Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F00550g5.348ON41541521660.0
TDEL0E027905.348ON4114109231e-121
Suva_2.4865.348ON4153846293e-77
Skud_4.5835.348ON4153806224e-76
Smik_4.5765.348ON4153866051e-73
YDR317W (HIM1)5.348ON4144155833e-70
CAGL0H07161g5.348ON4244235721e-68
Kpol_1051.45.348ON4264275223e-61
KAFR0C018805.348ON3453073769e-41
TPHA0D020605.348ON4964343797e-40
Kwal_34.159895.348ON5064023781e-39
KLTH0H14784g5.348ON5144033421e-34
Ecym_81855.348ON4713883349e-34
SAKL0G08910g5.348ON5053753341e-33
AGR348W5.348ON5423833299e-33
TBLA0A031005.348ON3723642762e-26
KLLA0B10120g5.348ON3482692382e-21
Ecym_44797.148ON2241381005e-04
TDEL0H031107.148ON224146980.001
TBLA0A105007.148ON237138890.012
ZYRO0D09548g7.148ON225139870.024
Smik_5.1187.148ON231119870.025
YER004W (FMP52)7.148ON23179860.027
Suva_5.917.148ON229119860.031
Smik_10.2155.261ON168386840.12
KLTH0H00264g7.148ON222121790.21
NDAI0C029105.143ON567138780.41
Skud_5.1037.148ON227120770.43
Skud_10.1111.264ON819112780.53
TBLA0F033107.148ON16139730.79
NDAI0D014401.506ON108591713.3
CAGL0H10164g3.269ON484235704.7
Suva_12.375.261ON168386704.8
Skud_10.1755.261ON168370695.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F00550g
         (415 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON...   838   0.0  
TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {O...   360   e-121
Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W ...   246   3e-77
Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317...   244   4e-76
Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317...   237   1e-73
YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Prot...   229   3e-70
CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {...   224   1e-68
Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..997...   205   3e-61
KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {O...   149   9e-41
TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.3...   150   7e-40
Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {...   150   1e-39
KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weak...   136   1e-34
Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}...   133   9e-34
SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {...   133   1e-33
AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic ...   131   9e-33
TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.3...   110   2e-26
KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some s...    96   2e-21
Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON} ...    43   5e-04
TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.14...    42   0.001
TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7....    39   0.012
ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar...    38   0.024
Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W (...    38   0.025
YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protei...    38   0.027
Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W (R...    38   0.031
Smik_10.215 Chr10 (350516..355567) [5052 bp, 1683 aa] {ON} YJL03...    37   0.12 
KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}...    35   0.21 
NDAI0C02910 Chr3 (668944..670647) [1704 bp, 567 aa] {ON} Anc_5.143     35   0.41 
Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W (...    34   0.43 
Skud_10.111 Chr10 (199209..201668) [2460 bp, 819 aa] {ON} YJL102...    35   0.53 
TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON...    33   0.79 
NDAI0D01440 Chr4 (335388..338645) [3258 bp, 1085 aa] {ON} Anc_1....    32   3.3  
CAGL0H10164g Chr8 complement(991125..992579) [1455 bp, 484 aa] {...    32   4.7  
Suva_12.37 Chr12 complement(49774..54825) [5052 bp, 1683 aa] {ON...    32   4.8  
Skud_10.175 Chr10 (326685..331736) [5052 bp, 1683 aa] {ON} YJL03...    31   5.9  

>ZYRO0F00550g Chr6 complement(51742..52989) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 415

 Score =  838 bits (2166), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/415 (97%), Positives = 405/415 (97%)

Query: 1   MSTDHNLTKHQSFQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDIN 60
           MSTDHNLTKHQSFQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDIN
Sbjct: 1   MSTDHNLTKHQSFQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDIN 60

Query: 61  HFTLNKFFYCVNRKLNNEKRSPGNEYLMERCKATPLVFRGQDYYLHNNTSATPPASQSSN 120
           HFTLNKFFYCVNRKLNNEKRSPGNEYLMERCKATPLVFRGQDYYLHNNTSATPPASQSSN
Sbjct: 61  HFTLNKFFYCVNRKLNNEKRSPGNEYLMERCKATPLVFRGQDYYLHNNTSATPPASQSSN 120

Query: 121 PSLGNNVFEEDGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLV 180
           PSLGNNVFEEDGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLV
Sbjct: 121 PSLGNNVFEEDGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLV 180

Query: 181 FEDSTRWADLLPSIFSGEVELVPEESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDR 240
           FEDSTRWADLLPSIFSGEVELVPEESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDR
Sbjct: 181 FEDSTRWADLLPSIFSGEVELVPEESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDR 240

Query: 241 YFVEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALA 300
           YFVEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALA
Sbjct: 241 YFVEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALA 300

Query: 301 QLVVLRPGPIVGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIGFKTK 360
           QLVVLRPGPIVGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIGFKTK
Sbjct: 301 QLVVLRPGPIVGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIGFKTK 360

Query: 361 ASELVAKAMYRKPGSSVLGYCVPASKXXXXXXXXXXNPTLGELRIVTSKEIDHLT 415
           ASELVAKAMYRKPGSSVLGYCVPASK          NPTLGELRIVTSKEIDHLT
Sbjct: 361 ASELVAKAMYRKPGSSVLGYCVPASKAAYATAYMATNPTLGELRIVTSKEIDHLT 415

>TDEL0E02790 Chr5 complement(536193..537428) [1236 bp, 411 aa] {ON}
           Anc_5.348 YDR317W
          Length = 411

 Score =  360 bits (923), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 181/410 (44%), Positives = 271/410 (66%), Gaps = 10/410 (2%)

Query: 11  QSFQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDINHFTLNKFFYC 70
           Q + DH L FGS+GLIGSLTL+ELLK +LYL    ++Q +L   E+ ++++F  NK  YC
Sbjct: 5   QQYNDHFLFFGSSGLIGSLTLKELLKADLYLGNPENIQKRLNTCEHLNLSNFRFNKLIYC 64

Query: 71  VNRKLNNEKRSPGNEYLMERCKATPLVFRGQDYYLHNNTSATPPASQSSNPSLGNNVFEE 130
           +NRK+  +     NE  ++  K  P+ F   DY     TS  P   + SN SL NNV +E
Sbjct: 65  INRKIGYKNILLDNEQYLKADKLAPISFNKADYRFEKITSICPSVKKHSNQSLVNNVSDE 124

Query: 131 DGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFEDSTRWADL 190
            GT+ +    ++    L++ ++ ++YQ+EY S++ K LLITF+F I+Q+   DS++W +L
Sbjct: 125 SGTLYIHN--NSAGNVLKYHRSMQTYQVEYKSENSKKLLITFNFVILQIACPDSSKWCEL 182

Query: 191 LPSIFSGEVELVPE-ESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQLTF 249
           LP IFSG V L  E E + T+ +LP LD++ TMICTLG  S   + S   R++V+Y+LTF
Sbjct: 183 LPDIFSGCVALRSEAEPDGTTNKLPPLDEIPTMICTLGAGS---RQSKAKRHYVDYELTF 239

Query: 250 QIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVVLRPGP 309
           ++ Q+F +CE KRLVI+T+FNN L+ H+ PYF+ K +LENDLQ+K+ P L +LVVLRPGP
Sbjct: 240 KLAQSFNNCEGKRLVIVTTFNNILIRHLLPYFRTKSKLENDLQHKLKPRLGKLVVLRPGP 299

Query: 310 IVGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIGFKTKASELVAKAM 369
           +VG H     + L + +S ++ +Q+ +YKE+C++ K +  KE R+IGF+T+ASEL+A+ M
Sbjct: 300 LVGEHGRPLTKSLTIGHSTNMLKQILYYKEYCFQCKLALFKEFRRIGFRTRASELIARTM 359

Query: 370 YRKPGSSVLGYCVPASKXXXXXXXXXXNPTLGE----LRIVTSKEIDHLT 415
           YRKPGS +LGYC+PA+K          +    E    + I+TS+++DH+ 
Sbjct: 360 YRKPGSWMLGYCIPATKAAYVAASKATDEASDEASDPVEIITSEQMDHIA 409

