Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F00528g6.12ON77774072e-53
Kpol_1032.36.12ON78761756e-18
ACR014C6.12ON70761401e-12
Ecym_30156.12ON70761401e-12
TPHA0M002206.12ON78811373e-12
KLLA0D00880g6.12ON71771288e-11
NCAS0F002106.12ON79781271e-10
SAKL0E00924g6.12ON97851262e-10
TDEL0G045906.12ON74801211e-09
Smik_5.286.12ON74771201e-09
YEL059C-A (SOM1)6.12ON74771192e-09
Skud_5.306.12ON74731183e-09
Kwal_56.223596.12ON91761151e-08
KLTH0C11484g6.12ON89781132e-08
TBLA0G009906.12ON78771096e-08
Suva_5.96.12ON73771071e-07
KAFR0L003506.12ON7171948e-06
KNAG0E009306.12ON10959820.001
Suva_10.3127.311ON14952611.4
TDEL0E027705.350ON25827612.0
CAGL0J08976g7.311ON8654574.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F00528g
         (77 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to...   161   2e-53
Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)...    72   6e-18
ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON} Syn...    59   1e-12
Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to As...    59   1e-12
TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12 Y...    57   3e-12
KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON} uniprot|P7...    54   8e-11
NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12 YE...    54   1e-10
SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to...    53   2e-10
TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}...    51   1e-09
Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON} YEL...    51   1e-09
YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}  SO...    50   2e-09
Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON} YEL...    50   3e-09
Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A ...    49   1e-08
KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON...    48   2e-08
TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12 ...    47   6e-08
Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON} YEL0...    46   1e-07
KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12 Y...    41   8e-06
KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON...    36   0.001
Suva_10.312 Chr10 complement(545725..546069,546073..546177) [450...    28   1.4  
TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.35...    28   2.0  
CAGL0J08976g Chr10 complement(883894..884154) [261 bp, 86 aa] {O...    27   4.1  

>ZYRO0F00528g Chr6 (51411..51644) [234 bp, 77 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A
          Length = 77

 Score =  161 bits (407), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%)

Query: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60
          MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL
Sbjct: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60

Query: 61 GHALEVTDADTNDIQGS 77
          GHALEVTDADTNDIQGS
Sbjct: 61 GHALEVTDADTNDIQGS 77

>Kpol_1032.3 s1032 (3019..3255) [237 bp, 78 aa] {ON} (3019..3255)
          [237 nt, 79 aa]
          Length = 78

 Score = 72.0 bits (175), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 52/76 (68%), Gaps = 3/76 (3%)

Query: 1  MAPPTPILTSEQVSRERERVQIL-KEKNKCELKSLTQHLCHAEAP--GEYICVPFKRVFE 57
          MAPPTPI + E+V R ++ + ++  +K KC L S+TQ  C  E    GEYIC+PFKR+FE
Sbjct: 1  MAPPTPIQSREEVLRGKKCLTMVDNKKGKCTLTSITQFQCRFENSYEGEYICLPFKRLFE 60

Query: 58 KCLGHALEVTDADTND 73
          +C G  +EVTD  TN+
Sbjct: 61 ECSGIRIEVTDRFTNN 76

>ACR014C Chr3 complement(382776..382988) [213 bp, 70 aa] {ON}
          Syntenic homolog of Saccharomyces cerevisiae YEL059C-A
          (SOM1)
          Length = 70

 Score = 58.5 bits (140), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (60%), Gaps = 11/76 (14%)

Query: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60
          MAPPTP+LT E+V+        L     C L SLTQ+ CH +  G Y+CVPF+R+F +C 
Sbjct: 1  MAPPTPVLTREEVA------PALATSRDCVLASLTQNECHFDGRG-YVCVPFQRLFRECT 53

Query: 61 GHA----LEVTDADTN 72
           +     +E+T+ +TN
Sbjct: 54 LNKRRVRIEITERNTN 69

>Ecym_3015 Chr3 (30115..30327) [213 bp, 70 aa] {ON} similar to
          Ashbya gossypii ACR014C
          Length = 70

