID----------QCLVRVSIGCESADDLINDL 366
            V SL+     M  + ID          + LVR+  G E+  DL  DL
Sbjct: 353 CVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDL 400

>Smik_7.89 Chr7 complement(149314..150711) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 99.0 bits (245), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 110/408 (26%), Positives = 182/408 (44%), Gaps = 58/408 (14%)

Query: 4   LETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPN 63
           L+T++++   ++++ +   PP+ +++TF+ D  N              ++  YSR G+P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLSNETA-----------QDYDYSRSGNPT 54

Query: 64  GVRLE---ALFSRFLGGHAICYSCGLGGF---LGVMVHFN------PKRVFMDQCYHGVQ 111
              L+       R    + +  S G+      L  +V FN      P  +  D  Y G Q
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLFNGTDNHTPTIIAGDDLYGGTQ 114

Query: 112 GIVGILKR-NYGVERY-GLADIEKHAQ------KGDIVHVETPINPFGTSLDISELAR-- 161
            ++   K+ ++ V  +   +D EK         K D V +E+P NP    +DI  + R  
Sbjct: 115 RLLNFFKQQSHAVSVHVDTSDFEKFKTVFQSLDKVDCVLLESPTNPLCKVVDIPRILRFV 174

Query: 162 RAHSKGALLMVDSTFAP----PPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKE 217
           +  S    ++VD+T        PLQ   D G D++  SATKY  GH DL+ GV++ K  E
Sbjct: 175 KCISPETTVVVDNTMMSGLNCNPLQ--LDPGCDVVYESATKYLNGHHDLMGGVIISKTAE 232

Query: 218 VASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPA-- 275
           +A+KL       G+ ++ ++S+LL+R L+T  +R+ +Q  NA  +  +L D     P   
Sbjct: 233 IAAKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLYQQQRNAMILAHWLEDSCGFKPTET 292

Query: 276 --LVELYHSSLQTEEFVKKQLSGGYTPVFSLTFKTE--EQCKKFCSSLKL--FQHATSLG 329
               +     L++    K   S    P   L+F+T   E  K+  SS KL  +    S G
Sbjct: 293 NKTTKTRFVGLRSNPDFKLHQSFNSGPGAVLSFETGSFEHSKRLVSSKKLSIWAVTVSFG 352

Query: 330 GVESLVEWRA-MCDSDID----------QCLVRVSIGCESADDLINDL 366
            V SL+     M  + ID          + L+R+  G E+  DL  DL
Sbjct: 353 CVNSLLSMPCKMSHASIDPELRKERDFPEDLIRLCCGIENIVDLKKDL 400

>Skud_7.88 Chr7 complement(160235..161632) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 98.2 bits (243), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 110/408 (26%), Positives = 182/408 (44%), Gaps = 58/408 (14%)

Query: 4   LETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPN 63
           L+T++++   ++++ +   PP+ +++TF+ D +N        N D       YSR G+P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN----EAAQNFD-------YSRSGNPT 54

Query: 64  GVRLEALFS---RFLGGHAICYSCGLGGF---LGVMVHFN------PKRVFMDQCYHGVQ 111
              L+       R    + +  S G+      L  +V  N      P  +  D  Y G Q
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLLNGTDNHTPTIIAGDDLYGGTQ 114

Query: 112 GIVGILK-RNYGVERY-GLADIEK------HAQKGDIVHVETPINPFGTSLDISELAR-- 161
            ++   K + + V  +   +D EK         K D V +E+P NP    +DI ++ R  
Sbjct: 115 RLLNFFKHQTHAVTAHVDTSDFEKFKTVFQSVDKVDCVLLESPTNPLCKVVDIPKILRFV 174

Query: 162 RAHSKGALLMVDSTFAP----PPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKE 217
           +  S   +++VD+T        PLQ   +   D++  SATKY  GH DL+ GV++ K  E
Sbjct: 175 KRISPETIVIVDNTMMSGLNCNPLQ--LNPSCDVVYESATKYLNGHHDLMGGVIISKTPE 232

Query: 218 VASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPA-- 275
           +ASKL       G+ ++ ++S+LL+R L+T  +R+ +Q  NA  +  +L +     P   
Sbjct: 233 IASKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLHQQQRNAMILAHWLENSCGFKPTET 292

Query: 276 --LVELYHSSLQTEEFVKKQLSGGYTPVFSLTFKT--EEQCKKFCSSLKL--FQHATSLG 329
               +     L++    K   S    P   L+F+T   E  K+  SS KL  +    S G
Sbjct: 293 NKATKTRFVGLRSNPDFKLHQSFNSGPGAVLSFETGSSEHSKRLVSSKKLNIWAVTVSFG 352

Query: 330 GVESLVEWRA-MCDSDID----------QCLVRVSIGCESADDLINDL 366
            V SL+     M  + ID          + LVR+  G E+  DL  DL
Sbjct: 353 CVNSLLSMPCKMSHASIDPELRKERDFPEDLVRLCCGIENIVDLKKDL 400

>TDEL0B04660 Chr2 complement(828468..829862) [1395 bp, 464 aa] {ON}
           Anc_8.145 YGL184C
          Length = 464

 Score = 94.0 bits (232), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 99/384 (25%), Positives = 166/384 (43%), Gaps = 54/384 (14%)

Query: 24  PINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPNGVRLEALFSRFLG---GHAI 80
           P+ +++TF+ D DN       P     D    YSR G+P    L+    +       H +
Sbjct: 29  PLYLSTTFKVDLDN-------PESQVFD----YSRSGNPTRSLLQYQIGKLYEVPVEHVL 77

Query: 81  CYSCGL--------GGFLGVMVHFNPKRVFMDQCYHGVQGIVGIL--KRNYGVERYGLAD 130
             + G+        G  +    H  P  +  D  Y G   ++  L  K +         D
Sbjct: 78  AVASGMTALDVILRGLVISSATHV-PTIIAGDDLYGGSNRLLAYLESKSHARAVHVDTTD 136

Query: 131 IEKHAQ------KGDIVHVETPINPFGTSLDISELAR--RAHSKGALLMVDSTFAPPPLQ 182
           +EK         K D V +E+P NP    +D+ +L    +  S   +++VD+T       
Sbjct: 137 MEKFKAVFGSLDKVDCVLLESPTNPLCKVVDVPQLVAYVKRISPSTVVIVDNTMMSGLQC 196

Query: 183 NAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLL 242
           N  ++G D++  SATKY  GH D++ G++V K  E+A ++       GS ++ ++S+LL 
Sbjct: 197 NPLEYGCDVVYESATKYLNGHHDIMGGIIVGKTAEIAQEIYYVVNATGSGLSPMDSWLLN 256

Query: 243 RSLRTYDLRIRRQAENATKVVKYLNDH-----KDKYPALVELYHSSLQTEEFVKKQLSGG 297
           R L+T  +R+ +Q  N+  + ++L +       +K  AL   Y   L+T    +   S  
Sbjct: 257 RGLKTLGVRMYQQQYNSMVIAQWLEESCGFKPTEKNSALKTRY-VGLKTNPGFELHRSFN 315

Query: 298 YTPVFSLTFKTE--EQCKKFCSS--LKLFQHATSLGGVESLVEWRA-MCDSDID------ 346
             P   L+F+T   E  ++  +S   +LF    S G V SL+     M  + ID      
Sbjct: 316 KGPGAVLSFETGSLEHSQRIVASKAFQLFSVTVSFGCVNSLISLPCKMSHASIDPEVRKQ 375

Query: 347 ----QCLVRVSIGCESADDLINDL 366
               + L+R+ +G E   DL  DL
Sbjct: 376 REFPEDLIRLCVGIEDVGDLQKDL 399

>ZYRO0G19162g Chr7 (1590120..1591487) [1368 bp, 455 aa] {ON} similar
           to uniprot|P53101 Saccharomyces cerevisiae YGL184C STR3
           Cystathionine beta-lyase converts cystathionine into
           homocysteine
          Length = 455

 Score = 92.8 bits (229), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 95/361 (26%), Positives = 160/361 (44%), Gaps = 61/361 (16%)

Query: 56  YSREGHPNGVRLEALFSRFLGG---------HAICYSCGLGGFLGVM-------VHFNPK 99
           YSR G+P      +L  R LG          HA+  S G+     +M           P 
Sbjct: 43  YSRSGNPT----RSLLHRQLGQLYNVPESQVHAV--SSGMTALDAIMRGLILSNTSHVPT 96

Query: 100 RVFMDQCYHGVQGIVGILK-----RNYGVERYGLADIEK---HAQKGDIVHVETPINPFG 151
            +  D  Y G   ++  LK     R   V+       ++      K D VH+E+P NP  
Sbjct: 97  ILAGDDLYGGSDRLLTFLKTRCHARTINVDTSNFDKFQEAFLSVDKVDCVHIESPTNPMC 156

Query: 152 TSLDISELAR--RAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSG 209
             +D+  +    ++ S    ++VD+T     L N    GAD +  SATK+  GH D+++G
Sbjct: 157 KVVDVPRIISFVKSVSPQTYVIVDNTMMSGLLCNPLSLGADAVYESATKFLNGHHDIMAG 216

Query: 210 VLVVKDKEVASKLKEDRIYL-----GSNIANLESYLLLRSLRTYDLRIRRQAENATKVVK 264
           V+V +++++A     D IY      G  +A ++S+LL+R L+T  +R+ +Q  NA  + +
Sbjct: 217 VVVSRNQKIA-----DAIYFVVNATGCGLAPMDSWLLIRGLKTLSVRLYQQQFNAMVLAE 271

Query: 265 YLND----HKDKYPALVELYHSSLQTE-EF-VKKQLSGGYTPVFSLTFKTEEQCKKFCSS 318
           +L       + K  +L+   +  LQ+  +F + +  + G   V S    +    ++  SS
Sbjct: 272 WLEQSCGFKQSKDNSLLRTRYVGLQSHPQFSLHRSFNDGPGAVLSFETGSTPLSRRIVSS 331

Query: 319 --LKLFQHATSLGGVESLVEWR-AMCDSDID----------QCLVRVSIGCESADDLIND 365
             LK++    S G V SL+    +M  + ID          + L+R+ +G E   DL  D
Sbjct: 332 KALKIWSVTVSFGCVNSLISLPCSMSHASIDPNVRKEREFPEDLIRLCVGIEDIVDLQKD 391

Query: 366 L 366
           L
Sbjct: 392 L 392

>Suva_7.79 Chr7 complement(150082..151479) [1398 bp, 465 aa] {ON}
           YGL184C (REAL)
          Length = 465

 Score = 92.4 bits (228), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 105/408 (25%), Positives = 179/408 (43%), Gaps = 58/408 (14%)

Query: 4   LETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPN 63
           L+T++++   ++++ +   PP+ +++TF+ D +N      +   D+      YSR G+P 
Sbjct: 6   LDTVVVNTGSQNDQHSASVPPVYLSTTFKVDLNN------EAAQDY-----DYSRSGNPT 54

Query: 64  GVRLE---ALFSRFLGGHAICYSCGLGGF---LGVMVHFN------PKRVFMDQCYHGVQ 111
              L+       R    + +  S G+      L  +V  N      P  +  D  Y G Q
Sbjct: 55  RSVLQNQIGKLYRVPQENVLAVSSGMTALDIILRGLVLLNGTEDHTPTIIAGDDLYGGTQ 114

Query: 112 GIVGILK-RNYGVERY-------GLADIEKHAQKGDIVHVETPINPFGTSLDISELAR-- 161
            ++   K + + V  +           + +   K D V +E+P NP    +DI ++ R  
Sbjct: 115 RLLNFFKHQTHAVTVHVDTSNFDRFKTVFQSLDKVDCVLLESPTNPLCKVVDIPKILRYV 174

Query: 162 RAHSKGALLMVDSTFAP----PPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKE 217
           +  S    ++VD+T        PLQ   +   D++  SATKY  GH DL+ GV++ K  E
Sbjct: 175 KCVSPDTKVIVDNTMMSGLNCNPLQ--LNPSCDVVYESATKYLNGHHDLMGGVIISKTAE 232

Query: 218 VASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALV 277
           +ASKL       G+ ++ ++S+LL+R L+T  +R+ +Q  NA  +  +L D     P   
Sbjct: 233 IASKLYFVVNSTGAGLSPMDSWLLVRGLKTLGVRLHQQQRNAMILAHWLEDSCGFKPTAT 292

Query: 278 ELYHSS----LQTEEFVKKQLSGGYTPVFSLTFKTE--EQCKKFCSSLKL--FQHATSLG 329
                +    L++    K   S    P   L+F+T   E  K+  SS KL  +    S G
Sbjct: 293 NKATKTRFVGLRSNPDFKLHQSFNNGPGAVLSFETGSFEHSKRLVSSKKLNIWAVTVSFG 352

Query: 330 GVESL-----------VEWRAMCDSDIDQCLVRVSIGCESADDLINDL 366
            V SL           ++     + D  + LVR+  G E+  DL  DL
Sbjct: 353 CVNSLLSMPCKMSHASIDPEVRKERDFPEDLVRLCCGIENIVDLKKDL 400

>Kwal_47.17221 s47 complement(306099..307490) [1392 bp, 463 aa] {ON}
           YGL184C (STR3) - Cystathionine beta-lyase [contig 211]
           FULL
          Length = 463

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 102/407 (25%), Positives = 176/407 (43%), Gaps = 61/407 (14%)

Query: 4   LETLLLHGDDEHNRVTDVAPPINVASTFRY---DNDNLIPWRDQPNLDFLDENPVYSREG 60
           L +++ H D   + V    PPI  ++TF+    ++D   P+              Y+R G
Sbjct: 12  LVSVVQHSDQHGSSV----PPIYQSTTFKIGSLEDDASQPYD-------------YTRSG 54

Query: 61  HPNGVRLEALFSRFLG---GHAICYSCGLGGF---LGVMVHFN----PKRVFMDQCYHGV 110
           +P    ++    +  G      +  S G+      L  +V  N    P  +  D  Y G 
Sbjct: 55  NPTRTVVQHQIGKLYGVDASQVLAVSSGMTALDVILRALVLTNNSYVPTIIAGDDLYGGT 114

Query: 111 QGIVGILK-RNYG------VERYGLADIEKHAQ-KGDIVHVETPINPFGTSLDISELAR- 161
           Q ++  L+ RN+          Y       +AQ + D V +E+P NP     D+  + R 
Sbjct: 115 QRLLTYLESRNHARVLHVDTTNYDAFTALFNAQPRVDCVLLESPTNPLLKVADLPRITRF 174

Query: 162 -RAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVAS 220
            +  ++  ++ +D+T     L N   F  D++  SATKY  GH D+++G++V +  ++A 
Sbjct: 175 VKQSNEKCVVAIDNTMMSGMLCNPLHFHCDVVYESATKYLNGHHDIMAGIVVARSAQLAG 234

Query: 221 KLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLND------HKDKYP 274
           ++       G  ++  +S+LL+R L+T  +RI +Q  NA  +  +L +      H  K  
Sbjct: 235 EIYFMINSTGCGLSPFDSWLLIRGLKTLGVRIYQQQHNAMVLAHWLENSCGFVSHGKKGK 294

Query: 275 ALVELYHSSLQTE-EF-VKKQLSGGYTPVFSLTFKTEEQCKKFCSS--LKLFQHATSLGG 330
             ++     L++  EF + K  + G   V S    + E  ++  SS  +KL+    S G 
Sbjct: 295 GSLQTRFVGLKSHPEFELHKSFNTGPGAVLSFETGSFEHSRRLVSSKKIKLWAVTVSFGC 354

Query: 331 VESLVEWRA-MCDSDIDQC----------LVRVSIGCESADDLINDL 366
           V SL+     M  + ID            LVR+  G E+  DL NDL
Sbjct: 355 VNSLISMPCKMSHAAIDPALRQERDFPEDLVRLCCGIENIVDLQNDL 401

>KLTH0E06644g Chr5 complement(608116..609498) [1383 bp, 460 aa] {ON}
           highly similar to uniprot|P53101 Saccharomyces
           cerevisiae YGL184C STR3 Cystathionine beta-lyase
           converts cystathionine into homocysteine
          Length = 460

 Score = 88.6 bits (218), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 96/390 (24%), Positives = 166/390 (42%), Gaps = 62/390 (15%)

Query: 23  PPINVASTFRY---DNDNLIPWRDQPNLDFLDENPVYSREGHPNGVRLEALFSRFL---G 76
           PPI  ++TF+    ++D   P+              Y+R G+P    ++    +      
Sbjct: 25  PPIYQSTTFKIGSLEDDASQPYD-------------YTRSGNPTRTVVQHQIGKLYDVDA 71

Query: 77  GHAICYSCGLGGF---LGVMVHFNPKRVFM----DQCYHGVQGIVGILK-RNYG------ 122
              +  S G+      L  +V  N  RV      D  Y G Q ++  L+ RN+       
Sbjct: 72  AQVLAVSSGMTALDVILRALVLTNKSRVPTIIAGDDLYGGTQRLLTHLESRNHARVLHVD 131

Query: 123 -VERYGLADIEKHAQKGDIVHVETPINPFGTSLDISELARRAH-----SKGALLMVDSTF 176
                   ++ K  +  D V +E+P NP    L +++L R  H     ++  L+ +D+T 
Sbjct: 132 TANYETFVEVFKQQEHVDCVLLESPTNPL---LKVADLPRLTHFIKSANEACLVAIDNTM 188