>Suva_2.486 Chr2 (859579..860826) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  246 bits (629), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 138/384 (35%), Positives = 219/384 (57%), Gaps = 13/384 (3%)

Query: 10  HQSFQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDIN-HFTLNKFF 68
           + +F D ILLFGS+GL G  TLE LL +  Y+   +DLQ KL+    ++IN +  LNK  
Sbjct: 5   NNAFTDSILLFGSSGLAGKGTLENLLDINFYIKNVSDLQDKLDSL--TEINENVVLNKHI 62

Query: 69  YCVNRKLNNEKRSPGNEYLMERCKATPLVFRGQDYYLHNNTSATPPASQSSNPSLGNNVF 128
           +C+NRK   E++S      ++      ++++G  YYL +           ++ +   + F
Sbjct: 63  FCINRKSVTEQKSFIKT--IDYVNMKSIIWKGGRYYLRSRGENETKRETCNSNTFCYDDF 120

Query: 129 EEDGTIQLTKTVDNRSVTLRFRQTRK--SYQLEYISKDLKNLLITFHFTIVQLVFEDSTR 186
           EE G I+ +   D +  T  F   RK  SY L Y     ++  I ++F + QLV   ST 
Sbjct: 121 EE-GIIRNSMDKDKKG-TFSFAYNRKQFSYALHYACGKDESFGIKYNFIVTQLVIPQSTS 178

Query: 187 WADLLPSIFSGEVEL----VPEESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYF 242
           W  LLP +FSG  +L    V      +   LP L+ + TM+C LG +++  + S     F
Sbjct: 179 WPKLLPEVFSGTQKLERFDVDSRDYVSDKSLPALNSIGTMVCALGSSAARVRKSQVPNSF 238

Query: 243 VEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQL 302
           V+Y L+F + Q F +  DK+LV++TSFNN  +S  F YF+ K +LENDL+  +   L +L
Sbjct: 239 VDYHLSFNLAQEFTNTTDKKLVVITSFNNDFLSRTFEYFRIKAKLENDLEEALPNKLKEL 298

Query: 303 VVLRPGPIVGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIGFKTKAS 362
           ++LRPGP+ G H N    ++ ++ +P+L E+  +Y  +  +YK+  + E+RK+G +T+ S
Sbjct: 299 IILRPGPMCGQHGNPVHVEMDIQQNPTLSERFFYYPRYILKYKQQCISEVRKVGLRTRLS 358

Query: 363 ELVAKAMYRKPGSSVLGYCVPASK 386
           E++A ++YR PGS++LGY VP SK
Sbjct: 359 EVIASSIYRMPGSALLGYSVPVSK 382

>Skud_4.583 Chr4 (1038472..1039719) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  244 bits (622), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 136/380 (35%), Positives = 212/380 (55%), Gaps = 11/380 (2%)

Query: 13  FQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDINHFTLNKFFYCVN 72
           F D+ILLFGS+GL G  TLE LL +  Y+   +DLQ KL+  +        LNK  +C+N
Sbjct: 8   FTDYILLFGSSGLAGRGTLENLLDINFYIKNVSDLQDKLDSLKEIK-EDVVLNKHVFCIN 66

Query: 73  RKLNNEKRSPGNEYL--MERCKATPLVFRGQDYYLHNNTSATPPASQSSNPSLGNNVFEE 130
           R+   E++S    +L  ++      + ++G  YYL + T+       SS  +   + FEE
Sbjct: 67  RRNVTEQKS----FLKTIDYVNMKSITWKGGRYYLRSRTANDNGRETSSTDTFFYDNFEE 122

Query: 131 DGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFEDSTRWADL 190
                        + +  + Q + SY L Y  +  ++  I ++FT+ QL+   S  W  L
Sbjct: 123 GFIRGAAYEGQKGNFSFAYNQKQFSYSLHYACRKEESFGIKYNFTVTQLIIPPSESWPRL 182

Query: 191 LPSIFSGEVEL----VPEESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQ 246
           L  IFS E +L    +  ++      LP L  + TM+CTLG  S+  + +     FV+Y 
Sbjct: 183 LSRIFSKEQKLEKFDIDNKTYVADKSLPSLRDIGTMVCTLGSTSARVRRTQVPNSFVDYH 242

Query: 247 LTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVVLR 306
           L F + Q FA+  +KRLV++TSFNN L+   F YF+ K +LENDL+  +   L +LV+LR
Sbjct: 243 LVFSLAQEFANTTNKRLVVVTSFNNDLLMRTFEYFRIKAKLENDLEEALPNKLKELVILR 302

Query: 307 PGPIVGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIGFKTKASELVA 366
           PGP+ G H +  +  L ++ +P+  E++ +Y  +  +YKK ++ E RK+G +TK SEL+A
Sbjct: 303 PGPMCGQHGDPVNVKLDVQENPTFSERILYYPRYVLKYKKQYISEARKVGLRTKLSELIA 362

Query: 367 KAMYRKPGSSVLGYCVPASK 386
            ++YR PGS++LGY VP SK
Sbjct: 363 SSIYRMPGSALLGYSVPVSK 382

>Smik_4.576 Chr4 (1028647..1029894) [1248 bp, 415 aa] {ON} YDR317W
           (REAL)
          Length = 415

 Score =  237 bits (605), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 142/386 (36%), Positives = 212/386 (54%), Gaps = 21/386 (5%)

Query: 12  SFQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKL-ELYE-NSDINHFTLNKFFY 69
           +F D+ILLFGS+GL G  TLE +L +  Y+   +DLQ KL  L E   D+    LNK  +
Sbjct: 7   AFTDYILLFGSSGLAGKGTLENMLDINFYIKNVSDLQDKLNSLTEIKGDV---VLNKHVF 63

Query: 70  CVNRKLNNEKRSPGNEYLMERCKATPLVFRGQDYYLH----NNTSATPPASQSSNP-SLG 124
           C+NR+   E++S      ++      + ++   YYL     N T   P     SNP +  
Sbjct: 64  CINRRSITEEKSFMKS--IDYINMKSITWKRGRYYLRSRNENETKKIP-----SNPDTFC 116

Query: 125 NNVFEEDGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFEDS 184
            + FEE    + T      +  + + Q R SY L Y S   +   I + FT+ QL+   S
Sbjct: 117 YDAFEEGFIKKTTDENGKDNFCIPYNQKRFSYALYYASGKKEGFEIIYKFTVTQLIIPRS 176

Query: 185 TRWADLLPSIFSGEVELVPEESNH----TSPRLPHLDQVKTMICTLGPNSSSTKHSHYDR 240
             W+ LL  IFSG  +L   ++N+        LP+L  + TM+CTLG  S+  + +    
Sbjct: 177 ENWSRLLSYIFSGTQKLEKFDANNKTYVAGKSLPNLRDISTMVCTLGSTSARVRRTQVPN 236

Query: 241 YFVEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALA 300
            FV+Y L F + Q F +  DKRLVI+TSFNN  +S  F YF+ K +LENDL+  +     
Sbjct: 237 SFVDYSLPFSLAQEFTNTTDKRLVIITSFNNKFLSTTFEYFRIKAKLENDLEEVLPNKPK 296

Query: 301 QLVVLRPGPIVGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIGFKTK 360
           +L++LRPGP+ G H N    +L ++ + +  +++ +Y  +   YKK ++ E+RKIG +TK
Sbjct: 297 ELIILRPGPMCGQHGNSIKVELDVQENLTFSDKILYYPRYLLMYKKQYISEVRKIGLRTK 356

Query: 361 ASELVAKAMYRKPGSSVLGYCVPASK 386
            SEL+A + YR PGS++LGY VP SK
Sbjct: 357 LSELIASSTYRMPGSALLGYSVPVSK 382

>YDR317W Chr4 (1102184..1103428) [1245 bp, 414 aa] {ON}  HIM1Protein
           of unknown function involved in DNA repair
          Length = 414

 Score =  229 bits (583), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 142/415 (34%), Positives = 219/415 (52%), Gaps = 18/415 (4%)

Query: 12  SFQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDI-NHFTLNKFFYC 70
           +F D++LLFGS+ L+G   LE LL + LY+   +DLQ KL+    S+I  +  LNK  +C
Sbjct: 7   TFTDYVLLFGSSSLVGKGILENLLDINLYIKNVSDLQGKLD--SLSEIKGNVVLNKHVFC 64

Query: 71  VNRKLNNEKRS--PGNEYLMERCKATPLVFRGQDYYLHNNTSATPPASQSSNPSLGNNVF 128
           VNR+  NE++S     +Y+  R     + ++G  YYL +          SS  +   + F
Sbjct: 65  VNRRCINEEKSFMKTIDYINMRS----VTWQGGRYYLRSRKEKDTEKVPSSPNTFCYDNF 120

Query: 129 EEDGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFEDSTRWA 188
           EE       +       +  + Q + SY L Y     K + I  +FT+ QL+   S  W 
Sbjct: 121 EEGFIKNTPEERGKDGYSFVYNQKQFSYTLHYACGKEKGIEIICNFTVTQLIIPRSETWP 180

Query: 189 DLLPSIFSGEVELVP---EESNHTSPR-LPHLDQVKTMICTLGPNSSSTKHSHYDRYFVE 244
            LLP IFSG  +L     +  N+   R LP L  + TM+C+LG  S+  + +     F +
Sbjct: 181 KLLPRIFSGTQKLEKFDIDNKNYVPGRSLPSLCDISTMVCSLGSTSARVRRTQVPSSFAD 240

Query: 245 YQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVV 304
           Y L F + Q F +  +KRLV+ T+FNN  +S  F YF+ K +LENDL   +   L +LV+
Sbjct: 241 YYLPFNLAQEFTNTTNKRLVVTTAFNNDFLSKTFEYFRIKAKLENDLDEALPNKLKELVI 300

Query: 305 LRPGPIVGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIGFKTKASEL 364
           LRPGP+ G H N  + +L  + + +  E++ +Y  +   YKK ++ E R+IG +TK SE+
Sbjct: 301 LRPGPMCGQHGNPINVELG-KENSTFLEKIFYYPHYLLVYKKKYISEARRIGLRTKLSEI 359

Query: 365 VAKAMYRKPGSSVLGYCVPASKXXXXXXXXXXNPTLGE----LRIVTSKEIDHLT 415
           +A ++YR PGS++LGY VP SK               E    L +++S +ID + 
Sbjct: 360 IASSIYRMPGSALLGYAVPVSKVSYVASLMAIERKSKEAGPKLEVISSYQIDMIV 414

>CAGL0H07161g Chr8 complement(704823..706097) [1275 bp, 424 aa] {ON}
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317w
          Length = 424

 Score =  224 bits (572), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 139/423 (32%), Positives = 225/423 (53%), Gaps = 17/423 (4%)

Query: 2   STDHNLTKHQSFQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDINH 61
           +T  +L++ ++F+ +ILLFGSTGL GSL  E LL    YL++  +L+  L       + +
Sbjct: 8   NTSGSLSREKTFEKNILLFGSTGLTGSLVFEYLLDPCFYLNSAVELRELLLEAIEEGLEN 67

Query: 62  FTLNKFFYCVNRKLNNEKRSPGNEYLMERCKAT--PLVFRGQDYYLHNNTSATPPASQ-- 117
            T+    YC NRK+      P ++YL      +  P  F G  Y+ +  T       Q  
Sbjct: 68  VTIKTCLYCFNRKIG----EPLDKYLKSPSANSFGPFCFNGSQYHYNKGTCVPLDIDQDI 123

Query: 118 --SSNPSLGNNVFEEDGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFT 175
             S++ +    ++ +D    +T       ++  +      Y LEY+S +   L + F F 
Sbjct: 124 ETSNDATFDGFLYYKDKGKNVT---GKNPISGEYYGKEYMYYLEYMSAEGNLLKLNFIFN 180

Query: 176 IVQLVFEDSTRWADLLPSIFSGEVELVPEESNHTSPR-LPHLDQVKTMICTLGPNSSSTK 234
            +QL+ ++S  W  ++P IFS EVE +         R  P L  +KTMI T+G  ++  K
Sbjct: 181 HIQLIIKNSFSWPSVIPIIFSDEVEAISFREKMPLKRYFPLLSDIKTMISTIGTTTNRNK 240

Query: 235 HSHYDRYFVEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNK 294
            S+     ++YQL   +V+ F++ +DK ++I+TSFNN+++S + PYFK K +LE+ L N 
Sbjct: 241 ISNTTYNDIDYQLNVDLVKAFSNTDDKSVIIVTSFNNTIISTVSPYFKIKMKLESTLANA 300

Query: 295 VAPALAQLVVLRPGPIVGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRK 354
           + P L  L +LRPGP+VG H ++   +  +  + SL E+   +K+   +  + FV +IR 
Sbjct: 301 ITPPLKTLTILRPGPLVGRHSDIYPTNDSILKNSSLFERALLHKKAFLQNMECFVDDIRT 360

Query: 355 IGFKTKASELVAKAMYRKPGSSVLGYCVPASKXXXXXXXXXXNPTLGE---LRIVTSKEI 411
            G   KASE+VA+  YR PGS +LGYC+PA K          +  L E    R+VTS+E+
Sbjct: 361 GGMSIKASEIVARTFYRIPGSKLLGYCIPAQKVAYAISIAAVDKYLHEEPLTRVVTSEEM 420

Query: 412 DHL 414
           D++
Sbjct: 421 DNM 423

>Kpol_1051.4 s1051 (8692..9972) [1281 bp, 426 aa] {ON} (8692..9972)
           [1281 nt, 427 aa]
          Length = 426

 Score =  205 bits (522), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 139/427 (32%), Positives = 224/427 (52%), Gaps = 33/427 (7%)

Query: 10  HQSFQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDI--NHFTLN-- 65
            ++F + I + GSTGL     L  LL +  YL   N+++ KL    + +I  NH  +N  
Sbjct: 12  EKNFSEKIPIVGSTGLEEKWPLVSLLDINFYLLNSNEIKQKLNPRSDIEIPSNHQKMNTI 71

Query: 66  ---KFFYCVNRKLNNEKRSPGNEYLMERCKATPLVFRGQDYYLHNNTSATPPASQSSNPS 122
              K  +C+NR+  ++     N+  +E  K   + F+  +Y L      TP  +   +  
Sbjct: 72  KIVKNIFCINRR--SQTLDLFNKDALESVKVGRIKFKDLEYRL----DKTPGETSYESSY 125

Query: 123 LGNNVFEEDGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFE 182
           L N +  E G I      ++    L F   +K  QL Y +K+   L I F  ++  ++  
Sbjct: 126 LTNEI--ESGKINFD--CEHPFSPLSFELQKKRAQLTYKAKEGNMLQIQFEISVYHIIIP 181

Query: 183 DSTRWADLLPSIFSGE--VELVPEESNHTSPR-LPHLDQVKTMICTLGPNSSSTKHSHYD 239
            S +W  LLP IF+    +E V ++ N   P  LP L  + TMI +LG N          
Sbjct: 182 TSNQWPTLLPRIFNPATVIEKVEDKENSILPTGLPDLKNIPTMISSLGLNHRQQITREKS 241

Query: 240 RYFVEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPAL 299
              +++ LT ++ Q FA+  +K+LV++T+FNN +VS +F YF  K+++E  LQN++ P L
Sbjct: 242 YRAIDFDLTLKLTQTFANNNNKKLVVITTFNNKVVSKMFRYFHFKFKIEEALQNELNPKL 301

Query: 300 AQLVVLRPGPIVGNHVNLNDR-----DLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRK 354
           +QLV+LRPGPIVG  V + D      +  L+ S +L EQ    K++  +YK + +K+ R 
Sbjct: 302 SQLVILRPGPIVG--VPMTDAINPEFNPILKKSDNLVEQSILLKKYLLDYKLATLKKYRS 359

Query: 355 IGFKTKASELVAKAMYRKPGSSVLGYCVPASKXXXXXXXXXXNPTLG------ELRIVTS 408
            G   + ++++AK MYRKPG+SVLGYC+PA+K           PT+       +++I+TS
Sbjct: 360 TGIAPRLTDILAKTMYRKPGTSVLGYCIPATKVAKVAALKAIEPTIASTYSKPDVQIITS 419