Query: 177 APPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANL 236
               L N   F  D++  SATKY  GH D+++G++V +  ++A ++       GS ++  
Sbjct: 189 MSGMLCNPLKFQCDVVYESATKYLNGHHDIMAGIVVTQTLKMAQEIYFVINSTGSGLSPF 248

Query: 237 ESYLLLRSLRTYDLRIRRQAENATKVVKYLNDH-----KDKYPALVELYHSSLQTE-EF- 289
           +S+LL+R L+T  +R+ +Q  NA  +  +L +      K             L++  +F 
Sbjct: 249 DSWLLVRGLKTLGVRLYQQQHNAMVLAHWLENSCGFVGKKGVKGSPRTRFVGLKSHPQFE 308

Query: 290 VKKQLSGGYTPVFSLTFKTEEQCKKFCSS--LKLFQHATSLGGVESLVEWRA-MCDSDID 346
           + K  + G   V S    + E  ++  SS  +K++    S G V SL+     M  + ID
Sbjct: 309 LHKSFNAGPGAVLSFETGSYEHSRRLVSSRKIKIWAVTVSFGCVNSLISMPCKMSHAAID 368

Query: 347 QC----------LVRVSIGCESADDLINDL 366
                       LVR+  G E+  DL NDL
Sbjct: 369 PALRQERDFPEDLVRLCCGIENISDLQNDL 398

>SAKL0H24882g Chr8 (2167623..2169002) [1380 bp, 459 aa] {ON} highly
           similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 459

 Score = 87.0 bits (214), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 104/398 (26%), Positives = 169/398 (42%), Gaps = 56/398 (14%)

Query: 10  HGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNL-DFLDENPVYSREGHPNGVRLE 68
           H  D+H       PP+  ++TF+           Q +L D  D+   Y+R G+P    L+
Sbjct: 15  HHKDQHG---SSVPPLYQSTTFK-----------QSSLEDDADQEYDYTRSGNPTRSVLQ 60

Query: 69  ALFSRFL---GGHAICYSCGLGGF--------LGVMVHFNPKRVFMDQCYHGVQGIVGIL 117
              ++     G      S G+           LG   H  P  +  D  Y G Q ++  L
Sbjct: 61  EQIAKLYNVPGFQVFAVSSGMTCLDVILRALVLGNSNH-TPTIIAGDDLYGGTQRLLTFL 119

Query: 118 KR-NYG-VERYGLADIEK--HAQKG----DIVHVETPINPFGTSLDISELAR--RAHSKG 167
           +R N+  V      D +K   A  G    D V +E+P NP     D+  L +  +  +  
Sbjct: 120 ERKNHARVIHVDTTDFDKFVSAFNGCGFVDCVVLESPTNPLCKVADLPGLTKFIKQANPK 179

Query: 168 ALLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRI 227
             ++VD+T       N  +F  D++  S TKY  GH D+++GV++ + KE+A +L     
Sbjct: 180 CHVVVDNTMVSGLNCNPLEFQCDVVYESGTKYLNGHHDIMAGVIIGRSKEIAQELYFVIN 239

Query: 228 YLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYP----ALVELYHSS 283
             G  ++ ++ +LL+R L+T  +R+ +Q  NA  + ++L       P     L+   +  
Sbjct: 240 STGCGLSPMDCWLLIRGLKTLSIRLYQQQHNAMILARWLYSSCGFRPNSENKLLRTRYVG 299

Query: 284 LQTEEFVKKQLSGGYTPVFSLTFKTE--EQCKKFCSS--LKLFQHATSLGGVESLVEWRA 339
           L++    +   S    P   L+F T   E  K+  SS  LK++    S G V SL+    
Sbjct: 300 LKSHPQFELHRSFNKGPGAVLSFDTGSFEHSKRLVSSKKLKIWAVTVSFGCVNSLISMPC 359

Query: 340 -MCDSDID----------QCLVRVSIGCESADDLINDL 366
            M  + ID          + LVR+  G E   DL  DL
Sbjct: 360 KMSHASIDPELRKERDFPEDLVRLCCGIEDVKDLQKDL 397

>Ecym_8405 Chr8 (839466..840884) [1419 bp, 472 aa] {ON} similar to
           Ashbya gossypii ACL059C
          Length = 472

 Score = 84.3 bits (207), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 101/409 (24%), Positives = 170/409 (41%), Gaps = 61/409 (14%)

Query: 4   LETLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPN 63
           L T L++   + +      PP+  ++TF+ ++        +P     D    Y+R G+P 
Sbjct: 16  LHTRLVNVTQQKDPYGASVPPLYQSTTFKQESF-------EPGCQEYD----YTRSGNPT 64

Query: 64  GVRLEALFSRF---LGGHAICYSCGLGGFLGVMVHF--------NPKRVFMDQCYHGVQG 112
              +E    +     G   +  S G+     ++            P  +  D  Y G Q 
Sbjct: 65  RSVVERQVGKLYGVCGEQVLAVSSGMSALDVILRSILGSYQAGKTPVVIAGDDLYGGTQR 124

Query: 113 IVGILKRNYGVERYGLADIEKHAQKGDI---------VHVETPINPFGTSLDISELARRA 163
           ++GIL     V+   + D    A+  D+         V +E+P NP     D+ +L    
Sbjct: 125 LLGILGIQGHVKVLHV-DTSDAARFVDVFLSQRNVACVLLESPTNPLMKVADLPKLISFV 183

Query: 164 HS----KGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVA 219
            S     G  ++VD+T       N  + GAD++  SATK+  GH D+++GV+V    E+A
Sbjct: 184 KSHRGGSGCKIVVDNTMVSGINCNPLELGADLVYESATKFLNGHHDIMAGVIVAASVELA 243

Query: 220 SKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVEL 279
             +      +G+ +A ++S+LL+R L+T  +R+ +Q  NA  +  +L D     P     
Sbjct: 244 QDMYFIVNSMGAGLAPMDSWLLIRGLKTLGVRMYQQQHNAMVLAHWLQDSCGFAPT---E 300

Query: 280 YHSSLQTE--------EF-VKKQLSGGYTPVFSL-TFKTEEQCKKFCS-SLKLFQHATSL 328
            +S L+T         +F + +  + G   V S+ T   E   K  CS   K +    S 
Sbjct: 301 QNSQLRTRFVGLKSHPQFHLHRSFNSGPGAVLSIETGDIELSEKIVCSKKFKYWNVTVSF 360

Query: 329 GGVESLVEWRA-MCDSDID----------QCLVRVSIGCESADDLINDL 366
           G V SL+     M  + ID          + L+R+  G E   DL  DL
Sbjct: 361 GCVNSLISMPCKMSHASIDPELRKDRKFPEDLIRICCGIEDVSDLQWDL 409

>Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}
           similar to Ashbya gossypii ADL031W
          Length = 444

 Score = 84.0 bits (206), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 114/442 (25%), Positives = 172/442 (38%), Gaps = 93/442 (21%)

Query: 5   ETLLLHG--DDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENP---VYSRE 59
           +TL LH   D   N     A PI   S++ + N        Q   D    N    +YSR 
Sbjct: 6   DTLQLHAGQDASANSGNPRAVPIYATSSYVFKNS-------QHGADLFGLNTPGYLYSRM 58

Query: 60  GHPNGVRLEALFSRFLGGHAICYSCGLGGF-----LGVMVHFNPKRVFMDQCYHGVQGIV 114
           G+P    LE   +   GG   C +   G       LG +       V     Y G    +
Sbjct: 59  GNPTVDVLEKRLAALEGGRG-CVAVASGQAAQAMALGALAQVGDNIVTSSHLYGGTYNQL 117

Query: 115 GILKRNYGVE-RYGLA-DIEKHAQ----KGDIVHVETPINPFGTSLDISELARRAHSKGA 168
            +  +  GVE R+    + E + Q    K   ++VE+  NP  T  D  ++   AH  G 
Sbjct: 118 KVAFKRLGVEVRFSEGGEAEDYEQLFDDKTKALYVESIGNPKYTVPDFEKITEVAHKHGI 177

Query: 169 LLMVDSTF-APPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLV---------VKDK-- 216
            ++VD+TF A        +FGAD+I HSATK+  GH   ++G +V           DK  
Sbjct: 178 PVVVDNTFGAAGFFCKPIEFGADIITHSATKWINGHGTAIAGAIVDSGNFPWTQYPDKFP 237

Query: 217 --EVASKLKEDRIY--------------------LGSNIANLESYLLLRSLRTYDLRIRR 254
                ++     +Y                    LGS ++   ++L L+ L T  LR  R
Sbjct: 238 QFSQPAESYHGMVYNDNFGPLAFIAYVRLELLRDLGSTMSPFTAFLSLQGLETLSLRCER 297

Query: 255 QAENATKVVKYLNDHKD----KYPALVELYHSSLQTEEFVKKQLSGGYTPVFSLTFKT-- 308
            A N+  + ++L D        YP L      S  +    KK L+ G   + S   K   
Sbjct: 298 HARNSIDLARHLEDSPYVAWVSYPGL-----DSHPSRNNAKKYLTNGAGGMLSFGIKPFD 352

Query: 309 ----EEQCK---------KFCSSLKLFQHATSLGGVESLV------EWRAMCDSD----- 344
               EE+           KF  SLKL  +  ++G  ++LV        + + D +     
Sbjct: 353 KTNGEEEASEVDTSVIAAKFVDSLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEKLKAG 412

Query: 345 IDQCLVRVSIGCESADDLINDL 366
            D+ ++RVS+G E  DD+I D 
Sbjct: 413 ADKDVIRVSVGTEYIDDIIADF 434

>NCAS0A05810 Chr1 (1143717..1145060) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 82.8 bits (203), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 102/395 (25%), Positives = 158/395 (40%), Gaps = 84/395 (21%)

Query: 55  VYSREGHPNGVRLEALFSRFLGGHA-ICYSCGLGG---FLGVMVHFNPKRVFMDQCYHGV 110
           VYSR  +P     E   +   GG A +  S G       +  + H     V     Y G 
Sbjct: 55  VYSRFQNPTNNVFEERIAALEGGAAAVAVSSGQAAQTLAISGLAHVGDNIVSTSYLYGGT 114

Query: 111 QGIVGILKRNYGVE-RY----GLADIEK-HAQKGDIVHVETPINPFGTSLDISELARRAH 164
                +  +  GVE R+      AD EK   ++   V++E+  NP     D   +   AH
Sbjct: 115 YNQFKVAFKRLGVEARFVDGDNPADFEKLFDERTKAVYLESIGNPKYNVPDFEGIVAVAH 174

Query: 165 SKGALLMVDSTFAP-----PPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKD---- 215
             G  ++VD+TF        PL+    FGAD++ HSATK+  GH   ++GV+V       
Sbjct: 175 KHGIPVVVDNTFGAGGFFCQPLK----FGADIVTHSATKWIGGHGTTVAGVVVDSGKFPW 230

Query: 216 KEVASKLKE-------------DRIY----------------LGSNIANLESYLLLRSLR 246
           K+   K  +             +  Y                LG  +    ++LLL+ + 
Sbjct: 231 KDYPEKFPQFSKPAEGYHGTIFNETYGNLAYIVHVRVELLRDLGPGMNPFAAFLLLQGVE 290

Query: 247 TYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQT---EEFVKKQLSGGYTPVFS 303
           T  LR  R A NA  + K+L    +K P +  + +  L++    E  KK LS G+  V S
Sbjct: 291 TLSLRCERHASNALALAKWL----EKSPYVSWVSYPGLESHSHHENAKKYLSNGFGGVLS 346

Query: 304 LTFK-----TEEQCKK---------FCSSLKLFQHATSLGGVESLV-----EWRAMCDSD 344
              K     +EE+ KK            SL+L  +  ++G  ++LV           D D
Sbjct: 347 FGVKDLPNQSEEEVKKNPFAASGAQVVDSLQLASNLANVGDSKTLVIAPYFTTHQQLDDD 406

Query: 345 ------IDQCLVRVSIGCESADDLINDLSTVLSQL 373
                 + + L+RVS+G E  DD+I D      ++
Sbjct: 407 EKLLSGVTKDLIRVSVGTEFIDDIIGDFQQSFEKV 441

>ACL059C Chr3 complement(259732..261093) [1362 bp, 453 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL184C
           (STR3)
          Length = 453

 Score = 80.9 bits (198), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 114/249 (45%), Gaps = 21/249 (8%)

Query: 143 VETPINPFGTSLDISELAR--RAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           +E+P NP     D+  L    +AH+ G  ++VD+T       N    GAD +  SATKY 
Sbjct: 148 LESPTNPLMKVADVPALVAHVKAHAPGCRVVVDNTMMSGLNCNPLRLGADYVYESATKYL 207

Query: 201 AGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENAT 260
            GH D+++GV+V   + +A +       +G+ +A ++++LL+R L+T  LR+ +Q  NA 
Sbjct: 208 NGHHDIMAGVIVAATRALAEEAYFVVNSVGAGLAPMDAWLLIRGLKTLSLRLYKQQHNAM 267

Query: 261 KVVKYLND----HKDKYPALVELYHSSLQTEEFVKKQLSGGYTPVFSLTFKTEEQC---K 313
            +  +L +            ++     L++    K   S    P   L+ +T +     +
Sbjct: 268 VLAHWLREVCGFRAVGGNHALQTRFVGLRSHPQHKLHRSFNRGPGAVLSIQTGDTALSER 327

Query: 314 KFCS-SLKLFQHATSLGGVESLVEWRA-MCDSDID----------QCLVRVSIGCESADD 361
             CS  L+ +    S G V SL+     M  + ID          + L+R+S G E  +D
Sbjct: 328 IVCSKKLQFWGVTVSFGCVNSLISMPCRMSHASIDPELRKARQFPEDLIRLSCGVEDVED 387

Query: 362 LINDLSTVL 370
           L  DL   L
Sbjct: 388 LQQDLLAAL 396

>KLLA0C17028g Chr3 complement(1487806..1489188) [1383 bp, 460 aa]
           {ON} similar to uniprot|P53101 Saccharomyces cerevisiae
           YGL184C STR3 Cystathionine beta-lyase converts
           cystathionine into homocysteine
          Length = 460

 Score = 79.0 bits (193), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 81/301 (26%), Positives = 131/301 (43%), Gaps = 33/301 (10%)

Query: 98  PKRVFMDQCYHGVQGIVGILK-RNYG-VERYGLADIEKHAQ------KGDIVHVETPINP 149
           P  +  D  Y G Q ++  L+ RN+  V      D E   +      + DIV +E+P NP
Sbjct: 96  PTIIAGDDLYGGTQRLLTFLQTRNHAKVIHTDTTDAESFIKLYNSLGQVDIVLLESPTNP 155

Query: 150 FGTSLDISELARRAHSKGA-----LLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHS 204
                D+  L +    KG       ++VD+T       N   FGAD++  S TKY  GH 
Sbjct: 156 LMKVADLPRLCQFVKQKGGSSSNCKIVVDNTMMSGLNSNPLQFGADVVYESGTKYLNGHH 215

Query: 205 DLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVK 264
           D+++GV++ K K+VA  +       G+ ++ ++S+LL+R L+T  +R+ +Q  NA  +  
Sbjct: 216 DIMAGVIIAK-KDVAPSVYFVINSTGAGLSPMDSWLLIRGLKTLSVRLYKQQINAMVLSH 274

Query: 265 YLND-----HKDKYPALVELYHSSLQTEEF-VKKQLSGGYTPVFSLTFKTEEQCKKFCSS 318
           +L D       D    L   +       +F + K  + G   V S+        +   +S
Sbjct: 275 WLQDICGFKPTDNNQQLKTRFVGLESHPQFELHKSFNNGPGAVLSIETGDLALSEAIVTS 334

Query: 319 --LKLFQHATSLGGVESLVEWRA-MCDSDID----------QCLVRVSIGCESADDLIND 365
             L ++    S G V SL+     M  + ID          + L+R+  G E   DL  D
Sbjct: 335 KRLNIWAVTVSFGCVNSLISMPCKMSHASIDPELRKQRAFPEDLIRLCCGIEDVKDLQYD 394

Query: 366 L 366
           L
Sbjct: 395 L 395

>KNAG0I02920 Chr9 (573008..574345) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 83/311 (26%), Positives = 125/311 (40%), Gaps = 80/311 (25%)

Query: 130 DIEK-HAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAP-----PPLQN 183
           D EK   ++   V++E+  NP     D  ++   AH  G  +MVD+TF        PL+ 
Sbjct: 139 DFEKVFDERTKCVYLESIGNPKYNVPDFEKIVAVAHKHGIPVMVDNTFGAGGFFCQPLK- 197

Query: 184 AWDFGADMIMHSATKYFAGHSDLLSGVLVVKDK--------------------------- 216
              +GAD++ HSATK+  GH   L G++V   K                           
Sbjct: 198 ---YGADIVTHSATKWIGGHGTTLGGIIVDSGKFPWKDYPEKFPQFSKPAEGYHGTIYNE 254

Query: 217 ---------EVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLN 267
                     V ++L  D   LGS I+   ++LL++ + T  LR  R  +NA K+ K+L 
Sbjct: 255 AYGNLAYIVHVRTELLRD---LGSMISPFAAFLLIQGVETLSLRGERHGQNALKLAKWLE 311