Query: 409 KEIDHLT 415
           ++ID L 
Sbjct: 420 RQIDELV 426

>KAFR0C01880 Chr3 complement(374180..375217) [1038 bp, 345 aa] {ON}
           Anc_5.348 YDR317W
          Length = 345

 Score =  149 bits (376), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 96/307 (31%), Positives = 169/307 (55%), Gaps = 23/307 (7%)

Query: 14  QDHILLFGSTGLIGSLTLEELLKVELYL-DAGNDLQSKLELYENSDINHFTLNKFFYCVN 72
           ++HIL FGS+GL+GS +L  LL     L +  N+    +E    S +     +K  YC N
Sbjct: 6   KEHILFFGSSGLVGSGSLSNLLNPNFLLCNKQNNFYDVIESSIVSGVYDIAFDKIIYCFN 65

Query: 73  RKLNNEKRSPGNEYLMERCKATPLVFRGQDYYLHNNTSATPPASQSSNPSLGNNVFEEDG 132
           R   N +     +Y  +  K +   F G  Y L NN                NN FE  G
Sbjct: 66  RTPQNIRY----KYHSDFEKNSQFDFGGTKYTLSNNPEP-------------NNSFESKG 108

Query: 133 TIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFEDSTRWADLLP 192
            +Q         + ++++    S +  + +++ + L +T++   VQ+V+ +S +W DLLP
Sbjct: 109 QLQFAINDVEERIKIKYQVMPYSKEFGFSAEEEQQLNVTYNVFHVQIVYNESEKWPDLLP 168

Query: 193 SIFSGE--VELVPEESNHTSP---RLPHLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQL 247
            +F+GE  +++  +  +   P   +L +++ + T++CTLG +S++ K  +     ++Y L
Sbjct: 169 ILFTGENEIKIARKRKDRLFPELFKLANINDISTVVCTLGASSATAKKQNMTVNKIDYDL 228

Query: 248 TFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVVLRP 307
           T+ +++ F + E+K+++I+TSFNN+L+S+IFPYF+ K +LENDL+  + P + +L +LRP
Sbjct: 229 TYNLIRAFTTTENKKVIIVTSFNNALISNIFPYFRTKLRLENDLKTTLEPPIKELYILRP 288

Query: 308 GPIVGNH 314
           GPI G H
Sbjct: 289 GPIKGKH 295

>TPHA0D02060 Chr4 (424797..426287) [1491 bp, 496 aa] {ON} Anc_5.348
           YDR317W
          Length = 496

 Score =  150 bits (379), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 120/434 (27%), Positives = 198/434 (45%), Gaps = 64/434 (14%)

Query: 13  FQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKL---ELYENSDINHFTLNKFFY 69
           F D+IL+ GSTGLIG   L+     +LY+    +L+  +   E    + I   T+ K  Y
Sbjct: 31  FSDNILVVGSTGLIGRNVLKSFFDTDLYIKHSQELKRLIASSEYDSTTRIKEVTIKKTAY 90

Query: 70  CVNRKLNNEKRSPGNEYLMERCKATPLVFRGQDYYLH------NNTSATPPAS------- 116
            + RK  + +       + ++ K   L   G+ +YL        N S  P  S       
Sbjct: 91  SLTRKRQSVELFKNKTIVGQKLKEVEL--DGKTFYLQFDLLKQINDSGEPKESFLKSLTT 148

Query: 117 ----------------QSSNPSLGNNVFEEDGTI-----QLTKTVDN------------- 142
                            +S  + G +V  E+ +I      L  +V N             
Sbjct: 149 KKMLEALTHGKGVKVTSNSKENQGISVRNEESSILKKDKSLLFSVINYNESEGNVILQPQ 208

Query: 143 --RSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFEDSTRWADLLPSIFSGEVE 200
              +V   F   +    L + S     L I F   +  L   DST W  LLP +F    +
Sbjct: 209 EYSNVECYFNLQQYDSSLIFASSSGDILKINFDLKLYHLSAVDSTIWPSLLPVLFDSNTK 268

Query: 201 LVP-----EESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQNF 255
           LVP     E  + T+ +LP L +VK M+ +LG  S S K+  +    ++Y+L   ++ +F
Sbjct: 269 LVPNKGLIENIDLTNEKLPLLSEVKVMLNSLGSRSHSPKNETFKN--IDYKLNLSLINSF 326

Query: 256 ASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVVLRPGPIVGNHV 315
            +  DK+++I+TS N  + +    Y   K  LE DL+  +   + +LV+LRPGP+VG  +
Sbjct: 327 NNTSDKKVIIITSVNKKIYTFFSRYLNYKMVLEEDLKTNLDNKINELVILRPGPLVGTPM 386

Query: 316 N---LNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIGFKTKASELVAKAMYRK 372
               +      L+ + S  +QL +YK + ++YK + ++ I+  GF+   + ++AK  YR+
Sbjct: 387 TTKLIPGLTAHLKRNDSSLKQLINYKRFAFDYKVALLRRIKYTGFEPTCTNILAKTFYRR 446

Query: 373 PGSSVLGYCVPASK 386
           PG+S+LGY +PASK
Sbjct: 447 PGTSLLGYTIPASK 460

>Kwal_34.15989 s34 complement(147085..148605) [1521 bp, 506 aa] {ON}
           YDR317W - Hypothetical ORF [contig 272] FULL
          Length = 506

 Score =  150 bits (378), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 128/402 (31%), Positives = 193/402 (48%), Gaps = 33/402 (8%)

Query: 15  DHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLE-LYENSD---INHFTLNKFFYC 70
           D  L+FG TGL G L    L +  +YL+A NDLQ K+  L+  SD    +H  + +    
Sbjct: 77  DSTLIFGITGLTGGLIAANLAQPWVYLNATNDLQRKISSLFPFSDQLEKHHHFMRRTRSP 136

Query: 71  VNRKLNNEK--RSPGNEYLMERCKAT--PLVFRGQDYYLHNNTSATPPASQSSNPSLG-N 125
           +   L  EK      N +   R   T   +   G D    ++          S  +L   
Sbjct: 137 LCNLLTKEKSVEVTKNLFCFTRRSVTLEQICLDGLDASWEHSIDYKGSKMVCSKENLSCE 196

Query: 126 NVFEEDGTIQLTKTV-DNRSVTLRFRQTRKSYQLEYI-SKDLKN------LLITFHFTIV 177
             F + GT    +   D  +VTL  +  + +Y L Y  S+D+        L+I     I+
Sbjct: 197 EPFVKRGTTTFFQDASDAPAVTLTIQLQKFTYHLNYDNSRDVHGETCRHTLMIQLRVNII 256

Query: 178 QLVFEDSTRWADLLPSIFSGEVELVPEESNHTSPRL----PHLDQVKTMICTLGPNSSST 233
            +V EDS +W  LL  IF       P     T   +    P L Q+ TM+ +LG  S   
Sbjct: 257 LIVEEDSQKWPMLLTRIFGKHASKRPLIVKDTEEPILWTAPPLTQINTMVSSLGSKSFEK 316

Query: 234 KHSHYDRYFVEYQLTFQIVQNFASCEDK------RLVIMTSFNNSLVSHIFPYFKAKYQL 287
           K     R+F +Y+L   +   F  C+DK      ++VI+TSFNN  +S    YF++K  L
Sbjct: 317 KKPKISRHFADYELNMLLAHAF--CKDKTRGLEKKIVIITSFNNLFLSSTSDYFQSKLML 374

Query: 288 ENDLQNKVAPALAQLVVLRPGPIVGNHVN-LNDRDL--RLRYSPSLCEQLKHYKEWCWEY 344
           E DL  KV  AL +LV+LRPGP+VGNH + L    +  +  + P+   ++  +K+ C E 
Sbjct: 375 EQDLVTKVQ-ALDKLVLLRPGPLVGNHTHQLQSPSIIDKPSFIPTAMFKVLKFKKNCIER 433

Query: 345 KKSFVKEIRKIGFKTKASELVAKAMYRKPGSSVLGYCVPASK 386
           K   ++EI ++G +TK SEL+A+  Y++  S +LG+ VPA K
Sbjct: 434 KLQLLREISQVGIRTKLSELMARLAYQRSCSPLLGHVVPAYK 475

>KLTH0H14784g Chr8 (1283834..1285378) [1545 bp, 514 aa] {ON} weakly
           similar to uniprot|Q06674 Saccharomyces cerevisiae
           YDR317W Hypothetical ORF
          Length = 514

 Score =  136 bits (342), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 110/403 (27%), Positives = 184/403 (45%), Gaps = 50/403 (12%)

Query: 11  QSFQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDINHFTLNKFFYC 70
           Q   D++L+ G+TGL GSL L  L +  +YL+A NDLQSK++    +D+  FT +  F  
Sbjct: 77  QRVTDNVLILGATGLTGSLILANLAQPWIYLNATNDLQSKVDSLYPADLERFTKHNIFV- 135

Query: 71  VNRKLNNEKRSPGNEYLMER----------CKAT-PLVFRGQDYYLHNNTSATPPASQSS 119
                  + +SP    L+ R          C A  P+   G      + +       +  
Sbjct: 136 ------KKPKSPLCNILVRRKSIEVTKNLYCLARRPIAVEGMPLDGLDASWEHTVRCKGF 189

Query: 120 NPSLGNNVFEEDGTIQL---------TKTVDNRSVTLRFRQTRKSYQLEYI-SKDLKN-- 167
           +   G      D T++          T     R + L+ +    S++L Y  S+D     
Sbjct: 190 DLICGKGGISRDCTLERNAAMYELASTHNCPGREIILQLQSF--SFKLVYENSRDPHGDT 247

Query: 168 ----LLITFHFTIVQLVFEDSTRWADLLPSIFSGEV---ELVPEESNHTSP---RLPHLD 217
               L++  +  ++ ++  DS RW  LL  +F  +     L+P+            P L 
Sbjct: 248 CGHALMVKLNINVICVIDTDSQRWPALLTDVFGEQPMKRGLIPQGQGLEGISHWEFPSLG 307

Query: 218 QVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQNF----ASCEDKRLVIMTSFNNSL 273
            V T++  LG      + S   R++V+Y+L   + Q F    A    K++V++TSFN+SL
Sbjct: 308 DVGTLVSALGSTRHQERKSSIPRHYVDYELNLTLAQEFCQRKARGTRKKIVVVTSFNSSL 367

Query: 274 VSHIFPYFKAKYQLENDLQNKVAPALAQLVVLRPGPIVGN---HVNLNDRDLRLRYSPSL 330
           +S +  YF+ K +LE DL  KV   +  LV+LRPGP+VGN   H        +  + P+ 
Sbjct: 368 LSTVSNYFQTKLKLEQDLYTKVH-GMDNLVLLRPGPLVGNHTPHAQTPPATNKFTFLPAA 426

Query: 331 CEQLKHYKEWCWEYKKSFVKEIRKIGFKTKASELVAKAMYRKP 373
              +   K+ C++ K   ++++ K+G + K SEL A+  Y+ P
Sbjct: 427 LFHILVLKKRCFDRKVRLLRDLMKVGLRAKLSELGARLAYQHP 469

>Ecym_8185 Chr8 complement(383906..385321) [1416 bp, 471 aa] {ON}
           similar to Ashbya gossypii AGR348W
          Length = 471

 Score =  133 bits (334), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 103/388 (26%), Positives = 177/388 (45%), Gaps = 77/388 (19%)

Query: 15  DHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDINHFTLNKFFYCVNRK 74
           D++++ GSTGL GS  L+  +                  + +  +    L K  +C NR+
Sbjct: 100 DNVIILGSTGLTGSQVLKGCMAP----------------WTSGVLYDLKLTKNIWCFNRR 143

Query: 75  LNNEKRS----PGNEYLMERCKATPLVFRGQDYYLHNNTSATPPASQSSNPSLGNNVFEE 130
           L     S    P     +      P + R  D  +  + +                + + 
Sbjct: 144 LKTVDFSISKLPPTWTAVVNYGGEPHIIRKYDLKIKQHIT---------------EIGKL 188

Query: 131 DGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFEDSTRWADL 190
           DG              L F+  +  ++L+  + ++KN+ +     + Q++  DS +W   
Sbjct: 189 DG--------------LEFQWDQFDWELKLPTDEVKNVTVN----VFQIIQNDSKKWDKT 230

Query: 191 LPSIFSGEVELVPEESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQ 250
              +F+G  + +   ++     LP +DQV+T+I TLG +S  ++     R FV+Y L   
Sbjct: 231 FSELFTGNRKPL---NDRIEVYLPSIDQVETLISTLGSSSWESRKMKTPRSFVDYTLNMD 287

Query: 251 IVQNFASCEDKRL----VIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVVLR 306
           + + FA  + K L    VI+TSFNN  +  + PYF+ K +LENDL   V P L  L +LR
Sbjct: 288 MAKVFAPDQKKSLIKHMVIVTSFNNLALGVLSPYFRTKQKLENDLTYDV-PGLTHLTILR 346

Query: 307 PGPIVGNHVNLNDRDLRLRYSPSL-CEQLKHYKEWCWEYKKSFVK-------EIRKIGFK 358
           PGP++G H        ++  +P L       YK  C+ +K+S +K       +++ +G  
Sbjct: 347 PGPLIGQHGK------QIILAPQLPVGSGVLYK--CYAWKRSLLKAKLHWLSQVKDVGPS 398

Query: 359 TKASELVAKAMYRKPGSSVLGYCVPASK 386
            K +EL+AKA Y  PG+ ++GY +P+SK
Sbjct: 399 KKVTELIAKATYHLPGNWIVGYSIPSSK 426

>SAKL0G08910g Chr7 complement(761626..763143) [1518 bp, 505 aa] {ON}
           weakly similar to uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W Hypothetical ORF
          Length = 505

 Score =  133 bits (334), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 102/375 (27%), Positives = 179/375 (47%), Gaps = 42/375 (11%)

Query: 39  LYLDAGNDLQSKLEL-YENSDINH--------------------FTLNKFFYCVNRKLNN 77
           LYL   ND+Q K+++ +E  D++                       + K  +C NRKL  
Sbjct: 98  LYLGTTNDVQDKIQMMFEAGDLSSESNPPNVKRTFGQILRGEKSIEITKNLFCFNRKLAL 157

Query: 78  EKRSPGNEYLMERCKATPLVFRGQDYY-LHNNTSATPPASQSSNPSLGNNVFEEDGTIQL 136
            +     EY+ +  + + + ++G  Y+   NN S   P  +      G  V   + +I  
Sbjct: 158 LEIPSTPEYINDYWEYS-IDYKGTKYHSKKNNISFGVPTLK-----FGKLVNSNENSI-- 209

Query: 137 TKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFEDSTRWADLLPSIFS 196
           T     +    +F   R+   ++ +    + L+I+    ++Q++  +S  W  LL S F 
Sbjct: 210 TNQCQLQQFDYKFEFQREDPSMQNLRTRAQTLIISLKINVIQILEPNSKLWPLLLHSTFG 269

Query: 197 G---EVELVPEESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQ 253
                V L  +    T    P L +V T++  LG  +   K SH  R FV+Y L F++ +
Sbjct: 270 DTDTNVALHVQGQVPTPMIFPSLSKVNTLVSALGSTTFEQKKSHVSRDFVDYDLNFKMAE 329

Query: 254 NFASCED-----KRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVVLRPG 308
            F +        K++V++TSFNN  +S   PYF  K +LE DL  ++ P L +LV+LRPG
Sbjct: 330 EFTTNSSEHGIKKKVVVITSFNNFALSSTSPYFHTKLKLEQDLATRI-PELDELVILRPG 388

Query: 309 PIVGNHVNLNDRDLRLRYSPSLCEQLK---HYKEWCWEYKKSFVKEIRKIGFKTKASELV 365
           P++G+H          + +  L + L    +YK+ C+++K+ F++ + ++G KTK +E+ 
Sbjct: 389 PLIGSHTPEFIPGDPPKSTNGLLKPLSTVCYYKKACYDHKRHFLQSVTQVGLKTKMTEVF 448

Query: 366 AKAMYRKPGSSVLGY 380
           A+ +YR   S + GY
Sbjct: 449 ARLIYRSSCSWMFGY 463

>AGR348W Chr7 (1377726..1379354) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR317W
          Length = 542