Query: 268 DHKD----KYPALVELYHSSLQTEEFVKKQLSGGYTPVFSLTFK------TEEQCKKFCS 317
                    YP L    H      E  KK LS G+  + S   K      TE    K   
Sbjct: 312 ASPYVSWVSYPGLPSHSH-----HENAKKYLSNGFGGMLSFGVKDLPNAATETDPFKLSG 366

Query: 318 S-----LKLFQHATSLGGVESLV------EWRAMCD-----SDIDQCLVRVSIGCESADD 361
           +     LKL  +  ++G  ++LV          + D     S + + L+RVS+G E  DD
Sbjct: 367 AQVVDNLKLASNLANVGDSKTLVIAPFFTTHEQLADEEKLASGVTKDLIRVSVGTEYIDD 426

Query: 362 LINDLSTVLSQ 372
           +I D      +
Sbjct: 427 IIEDFKQAFEK 437

>KAFR0F03070 Chr6 (610571..611908) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 76.6 bits (187), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 82/305 (26%), Positives = 125/305 (40%), Gaps = 80/305 (26%)

Query: 130 DIEKHA-QKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAP-----PPLQN 183
           D EK   ++   V++E+  NP     D  ++   AH  G  +MVD+TF        P++ 
Sbjct: 139 DFEKQFDERTKCVYLESIGNPKYNVPDFEKIVAVAHKHGIPVMVDNTFGAGGFFCQPIK- 197

Query: 184 AWDFGADMIMHSATKYFAGHSDLLSGVLVVKDK--------------------------- 216
              +G D++ HSATK+  GH   L GV++   K                           
Sbjct: 198 ---YGVDIVTHSATKWIGGHGTTLGGVIIDSGKFPWKDYPEKFPQFSKPAEGYHGTIYNE 254

Query: 217 ---------EVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLN 267
                     V ++L  D   LGS ++   ++LLL+ + T  LR  R  ENA K+ K+L 
Sbjct: 255 AYGNLAYIVHVRTELLRD---LGSLMSPFAAFLLLQGVETLSLRGERHGENALKLAKWLE 311

Query: 268 DHKD----KYPALVELYHSSLQTEEFVKKQLSGGYTPVFSLTFK------TEEQCKKFCS 317
                    YP L    H      E  KK LS G+  + S   K      TE    K   
Sbjct: 312 QSPYVSWVSYPGLPSHSH-----HENAKKYLSNGFGGMLSFGVKDLPNADTETDPFKLSG 366

Query: 318 S-----LKLFQHATSLGGVESLV------EWRAMCD-----SDIDQCLVRVSIGCESADD 361
           +     LK+  +  ++G  ++LV        + + D     S + + L+RVS+G E  DD
Sbjct: 367 AQVVDNLKIASNLANVGDSKTLVIAPYFTTHQQLNDEEKLASGVTKDLIRVSVGTEFIDD 426

Query: 362 LINDL 366
           +IND 
Sbjct: 427 IINDF 431

>TBLA0C04400 Chr3 (1062021..1063358) [1338 bp, 445 aa] {ON} Anc_4.53
           YLR303W
          Length = 445

 Score = 75.1 bits (183), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 82/309 (26%), Positives = 125/309 (40%), Gaps = 74/309 (23%)

Query: 130 DIEK-HAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAP-----PPLQN 183
           D EK   +K   V++ET  NP     D  ++   AH  G  ++VD+TF        P++ 
Sbjct: 139 DFEKLFDEKTKAVYLETIGNPKYNVPDFDKIVAVAHKHGIPVVVDNTFGAGGFFCQPIK- 197

Query: 184 AWDFGADMIMHSATKYFAGHSDLLSGVLVVKD----KEVASKL----KEDRIY------- 228
              +GAD++ HSATK+  GH   ++G ++       KE   K     K    Y       
Sbjct: 198 ---YGADIVTHSATKWIGGHGTTIAGAIIDSGKFPWKEYPEKFPQFSKPSEGYHGMIFNE 254

Query: 229 ------------------LGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHK 270
                             LG  ++   S+LLL+ + T  LR  RQ EN   + K+L    
Sbjct: 255 AMGNLAFIGHVRTELLRDLGPCMSPFASFLLLQGVETLSLRAERQGENTLALAKWLEKSA 314

Query: 271 D----KYPALVELYHSSLQTEEFVKKQLSGGYTPVFSLTFK----TEEQCKKFCSS---- 318
                 YP LV   H      E  KK L  G+  V S   K      E+   F ++    
Sbjct: 315 YVSWVSYPGLVSHSH-----HENAKKYLRNGFGGVLSFGVKDLPGAAEEKDPFKAAGAQA 369

Query: 319 ---LKLFQHATSLGGVESLV------EWRAMCD-----SDIDQCLVRVSIGCESADDLIN 364
              LKL  +  ++G  ++LV        + + D     S + + L+RVS+G E  DD+I 
Sbjct: 370 VDNLKLASNLANVGDSKTLVIAPYFTTHQQLSDEEKLASGVTKDLIRVSVGTEFIDDIIA 429

Query: 365 DLSTVLSQL 373
           D      ++
Sbjct: 430 DFQQSFEKI 438

>Skud_19.6 Chr19 complement(5562..6767) [1206 bp, 401 aa] {ON}
           YFR055W (REAL)
          Length = 401

 Score = 74.3 bits (181), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 92/387 (23%), Positives = 151/387 (39%), Gaps = 32/387 (8%)

Query: 6   TLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPNGV 65
           T++    DE N    V PP+   ST  +        +   +++ +     Y   G P   
Sbjct: 17  TVIGRNPDEQNGF--VNPPLYKGSTIIH--------KKLDDVEHMKGRFFYGTAGSPTIA 66

Query: 66  RLEALFSRFLGGHAICYS-CGLGGF---LGVMVHFNPKRVFMDQCYHGVQGIVGILKRNY 121
            LE  ++   GG     S  GLG     L  +       +  D  Y   + +   L   +
Sbjct: 67  NLEDAWTHLTGGAGTVLSPSGLGSISLALLTLAKAGDHILITDSVYVPTRMLCDGLLAKF 126

Query: 122 GVER--YGLA---DIEKHAQKGD-IVHVETPINPFGTSLDISELARRAHSKGALLMVDST 175
           G+E   Y  +   DI+K  +    ++ +E+P +      DI  L   A   G   ++D+T
Sbjct: 127 GIETEYYDPSVGEDIKKLIKPNTTVIFLESPGSGTMEIQDIPALVSVAKKHGIKTILDNT 186

Query: 176 FAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIAN 235
           +A P   +A   G D+ + + TKY  GHSDLL G L   ++E    L+     +      
Sbjct: 187 WATPLFFDAHGHGIDISLEAGTKYLGGHSDLLIG-LTSANEECWPLLRSTYDAMAMLPGA 245

Query: 236 LESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTEEFVKKQLS 295
            +  L LR +RT  LR++     A  +  +L D  +    L   +      E +V+    
Sbjct: 246 DDCLLALRGMRTLHLRLKEAERKALDLAAWLEDRDEVEKVLHPAFKDCPGHEYWVRDY-- 303

Query: 296 GGYTPVFSLTFK---TEEQCKKFCSSLKLFQHATSLGGVESLV------EWRAMCDSDID 346
            G + +FS+  K   T    +     +K+F    S GG ESL+        R   +    
Sbjct: 304 KGSSGLFSIVLKDGYTRTGLENMVEKMKVFHLGFSWGGYESLITPVNPARQRKAANWPHR 363

Query: 347 QCLVRVSIGCESADDLINDLSTVLSQL 373
              +R+ +G E   DL  DL     +L
Sbjct: 364 GFALRIQVGLEELTDLKRDLELGFERL 390

>TPHA0F00420 Chr6 complement(103419..104747) [1329 bp, 442 aa] {ON}
           Anc_4.53 YLR303W
          Length = 442

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 75/310 (24%), Positives = 131/310 (42%), Gaps = 77/310 (24%)

Query: 130 DIEK-HAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAP-----PPLQN 183
           D EK   +K   V++E+  NP     D  ++   AH  G  ++VD+TF        P+++
Sbjct: 139 DFEKLFDEKTKAVYIESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGGFFCQPIKH 198

Query: 184 AWDFGADMIMHSATKYFAGHSDLLSGVLVVKDK--------------------------- 216
               G D++ HSATK+  GH   ++GV+V   K                           
Sbjct: 199 ----GVDIVTHSATKWIGGHGTTIAGVIVDSGKFPWKDYPEKFPQFSKPSEGYHGMIFND 254

Query: 217 ---------EVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLN 267
                     V ++L  D   LG  +  + ++LLL+ + T  LR  RQ +NA K+ ++L 
Sbjct: 255 AMGPLAYIAHVRTELLRD---LGPVMEPIAAFLLLQGVETLSLRAERQGQNALKLAQWL- 310

Query: 268 DHKDKYPALVELYHSSLQTEEF---VKKQLSGGYTPVFSLTFKT----------EEQCKK 314
              +K P +  + +  L +  +    KK L  G+  V S+  K           ++   +
Sbjct: 311 ---EKSPHVNWVSYPGLPSHPYHDNAKKYLDNGFGGVLSIGVKPLKDVSDSDPFKKSGAQ 367

Query: 315 FCSSLKLFQHATSLGGVESLV------EWRAMCDSD-----IDQCLVRVSIGCESADDLI 363
              +LKL  +  ++G  ++LV        + + D D     + + L+R+SIG E  DD+I
Sbjct: 368 VVDNLKLALNLANVGDSKTLVIAPYFTTHQQLSDEDKLKSGVTEDLIRISIGTEFIDDII 427

Query: 364 NDLSTVLSQL 373
            D      ++
Sbjct: 428 ADFEQSFEKV 437

>NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 72.8 bits (177), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 124/304 (40%), Gaps = 76/304 (25%)

Query: 137 KGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAP-----PPLQNAWDFGADM 191
           K   V++E+  NP     D  ++   AH  G  ++VD+TF        P++    +GAD+
Sbjct: 147 KTKAVYLESIGNPKYNVPDFEKIVEIAHKHGVPVVVDNTFGAGGFFCQPIK----YGADI 202

Query: 192 IMHSATKYFAGHSDLLSGVLVVKDKEVASKLKE-----------------DRIY------ 228
           + HSATK+  GH   ++G++V   K   +   E                 +  Y      
Sbjct: 203 VTHSATKWIGGHGTTIAGMIVDSGKFPWADYPEKFPQFSKPAEGYHGTIFNEAYGNLAYI 262

Query: 229 ----------LGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKD----KYP 274
                     LG  I+   ++LL++ + T  LR  R  +NA K+ ++L          YP
Sbjct: 263 VHVRVELLRDLGPAISPFAAFLLIQGIETLSLRGERHGQNALKLAQWLEQSPYVSWVSYP 322

Query: 275 ALVELYHSSLQTEEFVKKQLSGGYTPVFSLTFK-----TEEQ--CKKFCS-------SLK 320
            L      S    E  KK LS G+  V S   K     T+E+   K F +       SLK
Sbjct: 323 GL-----PSHPYHENAKKYLSNGFGGVLSFGVKDIPGQTKEELAAKPFSASGAQVVDSLK 377

Query: 321 LFQHATSLGGVESLV-----EWRAMCDSD------IDQCLVRVSIGCESADDLINDLSTV 369
           L  +  ++G  ++LV           D D      + + L+RVS+G E  DD+I D    
Sbjct: 378 LASNLANVGDSKTLVIAPYFTTHEQLDDDEKLLSGVTKDLIRVSVGTEFIDDIIADFQQS 437

Query: 370 LSQL 373
             ++
Sbjct: 438 FEKV 441

>TDEL0D06630 Chr4 complement(1200459..1201667) [1209 bp, 402 aa]
           {ON}  YFR055W
          Length = 402

 Score = 72.0 bits (175), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 87/357 (24%), Positives = 142/357 (39%), Gaps = 35/357 (9%)

Query: 44  QPNLDFLDE---NPVYSREGHPNGVRLEALFSRFLGGHAICYS-CGLG----GFLGVMVH 95
            PNL+ L+       Y   G P    LE  ++   G      S  GLG      L V+ H
Sbjct: 42  HPNLESLESLGGRFWYGTAGSPTIANLEDSWTELTGAAGTVLSPTGLGSISLAILSVVKH 101

Query: 96  FNPKRVFMDQCYHGVQGIVGILKRNYGV--ERYGL---ADIEKHAQKG-DIVHVETPINP 149
            +   +     Y         + R +GV  E Y      DIE+  +    ++ +E+P + 
Sbjct: 102 GD-HILLPISVYGPTANFCNNVLRKFGVNSEFYDPLIGKDIEELIKTNTSLIFLESPCSQ 160

Query: 150 FGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSG 209
                D+  + + A       ++D+T+A P    A D+G D+ + + TKY  GHSDLL G
Sbjct: 161 TMEIQDVPAIVKVAKKHNVKTVLDNTWATPLFFKAHDYGIDISVEAGTKYVGGHSDLLLG 220

Query: 210 VLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDH 269
            L   +      L+     +G      + +L LR LRT  LR++     A  + ++L   
Sbjct: 221 -LTSANSRCWPALRSTYDAMGMLPGADDCHLALRGLRTLQLRVKEAERKALILAEWLEAR 279

Query: 270 KDK----YPALVELYHSSLQTEEFVKKQLSGGYTPVFSLTFK---TEEQCKKFCSSLKLF 322
            +     +PA  +    SL   ++       G T VF+   K   +    K     +++F
Sbjct: 280 NEVERILHPAFEDCPGHSLWVRDY------SGSTGVFTFILKDQFSRAGLKDMLEKMQIF 333

Query: 323 QHATSLGGVESLVEWRAMCDSDIDQCL------VRVSIGCESADDLINDLSTVLSQL 373
           +   S GG ESL+        D  +        +R+ +G E  DD + DL     +L
Sbjct: 334 KLGYSWGGYESLLIPVNSTSRDRIRTWSHFGYALRIQVGLEDIDDQLRDLEMGFERL 390

>SAKL0H23892g Chr8 (2059083..2060411) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 442

 Score = 71.6 bits (174), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 77/308 (25%), Positives = 125/308 (40%), Gaps = 72/308 (23%)

Query: 130 DIEKHA-QKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAP-----PPLQN 183
           D EK   +K   +++E+  NP     D  ++   AH  G  ++VD+TF        P++ 
Sbjct: 138 DFEKQFDEKTKALYLESIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGFFCQPIK- 196

Query: 184 AWDFGADMIMHSATKYFAGHSDLLSGVLVVKDK--------EVASKLKEDRIY------- 228
              +GAD++ HSATK+  GH   ++G ++   K        +     K    Y       
Sbjct: 197 ---WGADIVTHSATKWIGGHGTTIAGAIIDSGKFPWKDYPEKFPQFSKPSEGYHGLVFND 253

Query: 229 ------------------LGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHK 270
                             LG  ++   S+LLL+ L T  LR  R A NA K+ ++L    
Sbjct: 254 AFGPLAFIGHARTELLRDLGPALSPFSSFLLLQGLETLSLRGERHAYNALKLAQWL---- 309

Query: 271 DKYPALVELYHSSLQTE---EFVKKQLSGGYTPVFSLTFK----TEEQCKKFCSS----- 318
           +K P +  + +  L++    E  KK L  G+  V S   K      E+   F +S     
Sbjct: 310 EKSPYVSWVSYPGLESHTHHENAKKYLQNGFGGVLSFGVKPLPNASEESDPFKASGAQVV 369

Query: 319 --LKLFQHATSLGGVESLV-----------EWRAMCDSDIDQCLVRVSIGCESADDLIND 365
             LKL  +  ++G  ++LV                  S +   L+RVS+G E  DD+I D
Sbjct: 370 DNLKLASNLANVGDSKTLVIAPYFTTHQQLSHEEKLASGVTDDLIRVSVGTEFIDDIIAD 429

Query: 366 LSTVLSQL 373
                 ++
Sbjct: 430 FEQSFEKI 437

>Smik_7.375 Chr7 (620194..621399) [1206 bp, 401 aa] {ON} YFR055W
           (REAL)
          Length = 401

 Score = 70.1 bits (170), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 79/337 (23%), Positives = 135/337 (40%), Gaps = 22/337 (6%)

Query: 56  YSREGHPNGVRLEALFSRFLGGHAICYS-CGLGGFLGVMVHFNPKR---VFMDQCYHGVQ 111
           Y   G P    LE  ++   G      S  GLG     ++  +      +  D  Y   +
Sbjct: 57  YGTAGSPTIANLEDAWTHLTGSAGTVLSPSGLGSISLALLTLSKAGDHILITDSVYFPTR 116

Query: 112 GIVGILKRNYGVER--YGLA---DIEKHAQKGD-IVHVETPINPFGTSLDISELARRAHS 165
            +   L   +G+E   Y  +   DIEK  +    ++ +E+P +      +I  L   A  
Sbjct: 117 MLCDGLLAKFGIETEYYDPSIGEDIEKLVKPNTTVIFLESPGSGTMEIQNIPALVSVAKK 176

Query: 166 KGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKED 225
            G   ++D+T+A P   +A   G D+ + + TKY  GHSDLL G LV  ++E    L+  
Sbjct: 177 HGIKTILDNTWATPLFFDAHGHGIDISLEAGTKYLGGHSDLLLG-LVSANEECWPLLRST 235

Query: 226 RIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQ 285
              +       +  L LR +RT  LR++     A  +  +     +    L   +     
Sbjct: 236 YDAMAMLPGADDCLLALRGMRTLHLRLKEAERKALDLAAWFKKRDEVEKVLHPAFEDCPG 295

Query: 286 TEEFVKKQLSGGYTPVFSLTFK---TEEQCKKFCSSLKLFQHATSLGGVESLV------E 336
            E +V+     G + +FS+  K   T    +    ++K+F+   S GG +SL+       
Sbjct: 296 HEYWVRDY--KGSSGLFSIVLKDGFTRSGLENMVDNMKVFELGYSWGGYDSLITPVNPPT 353

Query: 337 WRAMCDSDIDQCLVRVSIGCESADDLINDLSTVLSQL 373
            R       +   +R+ +G E  +DL  DL     +L
Sbjct: 354 QRKAAPWSHNGFALRIQVGLEELEDLKRDLELGFERL 390

>KLTH0G00418g Chr7 complement(23130..24836) [1707 bp, 568 aa] {ON}
           similar to uniprot|Q12198 Saccharomyces cerevisiae
           YLL058W Hypothetical ORF
          Length = 568

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 119/251 (47%), Gaps = 22/251 (8%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V +ETP NP     D+ +L   A+  G  ++VD T     L       AD++  S TK F
Sbjct: 320 VFLETPSNPMLNMPDLKQLRNMANEYGFFIVVDDTIGG--LNVDVLPYADIVCTSLTKLF 377

Query: 201 AGHSDLLSGVLVVKDKEV--ASKLKEDRIYLGSNIANLESYLLLRS-LRTYDLRIRRQAE 257
           +G S+++ G +++  K    +  L+  R      +  LE  ++L +  R ++ R  R  E
Sbjct: 378 SGSSNVMGGSIILNPKSALYSCALQYFRGGEFEELLWLEDAIILEANSRDFEERTTRTNE 437

Query: 258 NATKVVKYLNDHKDKYPALVELYHSSLQTEEFVK-----KQLSGGYTPVFSLTFKTEEQC 312
           N  K+++ +    ++     ++Y+ ++ ++E  K     +   GGY  +FSL+F  EE  
Sbjct: 438 NTMKLIQEV-LLPEEGKIFKKVYYPTVSSKETFKNFESVRTNGGGYGSLFSLSFFNEEDA 496

Query: 313 KKFCSSLKLFQHATSLGGVESLV----------EWRAMCDSDIDQCLVRVSIGCESADDL 362
           KKF +SL +F+   S G   +L           E   +        LVRVS+G E+   L
Sbjct: 497 KKFYNSLTVFK-GPSNGTNFTLACPYVHLAHHFELEEVSTFGAHSSLVRVSVGLENTQWL 555

Query: 363 INDLSTVLSQL 373
           +N  S+V++ L
Sbjct: 556 LNAFSSVINLL 566

>Kpol_1041.44 s1041 (117344..118678) [1335 bp, 444 aa] {ON}
           (117344..118678) [1335 nt, 445 aa]
          Length = 444

 Score = 68.6 bits (166), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 77/311 (24%), Positives = 125/311 (40%), Gaps = 78/311 (25%)

Query: 130 DIEK-HAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAP-----PPLQN 183
           D EK   +K   V++ET  NP     D  ++   AH  G  ++VD+TF        P++ 
Sbjct: 139 DFEKLFDEKTKAVYLETIGNPKYNVPDFEKITEVAHKHGIPVVVDNTFGAGGYFCQPIK- 197

Query: 184 AWDFGADMIMHSATKYFAGHSDLLSGVLVVKDK--------------------------- 216
              +G D++ HSATK+  GH   ++G ++   K                           
Sbjct: 198 ---YGCDIVTHSATKWIGGHGTTVAGAIIDSGKFPWKDYPERFPQFSKPSEGYHGLVFND 254

Query: 217 ---------EVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLN 267
                     V ++L  D   LG  +    ++LLL+ + T  LR  R  EN  K+ K+L 
Sbjct: 255 AFGPAAFIGHVRTELLRD---LGPCLDAFSAFLLLQGVETLSLRGERHGENTLKLAKWL- 310

Query: 268 DHKDKYPALVELYHSSLQT---EEFVKKQLSGGYTPVFSLTFK----TEEQCKKFCSS-- 318
              +K P +  + +  L +    E  KK LS G+  V S   K      ++   F +S  
Sbjct: 311 ---EKSPYVSWVSYPGLPSHSHHENAKKYLSNGFGGVLSFGVKDLPNASDEKDPFKASGA 367

Query: 319 -----LKLFQHATSLGGVESLV-----------EWRAMCDSDIDQCLVRVSIGCESADDL 362
                LKL  +  ++G  ++LV                  S + + L+RVS+G E  DD+
Sbjct: 368 QVVDNLKLALNLANVGDSKTLVIAPYFTTHQQLNEEEKLASGVTKDLIRVSVGTEYIDDI 427

Query: 363 INDLSTVLSQL 373
           I D      ++
Sbjct: 428 IADFQQSFEKV 438

>Suva_17.6 Chr17 (9922..11127) [1206 bp, 401 aa] {ON} YFR055W (REAL)
          Length = 401

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 89/387 (22%), Positives = 148/387 (38%), Gaps = 32/387 (8%)

Query: 6   TLLLHGDDEHNRVTDVAPPINVASTFRYDNDNLIPWRDQPNLDFLDENPVYSREGHPNGV 65
           T++    DE N    V PP+   ST  +        +   +++ +     Y   G P   
Sbjct: 17  TVIGRNPDEQNGF--VNPPLYKGSTIIH--------KKLSDVESMKGRFFYGTAGSPTIA 66

Query: 66  RLEALFSRFLGGHAICYS-CGLGGF---LGVMVHFNPKRVFMDQCYHGVQGIVGILKRNY 121
            LE  ++   G      S  GLG     L  +       +  D  Y   + +   L   +
Sbjct: 67  NLEDAWTHLTGAAGTVLSPSGLGSITLALMTLAKAGDHILITDSVYVPTRVLCDGLLAKF 126

Query: 122 GV--ERYGLA---DIEKHAQKG-DIVHVETPINPFGTSLDISELARRAHSKGALLMVDST 175
           G+  E Y      DIEK  +    ++ +E+P +      DI  L   A   G   ++D+T
Sbjct: 127 GIQTEYYDPTVGEDIEKLVKPNTSVIFLESPGSGTMEIQDIPALVSIAKKHGIRTILDNT 186

Query: 176 FAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIAN 235
           +A P   +A   G D+ + + TKY  GHSD L G L   ++E    L+     +      
Sbjct: 187 WATPLFFDAHGHGIDISLEAGTKYLGGHSDFLLG-LTSANQECWPLLRSTYDAMAMLPGA 245

Query: 236 LESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTEEFVKKQLS 295
            +  L LR +RT  LR++     A  +  +L    +    L   +      + +++    
Sbjct: 246 DDCQLALRGMRTLHLRLKEAERKALDLAAWLGKRDEVETVLHPAFEDCPGHKYWLRDY-- 303

Query: 296 GGYTPVFSLTFK---TEEQCKKFCSSLKLFQHATSLGGVESLV------EWRAMCDSDID 346
            G + +FS+  K   T    +     +K+F    S GG ESL+      E R   +    
Sbjct: 304 KGSSGLFSIVLKEGFTRAGLESMVEKMKIFHLGFSWGGYESLITPVKPAEQRKPHNWPHR 363

Query: 347 QCLVRVSIGCESADDLINDLSTVLSQL 373
              +R+ +G E   DL  DL     +L
Sbjct: 364 GFALRIQVGLEELSDLKRDLELGFERL 390

>ADL031W Chr4 (645776..647179) [1404 bp, 467 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR303W (MET17)
          Length = 467

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 73/296 (24%), Positives = 122/296 (41%), Gaps = 63/296 (21%)

Query: 137 KGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTF-APPPLQNAWDFGADMIMHS 195
           K   V +E+  NP     D   +   AH  G  ++VD+TF A         FGAD++ HS
Sbjct: 147 KTKAVFLESIGNPKYNVPDFERIVAVAHRHGIPVVVDNTFGAGGYFCQPIKFGADIVTHS 206

Query: 196 ATKYFAGHSDLLSGVLVVKD----KEVASKLKE-------------------------DR 226
           ATK+  GH   + G++V       K+  +K  +                          R
Sbjct: 207 ATKWIGGHGTAIGGLVVDSGKFPWKDYPAKFPQFSEPSEGYHGLVLNEALGPLAFVGHAR 266

Query: 227 IY----LGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHS 282
           I     LG  ++   ++L L+ L T  LR  R  +NA  + KYL      Y + V   + 
Sbjct: 267 IELLRDLGPALSPFAAFLFLQGLETLSLRAERHGQNALALAKYL--ETSAYVSWVS--YP 322

Query: 283 SLQTEEFVK---KQLSGGYTPVFSLTFK----TEEQC-------KKFCSSLKLFQHATSL 328
            L++ +++    + L  GY  V S   K    T+E+         +F  +LK   +  ++
Sbjct: 323 GLESHDYLSNATRYLQNGYGGVLSFGVKPLPDTDEEADPFKAAGAQFVDNLKFASNLANV 382

Query: 329 GGVESLV------EWRAMCDSD-----IDQCLVRVSIGCESADDLINDLSTVLSQL 373
           G  ++LV        + + +S+     + + L+RVS+G E   D+I D     S +
Sbjct: 383 GDSKTLVIAPYFTTHQQLSESEKLASGVTRDLIRVSVGTEYLQDIIADFEQAFSTV 438

>Kwal_26.7437 s26 complement(365889..367223) [1335 bp, 444 aa] {ON}
           YLR303W (MET17) - O-Acetylhomoserine-O-Acetylserine
           Sulfhydralase [contig 50] FULL
          Length = 444

 Score = 65.5 bits (158), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 119/300 (39%), Gaps = 71/300 (23%)

Query: 137 KGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTF-APPPLQNAWDFGADMIMHS 195
           K   V++E+  NP     D  ++   AH  G  ++VD+TF A       + FGAD+I HS
Sbjct: 147 KTKAVYLESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGGFFAQPFKFGADIITHS 206

Query: 196 ATKYFAGHSDLLSGVLVVKDK------------------------------------EVA 219
           ATK+  GH   + GV+V   K                                     V 
Sbjct: 207 ATKWIGGHGTTIGGVIVDSGKFPWKDYPEKFPQFSQPSEGYHGLIFNDALGPLAYIAHVR 266

Query: 220 SKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKD----KYPA 275
            +L  D   LG  +    ++ LL+ + T  LR  R A NA K+ +YL          YP 
Sbjct: 267 VELLRD---LGPALNPFAAFQLLQGIETLSLRCERHASNALKLAQYLESSPYVSWVSYPG 323

Query: 276 LVELYHSSLQTEEFVKKQLSGGYTPVFSLTFK----TEEQCKKFCS-------SLKLFQH 324
           L    H      E  KK L  G+  V S+  K      E+   F +       SLKL  +
Sbjct: 324 LPSHSH-----HENAKKYLQNGFGGVLSIGVKDLPNASEETDPFAASGAQVVDSLKLASN 378

Query: 325 ATSLGGVESLV------EWRAMCD-----SDIDQCLVRVSIGCESADDLINDLSTVLSQL 373
             ++G  ++LV        + + D     S + + L+R+S+G E  DD+I D      ++
Sbjct: 379 LANVGDSKTLVIAPYFTTHQQLSDEEKLASGVTKDLIRISVGTEFIDDIIGDFEQAFEKV 438

>YFR055W Chr6 (264204..265226) [1023 bp, 340 aa] {ON}
           IRC7Beta-lyase involved in the production of thiols;
           null mutant displays increased levels of spontaneous
           Rad52p foci; expression induced by nitrogen limitation
           in a GLN3, GAT1-dependent manner and by copper levels in
           a Mac1-dependent manner
          Length = 340

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 117/288 (40%), Gaps = 16/288 (5%)

Query: 56  YSREGHPNGVRLEALFSRFLGGHAICYSC-GLGGFLGVMVHFNPKR---VFMDQCYHGVQ 111
           Y   G P    LE  ++   GG     S  GLG     ++  +      +  D  Y   +
Sbjct: 56  YGTAGSPTIDNLENAWTHLTGGAGTVLSASGLGSISLALLALSKAGDHILMTDSVYVPTR 115

Query: 112 GIVGILKRNYGVER--YGLA---DIEKHAQKGD-IVHVETPINPFGTSLDISELARRAHS 165
            +   L   +GVE   Y  +   DIEK  +    ++ +E+P +      DI  L   A  
Sbjct: 116 MLCDGLLAKFGVETDYYDPSIGKDIEKLVKPNTTVIFLESPGSGTMEVQDIPALVSVAKK 175

Query: 166 KGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKED 225
            G   ++D+T+A P   +A   G D+ + + TKY  GHSDLL G L   ++E    L+  
Sbjct: 176 HGIKTILDNTWATPLFFDAHAHGIDISVEAGTKYLGGHSDLLIG-LASANEECWPLLRST 234

Query: 226 RIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQ 285
              +       +  L LR +RT  LR++     A  +  +L +  +    L   +     
Sbjct: 235 YDAMAMLPGAEDCQLALRGMRTLHLRLKEVERKALDLAAWLGNRDEVEKVLHPAFEDCPG 294

Query: 286 TEEFVKKQLSGGYTPVFSLTFK---TEEQCKKFCSSLKLFQHATSLGG 330
            E +V+     G + +FS+  K   T    +K    +K+ Q   S GG
Sbjct: 295 HEYWVRDY--KGSSGLFSIVLKNGFTRAGLEKMVEGMKVLQLGFSWGG 340

>Ecym_5169 Chr5 complement(353237..355282) [2046 bp, 681 aa] {ON}
           similar to Ashbya gossypii AER164C
          Length = 681

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 118/264 (44%), Gaps = 41/264 (15%)

Query: 127 GLADIEKHAQKGDIVH---------VETPINPFGTSLDISELARRAHSKGALLMVDSTFA 177
           G+ D E   Q   I+H         +ETP NP     D+ EL + A +    +++D T  
Sbjct: 404 GMGDSEAMEQLKAILHGGEPILAVFIETPSNPLLKMGDLLELRKLADAYDFYVIIDDTIG 463

Query: 178 PPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANL- 236
                +   + AD++  S TK F+G S++++G LV+       KL   R +   +  +L 
Sbjct: 464 GFINVDVLQY-ADIVCSSLTKIFSGDSNVMAGSLVLNPSSRLYKLAR-RFFASDDYEDLL 521

Query: 237 ---ESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPA----LVELYHSSLQTEEF 289
              +S  L R+ R    R  +  ENA +++K         P       ++Y+ SL + E 
Sbjct: 522 WCEDSIYLERNSRDCVSRSMKINENAERLLK-----GTLLPLEGTLFKKIYYPSLTSSET 576

Query: 290 ------VKKQLSGGYTPVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLV-------- 335
                 VK Q +GGY  +FSLTF  +E  K F +SL L +   SLG   +L         
Sbjct: 577 KANYDAVKCQPNGGYGGLFSLTFFDDECAKAFFNSLDLCK-GPSLGTNFTLACPYTILAH 635

Query: 336 --EWRAMCDSDIDQCLVRVSIGCE 357
             E   +    +++ LVRVSIG E
Sbjct: 636 YGEMDVVAKYGLEKNLVRVSIGLE 659

>TDEL0E05620 Chr5 complement(1043585..1044925) [1341 bp, 446 aa]
           {ON} Anc_4.53 YLR303W
          Length = 446

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 80/307 (26%), Positives = 118/307 (38%), Gaps = 68/307 (22%)

Query: 130 DIEK-HAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTF-APPPLQNAWDF 187
           D EK   ++   V++ET  NP     D   +   AH  G  ++VD+TF A         +
Sbjct: 139 DFEKVFDERTKAVYLETIGNPKYNVPDFDRIVEVAHKHGIPVVVDNTFGAGGFFAQPIKY 198

Query: 188 GADMIMHSATKYFAGHSDLL------SGVLVVKDK-------EVASKLKEDRIY------ 228
           GAD++ HSATK+  GH   +      SG    KD         + S+     I+      
Sbjct: 199 GADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSIPSEGYHGMIFNDAFGP 258

Query: 229 --------------LGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKD--- 271
                         LG  +    ++ LL+ + T  LR  R  ENA K+  +L        
Sbjct: 259 LAFIGHVRTELLRDLGPALNPFAAFQLLQGVETLSLRAERHGENALKLAAWLEQSPYVSW 318

Query: 272 -KYPALVELYHSSLQTEEFVKKQLSGGYTPVFSLTFK-----TEEQCK--------KFCS 317
             YP L    H      E  KK L+ G+  V S   K      E + K        K   
Sbjct: 319 VSYPGLPSHSH-----HENAKKYLTNGFGGVLSFGAKDLPNNAEAEAKNPFAAAGAKVVD 373

Query: 318 SLKLFQHATSLGGVESLV-----------EWRAMCDSDIDQCLVRVSIGCESADDLINDL 366
           +LKL  +  ++G  ++LV                  S + + L+RVS+G E  DD+IND 
Sbjct: 374 NLKLASNLANVGDCKTLVIAPYFTTHLQLTHEEKASSGVTKDLIRVSVGTEFIDDIINDF 433

Query: 367 STVLSQL 373
                Q+
Sbjct: 434 QQSFEQV 440

>SAKL0G18172g Chr7 complement(1572652..1574673) [2022 bp, 673 aa]
           {ON} similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 673