 Score =  131 bits (329), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 103/383 (26%), Positives = 179/383 (46%), Gaps = 68/383 (17%)

Query: 15  DHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDINHFTLNKFFYCVNRK 74
           ++ +L GSTGL GS  L++L+   +    G  L+                 + F+C +RK
Sbjct: 171 ENYVLLGSTGLTGSQVLQDLITPWI----GAPLEG-------------VTARTFWCFSRK 213

Query: 75  LNNEKRSPGNEYLMERCKATPLVFRGQDYYLHNNTSATPPASQSSNPSLGNNVFEEDGTI 134
             + +    N   + +     + F G+ + +  N           +  L  ++ E  G +
Sbjct: 214 FQDVEIDISN---LPKTWTAIVEFEGEKHVIRKN-----------DVRLIRHLSECGGML 259

Query: 135 QLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFEDSTRWADLLPSI 194
            L    D           + ++ +   + +++N  I     +VQ+V  DS RW DL   +
Sbjct: 260 GLKCHWD-----------QYNWDVVLTTGEVRNATIN----VVQVVQPDSRRWPDLFNKM 304

Query: 195 FSGEVELVPEESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQN 254
           F+G V      + ++   +P + +++T+I TLG  S   + S   R FV+Y L  Q+ + 
Sbjct: 305 FTGGVRTF---NAYSEIYMPAVTEIETLISTLGSTSWEARKSKAPRAFVDYTLNMQMAKT 361

Query: 255 FA----SCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVVLRPGPI 310
           FA        K +VI+TSFN+  +  +  YF+ K +LENDL   V P L  L +LRPGP+
Sbjct: 362 FAPDPKKGTVKHMVIVTSFNHLALGMVSQYFRTKQRLENDLTYDV-PGLTHLTILRPGPL 420

Query: 311 VGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVK-------EIRKIGFKTKASE 363
           +G H     + +    +P     L      C+ YKK+ ++       +++++G  TK +E
Sbjct: 421 LGEH---GSKPVISPTNPDTGNMLTR----CYTYKKNVMRTQFNWLAQVKEVGPTTKVTE 473

Query: 364 LVAKAMYRKPGSSVLGYCVPASK 386
           LVAKA Y  PG+ ++GY +PA +
Sbjct: 474 LVAKATYHLPGNWIVGYSIPAGR 496

>TBLA0A03100 Chr1 (739771..740889) [1119 bp, 372 aa] {ON} Anc_5.348
           YDR317W
          Length = 372

 Score =  110 bits (276), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 102/364 (28%), Positives = 159/364 (43%), Gaps = 50/364 (13%)

Query: 18  LLFGSTGLIGSLTLEELLKVELYLDAGN------DLQSKLELYENSDINHFTLNKFFYCV 71
           + FGSTG+ G  TL  LL +  YL A +      +L    +     D     L K  +C+
Sbjct: 8   IFFGSTGMTGFTTLTNLLNINSYLQAKDPQSAIDNLPQDFQWQACDDSLDLYLVKNIFCI 67

Query: 72  NRKLNN------EKRSPGNEYLMERCKATPLVFRGQDYYLHNNTSATPPASQSSNPSLGN 125
           NR+  +      EK    N  +  + K   L F+     + NN +           +   
Sbjct: 68  NRRFFDSPIYLDEKIISSNISINYKDKTFELQFQSNTNSVSNNITEQNELKLPLVSTDCL 127

Query: 126 NVFEEDGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLL---------------- 169
             F + G IQL  T    +  L   +    +  +    + K +                 
Sbjct: 128 RYFIDTGNIQLETTPGKENQILTTDEVWYHFNQQLCQLNFKQINLNENENDNDNVQEKFI 187

Query: 170 -ITFHFTIVQLVFEDSTRWADLLPSIFSGEVEL----------VPEESNHTSP-RLPHLD 217
            + +   I Q V   S  W ++LP+IF     L          + + +N  S   LP L+
Sbjct: 188 KLNYIINIYQFVLPKSDTWLEVLPNIFKPTTILHSKINCTWNYIDQFTNEKSNIVLPKLE 247

Query: 218 QVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHI 277
            ++ MICTLG N         D+  +++ LTFQ+   F++   K+LVI+T+FNNSL+S  
Sbjct: 248 DIQVMICTLGTNLLC------DQKKIDFDLTFQLSNWFSNRLGKKLVIVTAFNNSLLSKT 301

Query: 278 FPYFKAKYQLENDLQNKVAPALAQLVVLRPGPIVGNHVNLN---DRDLRLRYSPSLCEQL 334
           F YF  K QLE  L+  +   L +LV+LRPGP++G HV LN   ++ + L +S  + +QL
Sbjct: 302 FNYFNVKNQLEKSLKYDLDFPLGELVILRPGPLLGTHV-LNPSEEQAVVLNHSTKILKQL 360

Query: 335 KHYK 338
             YK
Sbjct: 361 WFYK 364

>KLLA0B10120g Chr2 (886187..887233) [1047 bp, 348 aa] {ON} some
           similarities with uniprot|Q06674 Saccharomyces
           cerevisiae YDR317W
          Length = 348

 Score = 96.3 bits (238), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 129/269 (47%), Gaps = 35/269 (13%)

Query: 123 LGNNVFEEDGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTIVQLVFE 182
           LG  V +     Q +  V+ + V   F ++  +        DL ++ +    T ++    
Sbjct: 58  LGTEVEKISSMFQKSDLVEWKCV---FNESSNTISYSTTIHDLISICVNVEVTTIKE--P 112

Query: 183 DSTRWADLLPSIFSGEVELVPEESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYF 242
           DST+WA ++P              +H     P  D   ++I  LG  S+ +K +   R +
Sbjct: 113 DSTKWAQMIP--------------HHIFINDPSADL--SVISCLGSTSARSKRTGVARDW 156

Query: 243 VEYQLTFQIVQ-----NFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAP 297
           V+  L   I++     +  S +  + +IMTSFNN  +S +FPYFKAK +LE + Q  +  
Sbjct: 157 VDKILNLDILKAILNNDILSQKLSQYIIMTSFNNFAISRMFPYFKAKQELETNTQFLLQN 216

Query: 298 ALAQLVVLRPGPIVGNHVNLNDRDLRLRYSPSLCEQLKH----YKEWCWEYKKSFVKEIR 353
             A +V+LRPGP++G H + +   +     P L ++L H    YK+  + +    + E +
Sbjct: 217 HRASIVILRPGPLIGKHGSTSSFTV-----PELDDRLLHSILRYKKAIFHHYVRRMNEWK 271

Query: 354 KIGFKTKASELVAKAMYRKPGSSVLGYCV 382
            +G  T+ SELVA+  Y  PG+  +GY V
Sbjct: 272 DVGIATRTSELVAQFSYNMPGAFFVGYPV 300

>Ecym_4479 Chr4 complement(973594..974268) [675 bp, 224 aa] {ON}
           similar to Ashbya gossypii ADR005W
          Length = 224

 Score = 43.1 bits (100), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/138 (22%), Positives = 61/138 (44%), Gaps = 29/138 (21%)

Query: 175 TIVQLVFEDSTRWADLLPSIFSGEVELVPEESNHTSPRLPHLDQVKTMICTLGPNSSSTK 234
           ++  ++ ED+  W D +P                        D +  +   LG   ++  
Sbjct: 44  SVKSIINEDTETWIDSIP------------------------DGINVLFSALGTTKAAA- 78

Query: 235 HSHYDRYFVEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNK 294
            S  ++Y +++ L   + +       K LV+++S   S+ S + PYFK K +LE D+   
Sbjct: 79  GSIENQYKIDHGLNLAVAKAAKEKGCKTLVLVSSLGASIESRL-PYFKMKGELERDV--- 134

Query: 295 VAPALAQLVVLRPGPIVG 312
           +A    + ++LRPG ++G
Sbjct: 135 LALGFERTILLRPGVLLG 152

>TDEL0H03110 Chr8 (512079..512753) [675 bp, 224 aa] {ON} Anc_7.148
           YER004W
          Length = 224

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/146 (21%), Positives = 63/146 (43%), Gaps = 30/146 (20%)