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/263 (29%), Positives = 107/263 (40%), Gaps = 66/263 (25%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDF-------GADMIM 193
           V +ETP NP     D+ EL R A   G  ++VD T        A  F        AD++ 
Sbjct: 419 VFMETPSNPLLKMGDLLELKRLADIYGFYVVVDET--------AGGFVNIDVLPHADLVC 470

Query: 194 HSATKYFAGHSDLLSGVLVVKDK----EVASKLK-----------EDRIYLGSNIANLES 238
            S TK F+G S++++G LV+       E A +             ED IYL  N      
Sbjct: 471 SSLTKIFSGDSNVMAGSLVLNPNSRLHEFAQEFFRNGEYEDCLWCEDAIYLERNS----- 525

Query: 239 YLLLRSLRTYDLRIRRQAENATKVVKYLND----------HKDKYPALVELYHSSLQTEE 288
               R   T  L++   AE        LND           K  YP L      + Q  +
Sbjct: 526 ----RDFVTRTLKVNSNAE------MLLNDVLIPEEGHLFSKIYYPRLTS--EETKQNYD 573

Query: 289 FVKKQLSGGYTPVFSLTFKTEEQCKKFCSSLKL---------FQHATSLGGVESLVEWRA 339
            V+ + +GGY  +FSLTF   EQ KKF ++L+L         F  A     +    E   
Sbjct: 574 TVRCKPNGGYGGLFSLTFYEIEQAKKFFNALELCKGPSLGTNFTLACPYAVLAHYAELEK 633

Query: 340 MCDSDIDQCLVRVSIGCESADDL 362
           +    ++  LVRVS+G E A+ L
Sbjct: 634 VAQYGVEANLVRVSVGLEDAEHL 656

>ZYRO0G22198g Chr7 complement(1827527..1828864) [1338 bp, 445 aa]
           {ON} highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 445

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 92/393 (23%), Positives = 156/393 (39%), Gaps = 82/393 (20%)

Query: 55  VYSREGHPNGVRLEALFSRFLGG-HAICYSCGLGG---FLGVMVHFNPKRVFMDQCYHGV 110
           +YSR  +P     E   +   GG  A+  S GL      +  + H     V     Y G 
Sbjct: 55  IYSRIMNPTADVFERRIAALEGGVGALAVSSGLAAQTLAITGLAHAGDNIVSTSYLYGGT 114

Query: 111 QGIVGILKRNYGVERYGLADIEKHAQKGDI------VHVETPINPFGTSLDISELARRAH 164
                I  + +G+E   +   +    +  I      V++ET  NP     D  ++   AH
Sbjct: 115 YNQFKIAFKRFGIESRFIEGDDPSGLEAQIDERTKAVYLETIGNPKYNVPDFEKIVAIAH 174

Query: 165 SKGALLMVDSTFAP-----PPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLVVKD---- 215
             G  ++VD+TF        P+++    GAD+++HSATK+  GH   + GV+V       
Sbjct: 175 KHGVPVVVDNTFGAGGYYCQPIKH----GADVVVHSATKWIGGHGTTIGGVIVDSGNFPW 230

Query: 216 KEVASKLKE------------------DRIY-----------LGSNIANLESYLLLRSLR 246
           KE   K  +                  ++ +           LG +++   ++LLL+ L 
Sbjct: 231 KEYPKKFPQFSEPSEGYHGLVFNEALGNQAFIGHVRAELLRDLGPSLSPFAAFLLLQGLE 290

Query: 247 TYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTEEF---VKKQLSGGYTPVFS 303
           T  LR  R A NA K+ ++L    +K P +  + +  L         KK L+ G+  V S
Sbjct: 291 TLSLRAERHASNALKLAQWL----EKSPYVSWVSYPGLPNHSHHANAKKYLTNGFGGVLS 346

Query: 304 LTFK-----TEEQCKKFCSS-------LKLFQHATSLGGVESLV-----------EWRAM 340
              K      EE+   F ++       L+L  +  ++G  ++LV                
Sbjct: 347 FGAKDLPDNPEEKENPFKAAGAQISDNLELASNLANVGDCKTLVIAPYFTTHLQLNHEEK 406

Query: 341 CDSDIDQCLVRVSIGCESADDLINDLSTVLSQL 373
             + + + L+RVS+G E  DD+I D      ++
Sbjct: 407 LAAGVSKDLIRVSVGTEFIDDIIADFEQSFKKV 439

>Suva_10.397 Chr10 (693647..694981) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 63.2 bits (152), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 90/347 (25%), Positives = 137/347 (39%), Gaps = 85/347 (24%)

Query: 93  MVHFNPKRVFMDQCYHGVQGIVGILKRNYGVE-RY----GLADIEK-HAQKGDIVHVETP 146
           + H     V     Y G      I  + +G+E R+       D EK   ++   V++ET 
Sbjct: 97  LAHTGDNIVSTSYLYGGTYNQFKISFKRFGIEARFVEGDNPEDFEKVFDERTKAVYLETI 156

Query: 147 INPFGTSLDISELARRAHSKGALLMVDSTFAP-----PPLQNAWDFGADMIMHSATKYFA 201
            NP     D  ++   AH  G  ++VD+TF        P++    +GAD++ HSATK+  
Sbjct: 157 GNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGYFCQPIK----YGADIVTHSATKWIG 212

Query: 202 GHSDLL------SGVLVVKDK------------------------------EVASKLKED 225
           GH   +      SG    KD                                V ++L  D
Sbjct: 213 GHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPAEGYHGTIYNEAYGNLAYIVHVRTELLRD 272

Query: 226 RIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKD----KYPALVELYH 281
              LG  +    S+LLL+ + T  LR  R  ENA K+ K+L          YP L    H
Sbjct: 273 ---LGPLMNPFASFLLLQGVETLSLRAERHGENALKLAKWLEQSPYVSWVSYPGLASHSH 329

Query: 282 SSLQTEEFVKKQLSGGYTPVFSLTFK----TEEQCKKF-------CSSLKLFQHATSLGG 330
                 E  KK LS G+  V S   K     +++   F         SLKL  +  ++G 
Sbjct: 330 -----HENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKLSGAQVVDSLKLASNLANVGD 384

Query: 331 VESLV------EWRAMCDSD-----IDQCLVRVSIGCESADDLINDL 366
            ++LV        + + D++     + + L+RVS+G E  DD+I D 
Sbjct: 385 AKTLVIAPYFTTHKQLNDTEKLASGVTKDLIRVSVGIEFIDDIIADF 431

>AER164C Chr5 complement(944867..946804) [1938 bp, 645 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR130C
           (STR2) and YML082W
          Length = 645

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 85/317 (26%), Positives = 129/317 (40%), Gaps = 65/317 (20%)

Query: 91  GVMVHFNP---KRVFMDQCYHGVQGIVGILKRNYGVERYGLADIEKHAQKGDIVH----- 142
           G +V + P   K V     Y     I+ +    + +   G  D +  AQ  DI+H     
Sbjct: 332 GALVGYGPPYKKTVMFGFPYTDTLSILRVFNHTHFL---GSGDHKAMAQLEDILHSGEPI 388

Query: 143 ----VETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATK 198
               +ETP NP     D+  L R A   G  L+VD T       +     AD++  S TK
Sbjct: 389 LAVFIETPSNPLLKMGDLQALRRLADIYGFYLVVDDTLGGFVNIDVLPH-ADLVCSSLTK 447

Query: 199 YFAGHSDLLSGVLVVKDKEVASKLK------------------EDRIYLGSNIANLESYL 240
            F+G S++++G LVV     AS+L                   ED IYL  N        
Sbjct: 448 IFSGDSNVMAGSLVVNP---ASRLYDFAQGFFHNGSYEDLLWCEDAIYLERNS------- 497

Query: 241 LLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTEEF------VKKQL 294
             R   +  LR+ +  E    + K L  H+       ++++ +L +EE       V+ + 
Sbjct: 498 --RDCASRSLRVNKNTE--LLLEKVLLPHQGSL--FKKIFYPTLTSEETKRNYDAVRCKP 551

Query: 295 SGGYTPVFSLTFKTEEQCKKFCSSLKL---------FQHATSLGGVESLVEWRAMCDSDI 345
            GGY  +FSLTF  E + K F  +L+L         F  A     +    E   + +  +
Sbjct: 552 DGGYGGLFSLTFHEENRAKVFFDTLELCKGPSLGTNFTLACPYTVLAHYAEMDVVAEYGL 611

Query: 346 DQCLVRVSIGCESADDL 362
           ++ LVRVS+G E  D L
Sbjct: 612 ERSLVRVSVGLEDFDHL 628

>TDEL0E05710 Chr5 complement(1062353..1064023) [1671 bp, 556 aa]
           {ON} 
          Length = 556

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 78/320 (24%), Positives = 140/320 (43%), Gaps = 47/320 (14%)

Query: 80  ICYSCGLGGFLGVMVHFNPKRVFMDQCYHGVQGIVGILKRNYGVERYGLADIEKHAQKGD 139
           +C +  + GF      F   +V M++  H     VG  K         +A+++K+    D
Sbjct: 250 LCKTAAVFGF-----PFKDTKVIMEKFGHCQFFGVGDSK--------DVAELKKYLDTSD 296

Query: 140 ----IVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHS 195
                  VETP NP     D++ L + A+  G  +++D T     L       AD++  S
Sbjct: 297 HRILAAFVETPSNPLLNMPDLTGLRKLANEYGFFIVIDDTIGG--LNVDILPYADIVCTS 354

Query: 196 ATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSN-----IANLESYLLLRSLRTYDL 250
            TK F G S+++ G L++  K  +S     R ++ S+     +   ++ +L  + R ++ 
Sbjct: 355 LTKLFNGSSNVMGGSLILNPK--SSLYSSARAFVESDGFEDLLWCEDAKVLEINSRDFED 412

Query: 251 RIRRQAENATKVVKYL---NDHKDKYPALVELYHSSLQTEEFVK-----KQLSGGYTPVF 302
           R  R  +N  +++  L   N+ K       ++Y+ ++ +EE  K     +   GGY  +F
Sbjct: 413 RTVRANKNTERLLSELILVNEGK----VFKKIYYPTVSSEETFKNYEAVRNKLGGYGCMF 468

Query: 303 SLTFKTEEQCKKFCSSLKLFQH---------ATSLGGVESLVEWRAMCDSDIDQCLVRVS 353
           S+ F +EE  K F  SLK+F+          A     +    E   +     D  L+RVS
Sbjct: 469 SMAFYSEEDSKAFYDSLKVFKGPSNGTNFTLACPYVQLAHRFELEEVSKFGADPNLIRVS 528

Query: 354 IGCESADDLINDLSTVLSQL 373
           +G E +  L++  S  ++ L
Sbjct: 529 VGLEDSQWLLDVFSDAINML 548

>Skud_12.384 Chr12 (673748..675082) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 82/305 (26%), Positives = 124/305 (40%), Gaps = 80/305 (26%)

Query: 130 DIEK-HAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAP-----PPLQN 183
           D EK   ++   V++ET  NP     D  ++   AH  G  ++VD+TF        P++ 
Sbjct: 139 DFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGYFCQPIK- 197

Query: 184 AWDFGADMIMHSATKYFAGHSDLL------SGVLVVKDK--------------------- 216
              +GAD++ HSATK+  GH   +      SG    KD                      
Sbjct: 198 ---YGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPAEGYHGTIYNE 254

Query: 217 ---------EVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLN 267
                     V ++L  D   LG  +    S+LLL+ + T  LR  R  ENA K+ K+L 
Sbjct: 255 AYGNLAYIVHVRTELLRD---LGPLMNPFASFLLLQGVETLSLRAERHGENALKLAKWLE 311

Query: 268 DHKD----KYPALVELYHSSLQTEEFVKKQLSGGYTPVFSLTFK----TEEQCKKF---- 315
           +        YP L    H      E  KK LS G+  V S   K     +++   F    
Sbjct: 312 ESPYVSWVSYPGLASHSH-----HENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKLSG 366

Query: 316 ---CSSLKLFQHATSLGGVESLV------EWRAMCD-----SDIDQCLVRVSIGCESADD 361
                +LKL  +  ++G  ++LV        + + D     S + + L+RVS+G E  DD
Sbjct: 367 AQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGIEFIDD 426

Query: 362 LINDL 366
           +I D 
Sbjct: 427 IIADF 431

>KLTH0D03652g Chr4 complement(358612..359946) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P06106 Saccharomyces
           cerevisiae YLR303W MET17 O-acetyl homoserine-O-acetyl
           serine sulfhydrylase required for sulfur amino acid
           synthesis
          Length = 444

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 75/297 (25%), Positives = 118/297 (39%), Gaps = 65/297 (21%)

Query: 137 KGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTF-APPPLQNAWDFGADMIMHS 195
           K   V++ET  NP     D  ++   AH  G  ++VD+TF A         +GAD++ HS
Sbjct: 147 KTKAVYLETIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGGYFAQPIKYGADIVTHS 206

Query: 196 ATKY-----------------------------FAGHSDLLSGVLVVKDKEVASKLKEDR 226
           ATK+                             F+  S+   G+++       + +   R
Sbjct: 207 ATKWIGGHGTTIGGVIVDSGKFPWKEYPEKFPQFSKPSEGYHGLVINDALGPLAYIGHVR 266

Query: 227 IY----LGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKD----KYPALVE 278
           I     LG  +    ++ LL+ + T  LR  R A NA K+ +YL          YP L  
Sbjct: 267 IELLRDLGPALNPFAAFQLLQGVETLSLRCERHATNALKLAQYLEKSPYVSWVSYPGL-- 324

Query: 279 LYHSSLQTEEFVKKQLSGGYTPVFSLTFK-------TEEQCK----KFCSSLKLFQHATS 327
              SS    E  KK L  G+  V S   K        E+  K    +   SLK+  +  +
Sbjct: 325 ---SSHSHHENAKKYLQNGFGGVLSFGVKDLPNAHEIEDPFKASGAQVVDSLKIASNLAN 381

Query: 328 LGGVESLV------EWRAMCD-----SDIDQCLVRVSIGCESADDLINDLSTVLSQL 373
           +G  ++LV        + + D     S + + L+RVS+G E  DD+I D      ++
Sbjct: 382 VGDSKTLVIAPYFTTHQQLTDEEKLASGVTKDLIRVSVGTEFIDDIIGDFEQAFEKV 438

>Smik_12.383 Chr12 (670676..672010) [1335 bp, 444 aa] {ON} YLR303W
           (REAL)
          Length = 444

 Score = 62.4 bits (150), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 82/305 (26%), Positives = 123/305 (40%), Gaps = 80/305 (26%)

Query: 130 DIEK-HAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAP-----PPLQN 183
           D EK   ++   V++ET  NP     D  ++   AH  G  ++VD+TF        P++ 
Sbjct: 139 DFEKVFDERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGYFCQPIK- 197

Query: 184 AWDFGADMIMHSATKYFAGHSDLL------SGVLVVKDK--------------------- 216
              +GAD++ HSATK+  GH   +      SG    KD                      
Sbjct: 198 ---YGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPAEGYHGTIYNE 254

Query: 217 ---------EVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLN 267
                     V ++L  D   LG  +    S+LLL+ + T  LR  R  ENA K+ K+L 
Sbjct: 255 AYGNLAYIVHVRTELLRD---LGPLMNPFASFLLLQGVETLSLRAERHGENALKLAKWLE 311

Query: 268 DHKD----KYPALVELYHSSLQTEEFVKKQLSGGYTPVFSLTFK----TEEQCKKF---- 315
                    YP L    H      E  KK LS G+  V S   K     +++   F    
Sbjct: 312 QSPYVSWVSYPGLASHSH-----HENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKLSG 366

Query: 316 ---CSSLKLFQHATSLGGVESLV------EWRAMCD-----SDIDQCLVRVSIGCESADD 361
                +LKL  +  ++G  ++LV        + + D     S + + L+RVS+G E  DD
Sbjct: 367 AQVVDNLKLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGIEFIDD 426

Query: 362 LINDL 366
           +I D 
Sbjct: 427 IIADF 431

>YLR303W Chr12 (732542..733876) [1335 bp, 444 aa] {ON}
           MET17Methionine and cysteine synthase (O-acetyl
           homoserine-O-acetyl serine sulfhydrylase), required for
           sulfur amino acid synthesis
          Length = 444

 Score = 62.0 bits (149), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 120/298 (40%), Gaps = 79/298 (26%)

Query: 136 QKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAP-----PPLQNAWDFGAD 190
           ++   V++ET  NP     D  ++   AH  G  ++VD+TF        P++    +GAD
Sbjct: 146 ERTKAVYLETIGNPKYNVPDFEKIVAIAHKHGIPVVVDNTFGAGGYFCQPIK----YGAD 201

Query: 191 MIMHSATKYFAGHSDLL------SGVLVVKDK---------------------------- 216
           ++ HSATK+  GH   +      SG    KD                             
Sbjct: 202 IVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSQPAEGYHGTIYNEAYGNLAY 261

Query: 217 --EVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKD--- 271
              V ++L  D   LG  +    S+LLL+ + T  LR  R  ENA K+ K+L        
Sbjct: 262 IVHVRTELLRD---LGPLMNPFASFLLLQGVETLSLRAERHGENALKLAKWLEQSPYVSW 318

Query: 272 -KYPALVELYHSSLQTEEFVKKQLSGGYTPVFSLTFK----TEEQCKKF-------CSSL 319
             YP L    H      E  KK LS G+  V S   K     +++   F         +L
Sbjct: 319 VSYPGLASHSH-----HENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKLSGAQVVDNL 373

Query: 320 KLFQHATSLGGVESLV------EWRAMCD-----SDIDQCLVRVSIGCESADDLINDL 366
           KL  +  ++G  ++LV        + + D     S + + L+RVS+G E  DD+I D 
Sbjct: 374 KLASNLANVGDAKTLVIAPYFTTHKQLNDKEKLASGVTKDLIRVSVGIEFIDDIIADF 431

>Kpol_1028.80 s1028 (179685..181754) [2070 bp, 689 aa] {ON}
           (179685..181754) [2070 nt, 690 aa]
          Length = 689

 Score = 62.4 bits (150), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 122/272 (44%), Gaps = 43/272 (15%)

Query: 127 GLADIEKHAQKGD---IVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQN 183
            L D+E     G+    V VETP NP     D++ L R A+  G  +++D T       +
Sbjct: 411 SLKDLECTLHSGEQILAVFVETPSNPLLKMPDLAHLRRLANLYGFYIIIDETMGGFVNID 470

Query: 184 AWDFGADMIMHSATKYFAGHSDLLSGVLVVKDKE--------VASKLK--------EDRI 227
              + AD++  S TK F+G S++++G +V+  +E          S+L         ED I
Sbjct: 471 VLPY-ADIVCSSLTKIFSGSSNVIAGSMVLNPQEKLYSFAQVFMSQLGEYEDHLWCEDAI 529

Query: 228 YLGSNIANLESYLLLRSLRTYDL--RIRRQAENATKVVKYLNDHKDKYPALV----ELYH 281
           YL  N  +  +  +  +  T  L  ++    E  +K+ K     K  YP+L     ++ +
Sbjct: 530 YLERNSRDFIARTIKTNQNTEFLLKKVLLAQEGPSKLFK-----KIFYPSLTSAESKVNY 584

Query: 282 SSLQTEEFVK-KQLSGGYTPVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLV----- 335
            +++ +   K     GGY  +FSL F   EQ K F + L L     SLG   +L      
Sbjct: 585 DAVRCKSIDKDSDEEGGYGGLFSLAFNKIEQAKIFFNELNL-SKGPSLGTNFTLSCPYTV 643

Query: 336 -----EWRAMCDSDIDQCLVRVSIGCESADDL 362
                +   +   ++++ LVRVSIG ES D+L
Sbjct: 644 LMYYDKLDEVAKYEVEESLVRVSIGIESQDEL 675

>Suva_13.68 Chr13 (103103..105169) [2067 bp, 688 aa] {ON} YML082W
           (REAL)
          Length = 688

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 111/239 (46%), Gaps = 23/239 (9%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V +ETP NP     ++ EL R +   G  +++D T       +   F AD++  S TK F
Sbjct: 434 VFIETPSNPLLKMGNLVELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADLVCSSLTKTF 492

Query: 201 AGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANL----ESYLLLRSLRTYDLRIRRQA 256
           +G S+++ G +V+  +    +     + L     +L    ++  L R+ R +  R  R  
Sbjct: 493 SGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 552

Query: 257 ENATKVV-KYLNDHKDKYPALVELYHSSLQTEE------FVKKQLSGGYTPVFSLTFKTE 309
            N   ++ K +  H  +     ++Y+ +L ++E       V+ +  GGY  +FSLTF  E
Sbjct: 553 YNTEYLLDKIIKPHVGENALFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTFHDE 612

Query: 310 EQCKKFCSSLKLFQHATSLGGVESLV---------EWRAMCDS-DIDQCLVRVSIGCES 358
           +  + F  +L+L     SLG   +LV            AM +   +++ L+R+S+G E+
Sbjct: 613 DHAEAFYDNLQL-NKGPSLGTNFTLVFPYTLMTYYHEMAMAEKFGVERNLLRISVGLEN 670

>Smik_10.423 Chr10 complement(654265..656184) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 109/242 (45%), Gaps = 23/242 (9%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V +E P NP     D+ EL R +      ++VD T       +   + AD++  S TK F
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIVCSSLTKIF 445

Query: 201 AGHSDLLSGVLVVKDK----EVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLR-IRRQ 255
           +G S++++G LV+  K    E A K  +        +   ++  L R+ R +  R I+  
Sbjct: 446 SGDSNVIAGSLVLNPKGKIYEFARKFMKTEDGYEDCLWCEDALCLERNSRDFVERTIKVN 505

Query: 256 AENATKVVKYLNDHKDKYPALVELYHSSLQTEEFVKKQLS------GGYTPVFSLTFKTE 309
                 + K L     K     ++Y+ SL +EE  +   S      GGY  +FSLTF + 
Sbjct: 506 TNTNILLTKVLLPQVGKL--FKKIYYPSLTSEETKRNYDSVISTKDGGYGGLFSLTFFSI 563

Query: 310 EQCKKFCSSLKL---------FQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESAD 360
           E+ KKF ++L+L         F  A     +    E   +    +++ LVRVS+G E++D
Sbjct: 564 EEAKKFFNNLELCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVGLENSD 623

Query: 361 DL 362
            L
Sbjct: 624 VL 625

>Suva_12.221 Chr12 complement(344667..346586) [1920 bp, 639 aa] {ON}
           YJR130C (REAL)
          Length = 639

 Score = 60.1 bits (144), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 106/242 (43%), Gaps = 23/242 (9%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V +E P NP     D+ EL R +      ++VD T       +   + AD++  S TK F
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIVCSSLTKIF 445

Query: 201 AGHSDLLSGVLVVKDK----EVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLR-IRRQ 255
           +G S++++G LV+  +    E A K           +   ++  L R+ R +  R I+  
Sbjct: 446 SGDSNVIAGSLVLNPRGKIYEFARKFMSTEDGYEDCLWCEDALCLERNSRDFVERTIKVN 505

Query: 256 AENATKVVKYLNDHKDKYPALVELYHSSLQTEEF------VKKQLSGGYTPVFSLTFKTE 309
                 + K L     K     ++Y+ SL +EE       V     GGY  +FSLTF   
Sbjct: 506 TNTDVLLTKVLLPQVGKL--FKKIYYPSLTSEETKKNYDNVMSTKDGGYGGLFSLTFFNI 563

Query: 310 EQCKKFCSSLKL---------FQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESAD 360
           E+ KKF +SL+L         F  A     +    E   +    +++ LVRVS+G E++D
Sbjct: 564 ERAKKFFNSLELCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVGLENSD 623

Query: 361 DL 362
            L
Sbjct: 624 VL 625

>KLLA0D04037g Chr4 (336499..337833) [1335 bp, 444 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303W MET17 O-acetyl homoserine-O-acetyl serine
           sulfhydrylase required for sulfur amino acid synthesis
          Length = 444

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 80/313 (25%), Positives = 124/313 (39%), Gaps = 82/313 (26%)

Query: 130 DIEK-HAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAP-----PPLQN 183
           D EK   +K   +++E+  NP     D  ++   AH  G  ++VD+TF        P++ 
Sbjct: 138 DFEKLFDEKTKALYLESIGNPKYNVPDFEKIVAVAHKHGIPVVVDNTFGAGGFFCQPIK- 196

Query: 184 AWDFGADMIMHSATKY-----------------------------FAGHSDLLSGVLVVK 214
              +GAD++ HSATK+                             F+  S+   G L+  
Sbjct: 197 ---YGADIVTHSATKWIGGHGVTVGGVIIDSGKFPWKDYPEKFPQFSQPSEGYHG-LIFN 252

Query: 215 DK--------EVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYL 266
           D          V ++L  D   LG  ++    +LLL+ L T  LR  R   NA K+ +YL
Sbjct: 253 DAFGPAAFIGHVRTELLRD---LGPVLSPFAGFLLLQGLETLSLRGERHGSNALKLAQYL 309

Query: 267 NDHKD----KYPALVELYHSSLQTEEFVKKQLSGGYTPVFSLTFK----TEEQCKKFCSS 318
                     YP L    H      E  KK L  G+  V S   K      E+   F +S
Sbjct: 310 ESSPYVSWVSYPGLPSHSH-----HENAKKYLENGFGGVLSFGVKDLPNASEESDPFKAS 364

Query: 319 -------LKLFQHATSLGGVESLV------EWRAMCD-----SDIDQCLVRVSIGCESAD 360
                  LKL  +  ++G  ++LV        + + D     S + + L+RVS+G E  D
Sbjct: 365 GAQVVDNLKLASNLANVGDSKTLVIAPYFTTHQQLTDEEKLASGVTKDLIRVSVGTEFID 424

Query: 361 DLINDLSTVLSQL 373
           D+I D     + +
Sbjct: 425 DIIADFEASFATV 437

>Skud_12.10 Chr12 (10565..12280) [1716 bp, 571 aa] {ON} YLL058W
           (REAL)
          Length = 571

 Score = 59.7 bits (143), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 64/250 (25%), Positives = 113/250 (45%), Gaps = 26/250 (10%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V VETP NP     ++ EL R A + G  +++D T     L       AD++  S TK F
Sbjct: 317 VFVETPSNPLLNMPNLKELRRLADAYGFFIVIDDTIG--GLNVDILPYADIVCTSLTKLF 374

Query: 201 AGHSDLLSGVLVVKDKEVASKLKEDRIYLGSN-----IANLESYLLLRSLRTYDLRIRRQ 255
            G S+++ G +V+  K  ++  +  R Y  S      +   ++ +L R+ R ++ R  R 
Sbjct: 375 NGASNVMGGSVVLNPK--SALYQRAREYFKSGEFEDLLWGEDAVVLERNSRDFEDRTLRA 432

Query: 256 AENATKVVKYLNDHKDKYPALVELYHSSLQTEEFVKKQLS-----GGYTPVFSLTFKTEE 310
             N T+ +       ++     ++Y+ ++ ++E +    S     GGY  +FS+ F +E 
Sbjct: 433 NTN-TEKLLKELLLPEQGKTCKKIYYPTVNSKETINNYESVRNERGGYGCLFSVAFHSEG 491

Query: 311 QCKKFCSSLKLFQHATSLGGVESLV----------EWRAMCDSDIDQCLVRVSIGCESAD 360
             + F  SLK+F+   S G   +L           E   +     D  ++RVS+G E   
Sbjct: 492 DAEAFYDSLKVFK-GPSNGTNFTLACPYVHLAHHSELEEVSKFGADSSIIRVSVGLEETQ 550

Query: 361 DLINDLSTVL 370
            L++  S+ L
Sbjct: 551 LLLDVFSSAL 560

>Skud_10.353 Chr10 complement(623771..625693) [1923 bp, 640 aa] {ON}
           YJR130C (REAL)
          Length = 640

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 107/242 (44%), Gaps = 23/242 (9%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V +E P NP     D+ EL R +      ++VD T       +   + AD+I  S TK F
Sbjct: 388 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIICSSLTKIF 446

Query: 201 AGHSDLLSGVLVVKDK----EVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLR-IRRQ 255
           +G S++++G LV+  +    E A K  +        +   ++  L R+ R +  R I+  
Sbjct: 447 SGDSNVIAGSLVLNPRGKIYEFAKKFMKSENGYEDCLWCEDALCLERNSRDFVERTIKVN 506

Query: 256 AENATKVVKYLNDHKDKYPALVELYHSSLQTEEF------VKKQLSGGYTPVFSLTFKTE 309
                 + K L     K     ++Y+ SL +EE       V     GGY  +FSLTF   
Sbjct: 507 TNTDILLTKVLLPQVGKL--FKKIYYPSLTSEETKRNYDSVMATRDGGYGGLFSLTFFDI 564

Query: 310 EQCKKFCSSLKL---------FQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESAD 360
           E+ KKF ++L+L         F  A     +    E   +    +++ LVRVS+G E++D
Sbjct: 565 EKAKKFFNNLELCKGPSLGTNFTLACPYAIIAHYQELDEIAQYGVEKNLVRVSVGLENSD 624

Query: 361 DL 362
            L
Sbjct: 625 VL 626

>KLTH0D17930g Chr4 (1486259..1488217) [1959 bp, 652 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 652

 Score = 59.3 bits (142), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 67/261 (25%), Positives = 115/261 (44%), Gaps = 37/261 (14%)

Query: 128 LADIEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDF 187
           L DI    ++   V +E P NP     D+ EL   A++ G  ++VD T        A  F
Sbjct: 384 LKDILHSGEQILAVFMEAPSNPLLKMGDLVELRELANAYGFYIVVDET--------AGGF 435

Query: 188 -------GADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANL---- 236
                   AD++  S TK F+G S++++G +V+  +       + + +   +  +L    
Sbjct: 436 VNIDVLPHADIVCSSLTKIFSGDSNVMAGSVVLNPRSPLYPFAQ-QFFSSDSFEDLLWCE 494

Query: 237 ESYLLLRSLRTYDLRIRRQAENATKVVK-YLNDHKDKYPALVELYHSSLQTEEFVKKQ-- 293
           ++  L R+ R +  R     +N  ++++  L   + K     +++  SL +EE  +    
Sbjct: 495 DAIYLERNSRDFATRTLTVNKNTQRLLEDVLLPQEGKL--FKKIFFPSLTSEETKRNYDV 552

Query: 294 ---LSGGYTPVFSLTFKTEEQCKKFCSSLKL---------FQHATSLGGVESLVEWRAMC 341
                GGY  +FSLTF  EEQ + F   L+L         F  A     +    E   + 
Sbjct: 553 VLCPQGGYGGLFSLTFYREEQARVFFDVLELCKGPSLGTNFTLACPYAILAHYAELEEVA 612

Query: 342 DSDIDQCLVRVSIGCESADDL 362
              +++ LVRVS+G ESA+ L
Sbjct: 613 KYGVERSLVRVSVGLESAESL 633

>YML082W Chr13 (101862..103811) [1950 bp, 649 aa] {ON} Putative
           protein predicted to have carbon-sulfur lyase activity;
           transcriptionally regulated by Upc2p via an upstream
           sterol response element; green fluorescent protein
           (GFP)-fusion protein localizes to the nucleus and the
           cytoplasm; YML082W is not an essential gene
          Length = 649

 Score = 58.9 bits (141), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 62/239 (25%), Positives = 106/239 (44%), Gaps = 23/239 (9%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V +ETP NP     ++ EL R +   G  +++D T       +   F AD++  S TK F
Sbjct: 395 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCSSLTKTF 453

Query: 201 AGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANL----ESYLLLRSLRTYDLR-IRRQ 255
           +G S+++ G +V+  +    +     + L     +L    ++  L R+ R +  R IR  
Sbjct: 454 SGDSNVIGGSMVLNPQSRVYEFASRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 513

Query: 256 AENATKVVKYLNDHKDKYPALVELYHSSLQTEE------FVKKQLSGGYTPVFSLTFKTE 309
                 + K L  H  +     ++Y+ +L ++E       V+ +  GGY  +FSLTF  E
Sbjct: 514 YSTEYLLDKILKPHVGENKLFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTFHDE 573

Query: 310 EQCKKFCSSLKLFQHATSLGGVESLV----------EWRAMCDSDIDQCLVRVSIGCES 358
           +    F  +LKL     SLG   +L           E        +++ L+R+S+G ES
Sbjct: 574 DHAAAFYDNLKL-NKGPSLGTNFTLAFPYTLMTYYHELDMAEKFGVERNLLRISVGLES 631

>Smik_13.55 Chr13 (99421..101520) [2100 bp, 699 aa] {ON} YJR130C
           (REAL)
          Length = 699

 Score = 58.9 bits (141), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 63/243 (25%), Positives = 108/243 (44%), Gaps = 23/243 (9%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V +ETP NP     ++ EL R +   G  +++D T       +   F AD++  S TK F
Sbjct: 445 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCGSLTKTF 503

Query: 201 AGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANL----ESYLLLRSLRTYDLR-IRRQ 255
           +G S+++ G +V+  +    +     + L     +L    ++  L R+ R +  R IR  
Sbjct: 504 SGDSNVIGGSMVLNPQSRVYEFATRFMQLEDEYEDLLWCEDAIYLERNSRDFIARTIRIN 563

Query: 256 AENATKVVKYLNDHKDKYPALVELYHSSLQTEE------FVKKQLSGGYTPVFSLTFKTE 309
                 + K L  H  +     ++Y+ SL ++E       V+ +  GGY  +FSLTF  E
Sbjct: 564 YSTEYLLDKILKAHVGENGLFKKIYYPSLTSKETLINYDMVRCKKEGGYGGLFSLTFHDE 623

Query: 310 EQCKKFCSSLKLFQHATSLGGVESLV----------EWRAMCDSDIDQCLVRVSIGCESA 359
           +    F ++L+L     SLG   +L           E        +++ L+R+S+G ES 
Sbjct: 624 DHAAAFYNNLQL-NKGPSLGTNFTLAFPYTLMTYYHELTMAEKFGVERNLLRISVGLESQ 682

Query: 360 DDL 362
             L
Sbjct: 683 STL 685

>CAGL0D06402g Chr4 (602973..604301) [1329 bp, 442 aa] {ON} highly
           similar to uniprot|P06106 Saccharomyces cerevisiae
           YLR303w MET25 O-acetylhomoserine sulfhydrylase
          Length = 442

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 126/312 (40%), Gaps = 80/312 (25%)