Query: 172 FHFTIVQLVFEDSTRWADLLPSIFSGEVELVPEESNHTSPRLPHLDQVKTMICTLGPNSS 231
           F  T VQ V +D+T+W   +P+                     HL+ V T + T     +
Sbjct: 39  FQSTAVQKVDKDTTKWGQYIPN--------------------EHLEFVFTGLAT-----T 73

Query: 232 STKHSHYDR-YFVEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLEND 290
                 +D+ Y +++ L  ++ +  A  +     ++ S   +    +F Y K K ++E D
Sbjct: 74  RGAAGGFDKQYKIDHDLNIELAK-VAKEKGCSTFVLVSSGGAKEDSMFAYMKMKGEIERD 132

Query: 291 LQNKVAPALAQLVVLRPGPIVGNHVN 316
           +   +A      ++LRPGP++G+ + 
Sbjct: 133 I---LALGFDHTIILRPGPLLGDRLT 155

>TBLA0A10500 Chr1 (2585576..2586289) [714 bp, 237 aa] {ON} Anc_7.148
           YER004W
          Length = 237

 Score = 38.9 bits (89), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/138 (21%), Positives = 57/138 (41%), Gaps = 28/138 (20%)

Query: 175 TIVQLVFEDSTRWADLLPSIFSGEVELVPEESNHTSPRLPHLDQVKTMICTLGPNSSSTK 234
           T  Q+V +D+++W    P+                       D++  ++  L     +  
Sbjct: 46  TAQQIVEKDNSKWISHFPT-----------------------DKIDILMTGLATTKKAAG 82

Query: 235 HSHYDRYFVEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNK 294
            +   +Y++++ L     +          V+++S   S  S  F Y K K ++E DL+  
Sbjct: 83  GAQ-QQYYIDHDLNIDFAKKAKENGCSTFVVVSSAGASADSRFF-YLKMKGEIERDLK-- 138

Query: 295 VAPALAQLVVLRPGPIVG 312
            A     L++LRPGP++G
Sbjct: 139 -AIDFDHLIILRPGPLLG 155

>ZYRO0D09548g Chr4 (812531..813208) [678 bp, 225 aa] {ON} similar to
           uniprot|P40008 Saccharomyces cerevisiae YER004W FMP52
           The authentic non-tagged protein was localized to the
           mitochondria
          Length = 225

 Score = 38.1 bits (87), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 31/139 (22%), Positives = 59/139 (42%), Gaps = 28/139 (20%)

Query: 176 IVQLVFEDSTRWADLLPSIFSGEVELVPEESNHTSPRLPHLDQVKTMICTLGPNSSSTKH 235
           + Q+V  DS++WA L P                          VK      G  + +   
Sbjct: 44  VKQIVETDSSKWAQLFPET-----------------------GVKFYFSAFG-TTRAAAG 79

Query: 236 SHYDRYFVEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKV 295
           S  + Y +++ L  ++ +   +     +V+++S   +  S + PYFK K ++E D+   +
Sbjct: 80  SAENFYKIDHDLNVELAKAAKTKGCTTMVLVSSVGANENS-MLPYFKDKGEIERDI---L 135

Query: 296 APALAQLVVLRPGPIVGNH 314
           A      ++LRPGP++G  
Sbjct: 136 ALDFDHTIILRPGPLLGRQ 154

>Smik_5.118 Chr5 (163900..164595) [696 bp, 231 aa] {ON} YER004W
           (REAL)
          Length = 231

 Score = 38.1 bits (87), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 25/119 (21%), Positives = 53/119 (44%), Gaps = 8/119 (6%)

Query: 240 RYFVEYQLTFQIVQNFASCEDK--RLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAP 297
           +Y +++ L  Q+ +   + +DK    +++ S   +     F Y K K ++E D+   +A 
Sbjct: 86  QYKIDHDLNLQLAR---AAKDKGCETIVLVSSAGAHADSRFGYMKMKGEIERDV---IAL 139

Query: 298 ALAQLVVLRPGPIVGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIG 356
                ++LRPGP++G   N          + +L  ++   +   W     +  E+ K+G
Sbjct: 140 NFKHTIILRPGPLLGERENSKQSGFGGNLAAALGVRVYRSRFQSWLGYPVYGDEVGKVG 198

>YER004W Chr5 (159580..160275) [696 bp, 231 aa] {ON}  FMP52Protein
           of unknown function, localized to the mitochondrial
           outer membrane; induced by treatment with
           8-methoxypsoralen and UVA irradiation
          Length = 231

 Score = 37.7 bits (86), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 21/79 (26%), Positives = 39/79 (49%), Gaps = 8/79 (10%)

Query: 240 RYFVEYQLTFQIVQNFA--SCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAP 297
           +Y +++ L  Q+ Q      CE    +++ S   +     F Y K K ++E D+   +A 
Sbjct: 86  QYKIDHDLNLQLAQAAKEKGCET---IVLVSSAGAHPDSRFGYMKMKGEIERDV---IAL 139

Query: 298 ALAQLVVLRPGPIVGNHVN 316
               +++LRPGP++G   N
Sbjct: 140 DFKHIIILRPGPLLGERTN 158

>Suva_5.91 Chr5 (135337..136023) [687 bp, 229 aa] {ON} YER004W
           (REAL)
          Length = 229

 Score = 37.7 bits (86), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 24/119 (20%), Positives = 53/119 (44%), Gaps = 8/119 (6%)

Query: 240 RYFVEYQLTFQIVQNFASCEDKRL--VIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAP 297
           +Y +++ L  Q+ +   + +D+    +++ S   + V   F Y K K ++E D+   +A 
Sbjct: 86  QYKIDHDLNMQLAR---AAKDRGCDTIVLVSSAGAHVDSRFGYMKMKGEIERDI---IAL 139

Query: 298 ALAQLVVLRPGPIVGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIG 356
                ++LRPGP++G   N          + +L  ++   +   W     +  ++ K G
Sbjct: 140 NFKHTIILRPGPLLGKRTNSKQNGFGGNLAAALGARVYRSRLQSWLGYPVYGDDVGKAG 198

>Smik_10.215 Chr10 (350516..355567) [5052 bp, 1683 aa] {ON} YJL039C
           (REAL)
          Length = 1683

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/86 (31%), Positives = 44/86 (51%), Gaps = 4/86 (4%)

Query: 215 HLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQNFASC--EDKRLVIMTSFNNS 272
           +LD++ T  C L  +S +T +S   +YF+  Q   QIV    +C  ED  L      N  
Sbjct: 82  NLDEIVT--CELILSSDATANSGKVQYFLRRQFILQIVSFIVNCFHEDTELYQELLKNGV 139

Query: 273 LVSHIFPYFKAKYQLENDLQNKVAPA 298
           LVS+I P FK  +   ++++ ++  A
Sbjct: 140 LVSNILPAFKFIHTQLSEIKQQINKA 165

>KLTH0H00264g Chr8 complement(23047..23715) [669 bp, 222 aa] {ON}
           similar to uniprot|P40008 Saccharomyces cerevisiae
           YER004W FMP52 The authentic non-tagged protein was
           localized to the mitochondria
          Length = 222

 Score = 35.0 bits (79), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/121 (22%), Positives = 58/121 (47%), Gaps = 9/121 (7%)

Query: 195 FSGEVE-LVPEESNHTSPRLPHLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQ 253
           + G+V  L+ E+S++ S  +P  +    +   L          ++  Y V++ +  Q+ +
Sbjct: 43  YDGKVRSLILEDSSNWSAAVP--ENYDILFSGLATTRGEAGKENF--YKVDHDMNLQLAR 98

Query: 254 NFASCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVAPALAQLVVLRPGPIVGN 313
           + A  +     ++ S   +  + +F Y K K +LE D+   +A    + ++LRPGP++G 
Sbjct: 99  S-AKEKGYSTYVVVSSTGADENSMFYYMKTKGELERDI---LALGFERTIILRPGPLLGE 154

Query: 314 H 314
            
Sbjct: 155 R 155

>NDAI0C02910 Chr3 (668944..670647) [1704 bp, 567 aa] {ON} Anc_5.143
          Length = 567

 Score = 34.7 bits (78), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 34/138 (24%), Positives = 63/138 (45%), Gaps = 8/138 (5%)