Query: 130 DIEK-HAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAP-----PPLQN 183
           D EK   ++   V++E+  NP     D   +   AH  G  ++VD+TF        P++ 
Sbjct: 139 DFEKLFDERTKAVYLESIGNPKYNVPDFENIVAVAHKHGIPVVVDNTFGAGGFFCQPIK- 197

Query: 184 AWDFGADMIMHSATKYFAGHSDLL------SGVLVVKDK--------------------- 216
              +GAD++ HSATK+  GH   +      SG    KD                      
Sbjct: 198 ---YGADIVTHSATKWIGGHGTTIGGIIVDSGKFPWKDYPEKFPQFSKPAEGYHGTVYNE 254

Query: 217 ---------EVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLN 267
                     V ++L  D   LG  ++   ++LLL+ + T  LR  R  +NA  + K+L 
Sbjct: 255 TYGNLAYIVHVRTELLRD---LGPGMSPFAAFLLLQGVETLSLRGERHGQNALALAKWLE 311

Query: 268 DHKD----KYPALVELYHSSLQTEEFVKKQLSGGYTPVFSLTFK----TEEQCKKF---- 315
            +       YP L    H      E  KK LS G+  V S   K     +++   F    
Sbjct: 312 KNPHVAWVSYPGLPSHSH-----HENAKKYLSNGFGGVLSFGVKDLPNADKETDPFKLAG 366

Query: 316 ---CSSLKLFQHATSLGGVESLV------EWRAMCD-----SDIDQCLVRVSIGCESADD 361
                +LK+  +  ++G  ++LV        + + D     S + + L+RVS+G E  DD
Sbjct: 367 AQVVDNLKIASNLANVGDSKTLVIAPYFTTHQQLSDPEKLASGVTKDLIRVSVGTEFIDD 426

Query: 362 LINDLSTVLSQL 373
           +I D     +++
Sbjct: 427 IIADFEQSFAKV 438

>Kwal_14.791 s14 complement(49074..50789) [1716 bp, 571 aa] {ON}
           YLL058W - Hypothetical ORF [contig 245] FULL
          Length = 571

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 68/243 (27%), Positives = 110/243 (45%), Gaps = 28/243 (11%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V VETP NP     D+ +L + A   G  +++D T     L       AD++  S TK F
Sbjct: 317 VFVETPSNPLLNVPDLDKLRKLADEYGFFIVIDDTIGG--LNVDILPYADIVCTSLTKLF 374

Query: 201 AGHSDLLSG-VLVVKDKEVASKLKEDRIYLGSNIANL----ESYLLLRSLRTYDLRIRRQ 255
           +G S+++ G VL+  D  +    +E   +      +L    ++ +L  + R ++ R  R 
Sbjct: 375 SGTSNVMGGSVLLNPDSSLYPYAQE--YFQSCEFEDLLWSEDAVVLEANSRDFEARTLRT 432

Query: 256 AENATKVV-KYLNDHKDKYPALVELYHSSLQTEEFVK-----KQLSGGYTPVFSLTFKTE 309
            EN   ++ K L   + K   + ++Y+ ++ +EE  K     +   GGY  +FS+ F  E
Sbjct: 433 NENTVNLLTKVLLPEEGKL--IKKVYYPTVSSEETFKNYERVRNRQGGYGCLFSIAFHNE 490

Query: 310 EQCKKFCSSLKLFQHATSLGGVESLV----------EWRAMCDSDIDQCLVRVSIGCESA 359
           E  K F  SLK+F+   S G   +L           E   + +   D  LVRVS+G E  
Sbjct: 491 EDAKCFYDSLKVFK-GPSNGTNFTLACPYVHLAHHFELVEVAELGADPNLVRVSVGLEEF 549

Query: 360 DDL 362
             L
Sbjct: 550 QGL 552

>NCAS0A06270 Chr1 complement(1239445..1241424) [1980 bp, 659 aa]
           {ON} Anc_4.354
          Length = 659

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 110/258 (42%), Gaps = 55/258 (21%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V +E P NP     D+ EL + +   G  ++VD T       +   F AD++  S TK F
Sbjct: 407 VFIEAPSNPLLQMCDLIELQKLSEIYGFFIVVDETIGGFVNLDGL-FHADIVCSSLTKVF 465

Query: 201 AGHSDLLSGVLVVKDK----EVASKLK------------EDRIYLGSNIANLESYLLLRS 244
            G S++++G +V+  K    E A +              ED IYL  N          R 
Sbjct: 466 NGDSNVIAGSMVLNPKSKIYEFAQQFLNGPDGVTDSIWCEDLIYLEKNS---------RD 516

Query: 245 LRTYDLRIRRQAENATKVVKYLNDHKDKYPALVEL----YHSSLQTEEF------VKKQL 294
                LRI    E       YL D+  K P + +L    Y+ S  +EE       +K + 
Sbjct: 517 FVAKTLRINYTTE-------YLLDNVFK-PHVGKLFKRIYYPSQNSEEIKQNYEAIKCKK 568

Query: 295 SGGYTPVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLV----------EWRAMCDSD 344
            GGY  VFS+TF   +Q K F ++LKL +  T LG   + V          E   + +  
Sbjct: 569 DGGYGGVFSVTFFQLDQAKVFFNNLKLTKQIT-LGNNSTTVCPYTMLKHKDELERVKEYG 627

Query: 345 IDQCLVRVSIGCESADDL 362
           ++  L+RV +G E+ + L
Sbjct: 628 LEDNLIRVCVGLENKNTL 645

>YJR130C Chr10 complement(665218..667137) [1920 bp, 639 aa] {ON}
           STR2Cystathionine gamma-synthase, converts cysteine into
           cystathionine
          Length = 639

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 109/247 (44%), Gaps = 29/247 (11%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V +E P NP     D+ EL R +      ++VD T       +   + AD++  S TK F
Sbjct: 387 VFIEAPSNPLLKMGDLQELKRLSDLYSFYIVVDETVGGFVNIDVLPY-ADIVCSSLTKIF 445

Query: 201 AGHSDLLSGVLVVKDK----EVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQA 256
           +G S++++G LV+  +    E A K  +        +   ++  L R+ R +  R  +  
Sbjct: 446 SGDSNVIAGSLVLNPRGKIYEFARKFMKTEDGYEDCLWCEDALCLERNSRDFVERTIKVN 505

Query: 257 ENATKVVKYLNDHKDKYPALVEL----YHSSLQTEEF------VKKQLSGGYTPVFSLTF 306
            N   ++K +       P + +L    Y+ SL +E+       V     GGY  +FSLTF
Sbjct: 506 TNTDILLKRV-----LLPQVGKLFKKIYYPSLTSEDTKRNYDSVMSTKDGGYGGLFSLTF 560

Query: 307 KTEEQCKKFCSSLKL---------FQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCE 357
              E+ KKF ++L+L         F  A     +    E   +    ++  LVRVS+G E
Sbjct: 561 FNIEEAKKFFNNLELCKGPSLGTNFTLACPYAIIAHYQELDEVAQYGVETNLVRVSVGLE 620

Query: 358 SADDLIN 364
           ++D L N
Sbjct: 621 NSDVLCN 627

>ZYRO0B08338g Chr2 complement(649933..651855) [1923 bp, 640 aa] {ON}
           similar to uniprot|P47164 Saccharomyces cerevisiae
           YJR130C STR2 Cystathionine gamma-synthase converts
           cysteine into cystathionine
          Length = 640

 Score = 57.4 bits (137), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 63/249 (25%), Positives = 111/249 (44%), Gaps = 24/249 (9%)

Query: 143 VETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAG 202
           +E P NP     D+ EL   A+S G  ++VD T       +   F AD++  S TK F+G
Sbjct: 392 MEAPSNPLLKMGDLIELRELANSFGFYIVVDDTAGGFVNIDVLPF-ADIVCSSLTKIFSG 450

Query: 203 HSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANL----ESYLLLRSLRTYDLRIRRQAEN 258
            S++++G +V+  +       E   ++     +     ++  L R+ R +  R  +  +N
Sbjct: 451 DSNVIAGSIVLNPQSKLYSFAE--TFMEQQYEDCLWCEDALYLERNSRDFVARTLKVNQN 508

Query: 259 ATKVV-KYLNDHKDKYPALVELYHSSLQTEEFVK-----KQLSGGYTPVFSLTFKTEEQC 312
             +++ K L   + K     ++Y+ SL ++E  K     +   GGY  +FSLTF   +  
Sbjct: 509 TERLLNKVLLPQEGKL--FKKIYYPSLTSKETKKNYDAVRGHQGGYGGLFSLTFYNLDSA 566

Query: 313 KKFCSSLKL---------FQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGCESADDLI 363
           K F ++L+L         F  A     +    E   +    ++  LVRVS+G E  D+L 
Sbjct: 567 KTFFNTLQLCKGPSLGTNFTLACPYAIIAHYQELDRVAKYGVESNLVRVSVGLEREDELC 626

Query: 364 NDLSTVLSQ 372
               T + +
Sbjct: 627 KVFQTAIDE 635

>Skud_13.59 Chr13 (101194..103143) [1950 bp, 649 aa] {ON} YML082W
           (REAL)
          Length = 649

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 62/243 (25%), Positives = 109/243 (44%), Gaps = 23/243 (9%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V +ETP NP     ++ EL R +   G  +++D T       +   F AD++  S TK F
Sbjct: 395 VFIETPSNPLLKMGNLLELKRLSELFGFFIIIDETVGGIVNIDGLPF-ADIVCSSLTKTF 453

Query: 201 AGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANL----ESYLLLRSLRTYDLRIRRQA 256
           +G S+++ G +V+  +    +     + L     +L    ++  L R+ R +  R  R  
Sbjct: 454 SGDSNVIGGSMVLNPQSRVYEFATRFMRLEDEYEDLLWCEDAIYLERNSRDFIARTVRIN 513

Query: 257 ENATKVV-KYLNDHKDKYPALVELYHSSLQTEE------FVKKQLSGGYTPVFSLTFKTE 309
            +   ++ K L  H        ++Y+ +L ++E       V+ +  GGY  +FSLTF  E
Sbjct: 514 YSTEYLLDKILKPHVGGNELFKKIYYPNLTSKETLTNYDMVRCKKEGGYGGLFSLTFHDE 573

Query: 310 EQCKKFCSSLKLFQHATSLGGVESLV---------EWRAMCDS-DIDQCLVRVSIGCESA 359
                F  +L+L     SLG   +L          +  AM +   +++ L+R+S+G ES 
Sbjct: 574 HHAAAFYDNLQL-NKGPSLGTNFTLAFPYTLMTYYQELAMAEKFGVERNLLRISVGLESQ 632

Query: 360 DDL 362
             L
Sbjct: 633 STL 635

>CAGL0M00550g Chr13 (66078..67787) [1710 bp, 569 aa] {ON} similar to
           uniprot|P47164 Saccharomyces cerevisiae YJR130c STR2
          Length = 569

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 67/243 (27%), Positives = 109/243 (44%), Gaps = 26/243 (10%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V +E P NP     D+S+L + +   G  ++VD T +     +   +  D++  S TK F
Sbjct: 318 VFLEAPSNPLLKMCDMSKLKQLSQQYGFFIVVDETVSGFVNIDILSY-CDIVCSSLTKIF 376

Query: 201 AGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENAT 260
           +G S++++G LVV     ASKL +  I   ++    E  L        +   R   + A 
Sbjct: 377 SGDSNVIAGSLVVNP---ASKLHDFAIDFLNDPKRNEDLLWCEDSVYLERNSRDFIDRAQ 433

Query: 261 KVVKYLND------HKDKYPALVELYHSSLQTEEF-----VKKQLSGGYTPVFSLTFKTE 309
           K+ K   D       +++   L ++Y+ SL + E        K  +GGY  + S+ FK E
Sbjct: 434 KINKIAEDLVSTVLLEEEGQLLEKIYYPSLTSPESKLNYDSVKCNNGGYGGLISIVFKRE 493

Query: 310 EQCKKFCSSLKLFQHATSLGGVESLV----------EWRAMCDSDIDQCLVRVSIGCESA 359
           +Q K F  +L L     SLG   +LV          E   +    + + LVR+S+G ES 
Sbjct: 494 DQAKVFYDNLSL-NKGPSLGTNFTLVCPYAILAHYAELDEVAKYGVVKNLVRISVGLESL 552

Query: 360 DDL 362
           + L
Sbjct: 553 ETL 555

>YLL058W Chr12 (23569..25296) [1728 bp, 575 aa] {ON} Putative
           protein of unknown function with similarity to Str2p,
           which is a cystathionine gamma-synthase important in
           sulfur metabolism; YLL058W is not an essential gene
          Length = 575

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 111/267 (41%), Gaps = 40/267 (14%)

Query: 131 IEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGAD 190
           +E   Q+   V VETP NP     D+ +L   A   G  +++D T     L       AD
Sbjct: 311 LETSKQRILAVFVETPSNPLLNMPDLKKLRSLADQYGFFIVIDDTIGG--LNVDILPYAD 368

Query: 191 MIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL-------LLR 243
           ++  S TK F G S+++ G +V+  K  +S     R Y  S  AN E  L       L R
Sbjct: 369 IVSTSLTKLFNGASNVMGGSVVLNPK--SSLYPYAREYFRS--ANFEDLLWCEDAIVLER 424

Query: 244 SLRTYDLRIRRQAENATKVVKYLND----------HKDKYPALVELYHSSLQTEEFVKKQ 293
           + R ++ R  R   N   +   LND           K  YP +      + +  E V+ +
Sbjct: 425 NSRDFEDRTLRANANTGIL---LNDLLLPEEGKICKKIYYPTVTS--KETFENYESVRNE 479

Query: 294 LSGGYTPVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLV----------EWRAMCDS 343
             GGY  +FS+ F  E   K F  SLK+F+  ++ G   +L           E   +   
Sbjct: 480 -RGGYGCLFSVAFFNEGDAKAFYDSLKVFKGPSN-GTNFTLACPYVHLAHHSELEEVSKF 537

Query: 344 DIDQCLVRVSIGCESADDLINDLSTVL 370
             D  ++RVS+G E    L+   S+ L
Sbjct: 538 GADPNIIRVSVGLEDIQWLLKVFSSAL 564

>TDEL0D00610 Chr4 (109396..111354) [1959 bp, 652 aa] {ON} Anc_4.354
           YJR130C
          Length = 652

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 75/273 (27%), Positives = 120/273 (43%), Gaps = 54/273 (19%)

Query: 127 GLADIEKHAQKGD---IVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQN 183
            + D++K  Q G+    V +E P NP     D+ EL + A+  G  ++VD T        
Sbjct: 380 AMEDLKKILQSGEQILAVFMEAPSNPLLKMGDLLELRQLANLYGFFIVVDET-------- 431

Query: 184 AWDF-------GADMIMHSATKYFAGHSDLLSGVLVVKDKE----------VASKLKEDR 226
           A  F        AD++  S TK F+G S+L++G LV+  +           +A K  ED 
Sbjct: 432 AGGFVNIDVLPHADVVCSSLTKIFSGDSNLIAGSLVLNPQGKLYDFAQQWLLAQKEYEDT 491

Query: 227 IYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVV-KYLNDHKDKYPALVELYHSSLQ 285
           ++    +A      L R+ R +  R  +   N   ++ K L   + K     ++Y+ SL 
Sbjct: 492 LWCEDALA------LERNSRDFVQRTIQVNHNTEYLLNKVLIPLEGKL--FKKIYYPSLT 543

Query: 286 TEEF------VKKQLSGGYTPVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLV---- 335
           + E       VK  +  GY  +FSLTF    Q + F  SL+L +   SLG   +L     
Sbjct: 544 SPETKRHYDAVKCSIDAGYGGLFSLTFFNLAQARVFFDSLQLCK-GPSLGTNFTLACPYA 602

Query: 336 ------EWRAMCDSDIDQCLVRVSIGCESADDL 362
                 E   +    +++ LVRVS+G E+ + L
Sbjct: 603 ILAHYQELDEVARYGVEKSLVRVSVGLENRESL 635

>Suva_10.8 Chr10 (9213..10931) [1719 bp, 572 aa] {ON} YLL058W (REAL)
          Length = 572

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 106/265 (40%), Gaps = 36/265 (13%)

Query: 131 IEKHAQKGDIVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGAD 190
           ++   Q+   V VETP NP     D+ EL R A + G  ++VD T     L       AD
Sbjct: 308 LDTSKQRILAVFVETPSNPLLNMPDLKELRRLADAYGFFIVVDDTIG--GLNVDVLPYAD 365

Query: 191 MIMHSATKYFAGHSDLLSGVLVVKDK-----EVASKLK----------EDRIYLGSNIAN 235
           ++  S TK F G S+ + G +++  K           K          ED + L +N  +
Sbjct: 366 IVCTSLTKLFNGSSNAMGGSIILNPKSSLYSSACEYFKSAEFEDLLWCEDAVVLEANSRD 425

Query: 236 LESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTEEFVKKQLS 295
            +   L  ++ T  L          K+ K     K  YP +      +    E V+ +  
Sbjct: 426 FQDRTLRANINTEKLLNEVLLPEEGKICK-----KIYYPTVSS--KETFNNYESVRNK-H 477

Query: 296 GGYTPVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLV----------EWRAMCDSDI 345
           GGY  +FS+ F  E   K F  +LK+F+   S G   +L           E   +     
Sbjct: 478 GGYGCLFSMAFYNEGDAKTFYDTLKVFK-GPSNGTNFTLACPYVHLAHHSELEEVSKFGA 536