Query: 107 NNTSATPPASQSSNPSLGNNVFEEDGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLK 166
           NNTSAT   +  S+ S   N  +ED  +Q T T   R  + + ++ RK     +I  ++ 
Sbjct: 90  NNTSATHSHNNKSDNSGAFNPNDEDNALQRTGT---RYFSPKLKKARKDVIYSFIFTNV- 145

Query: 167 NLLITFHFTIVQLVFEDSTRWADLLPSIFSGEVELVPEESNHTSPRLPHLDQVKTMICTL 226
            +L  F FTI  L +  + +  D    +   ++  V ++   TSP +  +  +   + T+
Sbjct: 146 -VLAIFAFTIFSLFWGVNYKNFDRAHKV---QILAVIQDEGITSPNISTIIPIAAAVPTI 201

Query: 227 GPNSSSTKHSHYDRYFVE 244
             +S  T H +    F++
Sbjct: 202 AESSMGTYHIYNSTGFMD 219

>Skud_5.103 Chr5 (156788..157471) [684 bp, 227 aa] {ON} YER004W
           (REAL)
          Length = 227

 Score = 34.3 bits (77), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 24/120 (20%), Positives = 50/120 (41%), Gaps = 8/120 (6%)

Query: 239 DRYFVEYQLTFQIVQNFA--SCEDKRLVIMTSFNNSLVSHIFPYFKAKYQLENDLQNKVA 296
           ++Y +++ L  Q+ +      CE    +++ S   +     F Y K K ++E D+   +A
Sbjct: 85  NQYKIDHDLNLQLARAAKEKGCET---IVLVSSAGAHPDSRFGYMKMKGEIERDV---IA 138

Query: 297 PALAQLVVLRPGPIVGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEYKKSFVKEIRKIG 356
                 ++LRPGP++G              + +L  ++       W     +  E+ K+G
Sbjct: 139 LNFKHTIILRPGPLLGERTKSKQSGFGGNLTAALGTRVYRSILQSWLGYPVYGDEVGKVG 198

>Skud_10.111 Chr10 (199209..201668) [2460 bp, 819 aa] {ON} YJL102W
           (REAL)
          Length = 819

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 43/112 (38%), Gaps = 25/112 (22%)

Query: 258 CEDKRLVIMTSFNNSLVSHIFP-----YFKAKYQLEN------DLQNKVAPALA------ 300
           C++  +  +T F+  LV H        Y K   Q  N       +QNK+ P L       
Sbjct: 250 CKESMIETLTEFDEDLVQHFLEEAEGDYSKVSAQSLNASIRKLTVQNKIVPILCGASFKN 309

Query: 301 --------QLVVLRPGPIVGNHVNLNDRDLRLRYSPSLCEQLKHYKEWCWEY 344
                    +V   P PI      LND+D+ ++Y P +   +   K +C  +
Sbjct: 310 IGVQPLLDAVVNYLPSPIEATLPELNDKDIPMKYDPKVGCLVNDNKNFCIAF 361

>TBLA0F03310 Chr6 complement(814437..814922) [486 bp, 161 aa] {ON}
           Anc_7.148 YER004W possible pseudogene; truncated at 5'
           end
          Length = 161

 Score = 32.7 bits (73), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 3/39 (7%)

Query: 278 FPYFKAKYQLENDLQNKVAPALAQLVVLRPGPIVGNHVN 316
           F Y K K ++E DL+   A     L++LRPG ++G   N
Sbjct: 54  FTYLKMKGEIERDLE---AIGFDHLIILRPGKLLGERQN 89

>NDAI0D01440 Chr4 (335388..338645) [3258 bp, 1085 aa] {ON} Anc_1.506
           YKL197C
          Length = 1085

 Score = 32.0 bits (71), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 43/91 (47%), Gaps = 2/91 (2%)

Query: 9   KHQSFQDHILLFGSTGLIGSLTLEELLKVELYLDAGNDLQSKLELYENSDINHFTLNKFF 68
           KH   +DHILL  S   I SLT +  +K+++       +  K        IN + +  F 
Sbjct: 298 KHTIMKDHILLSDSLWSILSLTPQNGVKLKVQFVKNRTIVQKHTFMNEKRINIYPI--FS 355

Query: 69  YCVNRKLNNEKRSPGNEYLMERCKATPLVFR 99
             ++ K N E  +   ++LMER KA+ L  R
Sbjct: 356 SNLSAKPNPESIARNTKFLMERLKASTLGKR 386

>CAGL0H10164g Chr8 complement(991125..992579) [1455 bp, 484 aa] {ON}
           weakly similar to uniprot|P38236 Saccharomyces
           cerevisiae YBR057c MUM2 meiotic protein
          Length = 484

 Score = 31.6 bits (70), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 96/235 (40%), Gaps = 33/235 (14%)

Query: 60  NHFT---LNKFFYCVNRKLNNEKRSPGNEYLMERCKATPLVFRGQDYYLHNNTSATPPAS 116
           N FT   +  ++Y  NR+ N +        L+   K  P  + G D     N + T  A+
Sbjct: 238 NSFTSDAVTGYYYPTNRETNKQG-------LINSTKL-PSRYSGSDNGQVYNNATTFDAT 289

Query: 117 QSSNPSLGNNVFEEDGTIQLTKTVDNRSVTLRFRQTRKSYQLEYISKDLKNLLITFHFTI 176
           QSS PS  +         + +  +D    TL++    K  QL+ + ++L  L        
Sbjct: 290 QSSQPSNCSATVNPKEPKESSGEID----TLKYDIQVKDAQLQSLQRELTRLKSAISV-A 344

Query: 177 VQLVFEDSTRWADLLPSIFSGEVELVPEE--------SNHTSPRLPHLDQVKTMI----- 223
           V    + S++ AD    I + E++ VP          S+    R   LD+ KT +     
Sbjct: 345 VDNTKDISSKTADKEEHITTKEID-VPNSLDIIFRKLSSALQKREKELDETKTNLESVLA 403

Query: 224 -CTLGPNSSSTKHSHYDRYFVEYQLTFQIVQNFASCEDKRLVIMTSFNNSLVSHI 277
              L P++SSTK   YD   + ++   ++     + E++ +  M SF  +   HI
Sbjct: 404 AMALNPSNSSTKFGRYDPENLAHKTVVRL--ETLTKENQEMARMLSFGRAKEKHI 456

>Suva_12.37 Chr12 complement(49774..54825) [5052 bp, 1683 aa] {ON}
           YJL039C (REAL)
          Length = 1683

 Score = 31.6 bits (70), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 45/86 (52%), Gaps = 4/86 (4%)

Query: 215 HLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQNFASCEDKRLVIMTSF--NNS 272
           +LD++  ++C L  +S +T ++   +YF+  Q   QIV    +C DK   +      N +
Sbjct: 82  NLDEI--VVCELILSSDATANNGKVQYFLRRQYILQIVSFVVNCFDKDTQLYQELIKNGA 139

Query: 273 LVSHIFPYFKAKYQLENDLQNKVAPA 298
           LVS+I   F+  +   ++++ ++  A
Sbjct: 140 LVSNILLAFRFIHTQLSEIKQQINKA 165

>Skud_10.175 Chr10 (326685..331736) [5052 bp, 1683 aa] {ON} YJL039C
           (REAL)
          Length = 1683

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 20/70 (28%), Positives = 37/70 (52%), Gaps = 4/70 (5%)

Query: 215 HLDQVKTMICTLGPNSSSTKHSHYDRYFVEYQLTFQIVQNFASCEDKRLVIMTSF--NNS 272
           +LD++  ++C L  +S  T ++   +YF+  Q   QIV    +C DK   +      N++
Sbjct: 82  NLDEI--VVCELILSSDVTANNGKVQYFLRRQYILQIVSFVVNCLDKDTELYQELLKNDT 139

Query: 273 LVSHIFPYFK 282
           L+S++   FK
Sbjct: 140 LISNVLSAFK 149

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,396,954
Number of extensions: 2157967
Number of successful extensions: 6753
Number of sequences better than 10.0: 50
Number of HSP's gapped: 6922
Number of HSP's successfully gapped: 53
Length of query: 415
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 303
Effective length of database: 40,638,807
Effective search space: 12313558521
Effective search space used: 12313558521
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)