Query: 346 DQCLVRVSIGCESADDLINDLSTVL 370
           D  L+RVS+G E    L++  S+ +
Sbjct: 537 DPNLIRVSVGLEDTQTLLDVFSSAI 561

>Kwal_47.16644 s47 complement(41349..43307) [1959 bp, 652 aa] {ON}
           YJR130C (STR2) - Cystathionine gamma-synthase [contig
           376] FULL
          Length = 652

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 63/256 (24%), Positives = 112/256 (43%), Gaps = 33/256 (12%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDF-------GADMIM 193
           V +E P NP     ++ EL   A + G  +++D T        A  F        ADM+ 
Sbjct: 401 VFMEAPSNPLLKMGNLIELRELADAYGFYVVIDET--------AGGFVNIDVLPHADMVC 452

Query: 194 HSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLG--SNIANLESYLLL-RSLRTYDL 250
            S TK F+G S++++G LV+  K       +   + G   ++   E  + L R+ R +  
Sbjct: 453 SSLTKIFSGDSNVMAGSLVLNRKSPLYSFAQQFFHDGEFEDLLWCEDVIYLERNSRDFVT 512

Query: 251 RIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTEEFVKKQ-----LSGGYTPVFSLT 305
           R     +N  ++++ +   ++K     ++++ SL + E  +         GGY  +FSLT
Sbjct: 513 RTLTVNKNTAQLLEEVLIPQEK-KLFKKIFYPSLTSPETKRNYDAILCPKGGYGGLFSLT 571

Query: 306 FKTEEQCKKFCSSLKL---------FQHATSLGGVESLVEWRAMCDSDIDQCLVRVSIGC 356
           F  E+Q + F  +L+L         F  A     +    E   +    +++ LVRVS+G 
Sbjct: 572 FYNEKQARVFFDTLELCKGPSLGTNFTLACPYAILAHYTELEEVAKFGVERSLVRVSVGL 631

Query: 357 ESADDLINDLSTVLSQ 372
           ES   L    S  +++
Sbjct: 632 ESPQVLNAVFSRAIAE 647

>NDAI0D03260 Chr4 complement(774579..776669) [2091 bp, 696 aa] {ON}
           Anc_4.354
          Length = 696

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 68/266 (25%), Positives = 110/266 (41%), Gaps = 45/266 (16%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V +E P NP     D+ EL R +   G  ++VD T A   +       AD+I  S TK F
Sbjct: 438 VFIEAPSNPLLKMGDLIELKRLSDMYGFFIIVDETIAGF-VNIDAIIHADIICSSLTKVF 496

Query: 201 AGHSDLLSGVLVV----KDKEVASKLK------------EDRIYLGSNIANLESYLLLRS 244
            G S++++G +V+    K  + A +              ED +YL  N          R 
Sbjct: 497 TGDSNVIAGSMVLNPMSKIYDFAKRFLSFPDGFEDCLWCEDILYLEKNS---------RD 547

Query: 245 LRTYDLRIRRQAENATKVV--KYLNDHKDKYPALVELYHSSLQTEEF------VKKQLSG 296
             +   RI    E     V   Y+   +       ++Y+ +  ++E       +K +  G
Sbjct: 548 FLSKTTRINNTTEYLVNTVLSPYVGKKEANGKLFKKIYYPTTTSKETKMCYDAIKCKTYG 607

Query: 297 GYTPVFSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLV----------EWRAMCDSDID 346
           GY  VFS+TF   E+ K F ++LKL     SLG   + V          E   + +  +D
Sbjct: 608 GYGGVFSITFHDIEKAKLFFNNLKL-SKTISLGSNYTTVCPYTVLKHGDELEKVSEYGLD 666

Query: 347 QCLVRVSIGCESADDLINDLSTVLSQ 372
           + L+RV +G E+   L  + S  + +
Sbjct: 667 ETLIRVCVGLENKTSLKENFSRAIEK 692

>TPHA0L00330 Chr12 (43495..45648) [2154 bp, 717 aa] {ON} Anc_4.354
           YJR130C
          Length = 717

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 63/275 (22%), Positives = 118/275 (42%), Gaps = 51/275 (18%)

Query: 128 LADIEKHAQKGD---IVHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNA 184
           + ++E+    G+    V +E P NP     D+  L   A+  G  +++D T       + 
Sbjct: 440 MKELEQTLHSGEQILAVFIEIPSNPLLKVADLKYLRNLANIYGFYIVIDETLGGFVNIDV 499

Query: 185 WDFGADMIMHSATKYFAGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESY----- 239
             F AD++  S ++ F G S++++G +V+  +E   KL +      + +   E+Y     
Sbjct: 500 LPF-ADIVCSSLSQSFGGDSNVMAGSMVLNPQE---KLYQFAQLFLNQLGEYENYVWCED 555

Query: 240 --LLLRSLRTY---DLRIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTEE------ 288
             +L R+ R +    + I   +E     V   N+  DK     ++Y+ SL ++E      
Sbjct: 556 AIILERNSRDFIPRSITINHNSEYLINEVLLPNEGPDK--IFKKIYYPSLTSDETKENYD 613

Query: 289 ---------FVKKQLSGGYTPVFSLTFKTEEQCKKFCSSLKLFQHA------------TS 327
                    F K++  GGY  + SLTF   +  K+F   + + +              T 
Sbjct: 614 KLRCKKIPNFEKEE--GGYGGIISLTFHNLDTSKRFFDEINITKGPSLSTNHTLACPYTI 671

Query: 328 LGGVESLVEWRAMCDSDIDQCLVRVSIGCESADDL 362
           L   ++L +        +++ L+R+ IGCES +DL
Sbjct: 672 LSYFDNLAQVEKF---GVEENLIRIKIGCESKEDL 703

>KNAG0M00330 Chr13 (48427..50322) [1896 bp, 631 aa] {ON} Anc_4.354
           YJR130C
          Length = 631

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 125/286 (43%), Gaps = 32/286 (11%)

Query: 99  KRVFMDQCYHGVQGIVGILKRNYGVERYG------LADIEKHAQKGDIVHVETPINPFGT 152
           K V +    H    +V  L ++Y +   G      L +I    ++   V  ETP N    
Sbjct: 346 KTVVLGVPCHDTYEMVTTLSKSYFIPENGTDGLSKLKEILHSGEQILAVITETPTNGLLD 405

Query: 153 SLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYFAGHSDLLSGVLV 212
             ++ EL + +   G  ++VD +       +A  +  D++  S  K F+G  D++SG +V
Sbjct: 406 VTNLVELKQLSELFGFYIVVDESVGGFVNVDALVY-CDIVCSSLVKMFSGTEDVVSGSMV 464

Query: 213 VKDKE---------VASKLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVV 263
           V  +          +AS+ +   +    +I  LE     ++ R +  + +R    ATK  
Sbjct: 465 VNPQSKLYDFAQTFMASEHEPSSVLWCEDIIQLE-----QNSRDFVSKSKR-INTATK-- 516

Query: 264 KYLND--HKDKYPALVELYHSSLQTE---EFVKKQLSGGYTPVFSLTFKTEEQCKKFCSS 318
           + L D     +     E++H S+        +K +  GGY  VF++ F T E+ + F   
Sbjct: 517 RLLRDVILPQRGTIFTEVHHPSITDRAQYNLIKGKQDGGYGGVFAVQFSTLERARSFYDR 576

Query: 319 LKLFQHATSLGGVESLV-EWRAMCDSD-IDQCLVRVSIGCESADDL 362
           L + +    LGG  ++   W+ +   D +D+ L+RVS+G E  D L
Sbjct: 577 LNVCK-GPGLGGDYTVACPWQLLNQYDEVDKTLIRVSVGLEDYDVL 621

>KLLA0B04378g Chr2 (390701..392767) [2067 bp, 688 aa] {ON} similar
           to uniprot|P47164 Saccharomyces cerevisiae YJR130C STR2
           Cystathionine gamma-synthase converts cysteine into
           cystathionine
          Length = 688

 Score = 49.7 bits (117), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 108/259 (41%), Gaps = 37/259 (14%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V +E+P NP     D+ EL R +   G  +++D T       +   + AD++  S TK F
Sbjct: 431 VFIESPSNPLLKMGDLVELKRLSDLYGFYIVIDETVGGFLNIDVLPY-ADVVCSSLTKIF 489

Query: 201 AGHSDLLSGVLVVKDK----EVASKLK-------------EDRIYLGSNIANLESYLLLR 243
           +G S++++G +V+  +    E A+ +              ED I L  N  +  S  +L 
Sbjct: 490 SGDSNVMAGSIVLNPRSRLYEFATTMLHLTEKWYEDLLWCEDAICLERNSRDFISRSILV 549

Query: 244 SLRTYDL--RIRRQAENATKVVKYLNDHKDKYPALVELYHSSLQTEEFVKKQLSGGYTPV 301
           +  T  L  ++    +   K+ K     K  YP       +    ++   K    GY  +
Sbjct: 550 NENTESLLEKVILPQQGEGKLFK-----KVFYPKYTNA-ETKKNYDQVKAKTAGSGYGGL 603

Query: 302 FSLTFKTEEQCKKFCSSLKLFQHATSLGGVESLV----------EWRAMCDSDIDQCLVR 351
           FS+TF   EQ K F +SL L +   SLG   +L           E   +    ++  LVR
Sbjct: 604 FSVTFYNIEQAKMFFNSLNLCK-GPSLGTNFTLACPYTVLAHYQEMEEVAKFGLEDNLVR 662

Query: 352 VSIGCESADDLINDLSTVL 370
           VS+G ES   L     T +
Sbjct: 663 VSVGLESKQHLEKVFQTAI 681

>Smik_12.3 Chr12 (6081..7781) [1701 bp, 566 aa] {ON} YLL058W (REAL)
          Length = 566

 Score = 48.5 bits (114), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 70/253 (27%), Positives = 112/253 (44%), Gaps = 32/253 (12%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V VETP NP     ++ +L R A   G  +++D T     + +   + AD++  S TK F
Sbjct: 312 VFVETPSNPLLNMPNLKDLRRLADQYGFFIIIDDTIGGINV-DILPY-ADIVCTSLTKLF 369

Query: 201 AGHSDLLSGVLVVKDKEVASKLKEDRIYLGSNIANLESYL-------LLRSLRTYDLRIR 253
            G S+++ G +V+  K  +S     R Y  S  A+ E  L       L R+ R ++ R  
Sbjct: 370 NGASNVMGGSIVLNPK--SSIYPYAREYFKS--ADFEDLLWCEDAVVLERNSRDFENRTL 425

Query: 254 RQAENATKVV-KYLNDHKDKYPALVELYHSSLQTEEFVKKQLS-----GGYTPVFSLTFK 307
               N  K++ + L   + K     ++Y+ ++ +EE  +   S     GGY  +FS+ F 
Sbjct: 426 HANANTEKLLNEVLIPEQGKL--CKKVYYPTVTSEETFRNYESVRNERGGYGCLFSVAFY 483

Query: 308 TEEQCKKFCSSLKLFQHATSLGGVESLV----------EWRAMCDSDIDQCLVRVSIGCE 357
            E   K F  SLK+F+   S G   +L           E  A+     D  ++RVS+G E
Sbjct: 484 NEGDAKAFYDSLKVFK-GPSNGTNFTLACPYVHLAHHSELEAVSKFGADPNIIRVSVGLE 542

Query: 358 SADDLINDLSTVL 370
               L+   S  L
Sbjct: 543 DTQWLLEVFSNAL 555

>Kwal_26.7197 s26 (258929..259192) [264 bp, 87 aa] {OFF} YAL012W
           (CYS3) - cystathionine gamma-lyase [contig 47] FULL
          Length = 87

 Score = 43.1 bits (100), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 25/68 (36%), Positives = 38/68 (55%), Gaps = 11/68 (16%)

Query: 315 FCSSLKLFQHATSLGGVESLVEWRAMCD-----------SDIDQCLVRVSIGCESADDLI 363
           F S+ +LF  A SLGG+ESL+E  A+             S +   L+R+S+G E  DDL+
Sbjct: 16  FTSTTRLFTLAESLGGIESLLEVPAVMTHGGIPKDQREASGVYDDLIRLSVGIEDTDDLL 75

Query: 364 NDLSTVLS 371
           +D+   L+
Sbjct: 76  DDIKNALT 83

>KAFR0B06830 Chr2 complement(1421910..1423913) [2004 bp, 667 aa]
           {ON} Anc_4.354 YJR130C
          Length = 667

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 105/244 (43%), Gaps = 24/244 (9%)

Query: 141 VHVETPINPFGTSLDISELARRAHSKGALLMVDSTFAPPPLQNAWDFGADMIMHSATKYF 200
           V +E P  P     ++ EL   ++  G +++VD T       +A    AD++  S TK F
Sbjct: 410 VLIEAPSTPLLKMGNLLELKELSNLFGFIIIVDETVGGFFNVDAL-VHADVVCTSLTKIF 468

Query: 201 AGH-SDLLSGVLVVKDKEVASKLKEDRIY----LGSNIANLESYLLLRSLRTYDLRIRRQ 255
           +G   ++++G + +          +D +        N+   ++ ++ R+ R +  ++ + 
Sbjct: 469 SGDVGNVMAGAMALNSNSTIYNFAKDFLIDNNEFEDNLWCEDAIIMERNSRDFIAKMLKI 528

Query: 256 AENATKVV-KYLNDHKDKYPALVELYHSSL------QTEEFVKKQLSGGYTPVFSLTFKT 308
                 ++ K L  H  ++    ++YH  L      Q  E +K +  GGY  VFS+ F  
Sbjct: 529 NYTTDYLLDKVLIPHIGEHNLFKKIYHPRLTSNETKQNYEKIKCKSDGGYGGVFSIDFNN 588

Query: 309 EEQCKKFCSSLKLFQHATSLGGVESL----------VEWRAMCDSDIDQCLVRVSIGCES 358
            EQ K F + L + +   SLG   +L           +   +    + + L+RVS+G E+
Sbjct: 589 LEQAKLFYNCLNVAK-GPSLGTTMTLACPYTILYHYADIEKVSKYGLSESLIRVSVGLEN 647

Query: 359 ADDL 362
              L
Sbjct: 648 RKQL 651

>KAFR0E04390 Chr5 complement(879422..883717) [4296 bp, 1431 aa] {ON}
           Anc_4.370 YJR137C
          Length = 1431

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 41/101 (40%), Gaps = 10/101 (9%)

Query: 276 LVELYHSSLQTEEFVKKQLSGGYTPVFSLTFKTEEQ--------CKKFCSSLKLFQHATS 327
           L +L+ S+LQ       +   G +P F       EQ          K C  + LF    +
Sbjct: 345 LQQLFSSNLQVLNEYNSETVNGNSPEFGYGLFLHEQKAREELVGIVKSCLDVSLFHTENA 404

Query: 328 LGGVESLVEWRAMCDSDIDQCLVRVSIGCESADDLINDLST 368
              VE L EW A+ D  +D+    ++   E AD+L   L T
Sbjct: 405 NRLVELLSEWLALSDEPLDES--ELNAANEVADELYKILET 443

>KAFR0E04410 Chr5 complement(886158..890468) [4311 bp, 1436 aa] {ON}
           
          Length = 1436

 Score = 31.2 bits (69), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 28/101 (27%), Positives = 40/101 (39%), Gaps = 10/101 (9%)

Query: 276 LVELYHSSLQTEEFVKKQLSGGYTPVFSLTFKTEEQ--------CKKFCSSLKLFQHATS 327
           L +L+ S+LQ       +   G +P F       EQ          K C    LF    +
Sbjct: 349 LQQLFSSNLQVLNEYNSETVNGNSPEFGYGLFLHEQKAREELVGIVKSCLDASLFHTENA 408

Query: 328 LGGVESLVEWRAMCDSDIDQCLVRVSIGCESADDLINDLST 368
              VE L EW A+ D  +D+    ++   E AD+L   L T
Sbjct: 409 NRLVELLSEWLALNDKPLDES--ELNAANEVADELYKILET 447

>KLLA0E11507g Chr5 (1011380..1014337) [2958 bp, 985 aa] {ON} similar
           to uniprot|P38764 Saccharomyces cerevisiae YHR027C RPN1
           Non-ATPase base subunit of the 19S regulatory particle
           of the 26S proteasome may participate in the recognition
           of several ligands of the proteasome contains a
           leucine-rich repeat (LRR) domain a site for protein?
           protein interactions
          Length = 985

 Score = 30.8 bits (68), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 30/62 (48%)

Query: 221 KLKEDRIYLGSNIANLESYLLLRSLRTYDLRIRRQAENATKVVKYLNDHKDKYPALVELY 280
           KLK+D  +L S +   ++ L L SL      I+    + T V K L   +  YP LV +Y
Sbjct: 46  KLKDDLEFLVSTLKGDDTSLYLGSLDQLKDSIKNSTSSMTAVPKPLKFLRPSYPELVSVY 105

Query: 281 HS 282
            S
Sbjct: 106 ES 107

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.138    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,858,453
Number of extensions: 1726204
Number of successful extensions: 4831
Number of sequences better than 10.0: 126
Number of HSP's gapped: 4747
Number of HSP's successfully gapped: 146
Length of query: 373
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 262
Effective length of database: 40,753,473
Effective search space: 10677409926
Effective search space used: 10677409926
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)