 Score = 58.5 bits (140), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 44/76 (57%), Gaps = 11/76 (14%)

Query: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60
          MAPPTPI+T ++V        IL     C L SL Q+ CH +    Y+C+PFKR+FE+C 
Sbjct: 1  MAPPTPIITRDEVE------PILSRTKDCILASLIQNECHFDG-HNYVCIPFKRLFEECT 53

Query: 61 GHA----LEVTDADTN 72
           +     +EVTD  TN
Sbjct: 54 LNKRRVRIEVTDISTN 69

>TPHA0M00220 Chr13 (44225..44461) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 57.4 bits (137), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 45/81 (55%), Gaps = 7/81 (8%)

Query: 1  MAPPTPILTSEQVSRERERVQILKEKNK--CELKSLTQHLCHAE--APGEYICVPFKRVF 56
          MAP TP++  E V+     +Q  K++N+  CELK+LTQ+ C         YIC PFKR+F
Sbjct: 1  MAPATPVVDREAVA---ATLQASKQRNRQECELKALTQYECQFVDLESNRYICRPFKRLF 57

Query: 57 EKCLGHALEVTDADTNDIQGS 77
          E C G + E T   TN    S
Sbjct: 58 EVCAGTSYETTAQPTNSADRS 78

>KLLA0D00880g Chr4 (82211..82426) [216 bp, 71 aa] {ON}
          uniprot|P78699 Kluyveromyces lactis KLLA0D00880g SOM1
          Protein SOM1 mitochondrial precursor
          Length = 71

 Score = 53.9 bits (128), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 33/77 (42%), Positives = 44/77 (57%), Gaps = 12/77 (15%)

Query: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60
          MAPPT IL  +   R      +L+    C LKSL Q+ C A    +Y+C PFKR+FE+C+
Sbjct: 1  MAPPTKILGLDTQQR------MLQRGENCSLKSLVQNEC-AFNGNDYVCTPFKRLFEQCM 53

Query: 61 ---GHAL--EVTDADTN 72
             G  L  EVT+ +TN
Sbjct: 54 VKDGRVLNIEVTNLNTN 70

>NCAS0F00210 Chr6 (32317..32556) [240 bp, 79 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 79

 Score = 53.5 bits (127), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 28/78 (35%), Positives = 38/78 (48%), Gaps = 6/78 (7%)

Query: 1  MAPPTPILTSEQV------SRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKR 54
          MAPP  +   + +      S  R      +  + C    LTQ  C     G+YIC PFKR
Sbjct: 1  MAPPVVVFGKDDIRVKTALSNNRTGETDAETGDGCRQFQLTQFQCQLLEDGQYICFPFKR 60

Query: 55 VFEKCLGHALEVTDADTN 72
          VF++C G   EVT+ D+N
Sbjct: 61 VFQECQGVRTEVTNVDSN 78

>SAKL0E00924g Chr5 (70494..70787) [294 bp, 97 aa] {ON} similar to
          uniprot|Q05676 Saccharomyces cerevisiae YEL059C-A SOM1
          Protein whose overexpression suppresses the imp1
          mutation may be required for the function of the Imp1p
          mitochondrial inner membrane peptidase and/or the
          protein sorting machinery
          Length = 97

 Score = 53.1 bits (126), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 33/85 (38%), Positives = 46/85 (54%), Gaps = 18/85 (21%)

Query: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60
          MAPPTP+   +++    ++V     K  C LKSL Q+ C      EYICVPFKR+F++CL
Sbjct: 1  MAPPTPVFGKDELESLLKKV-----KPPCTLKSLIQNECTFNGE-EYICVPFKRLFKECL 54

Query: 61 GHA------------LEVTDADTND 73
            +            +E+TD  TND
Sbjct: 55 LDSKTKDGRTSRTVRIEITDRHTND 79

>TDEL0G04590 Chr7 complement(838052..838276) [225 bp, 74 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 74

 Score = 51.2 bits (121), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 43/80 (53%), Gaps = 15/80 (18%)

Query: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGE--YICVPFKRVFEK 58
          MAPPTP+L  E++       +I + KN C LKSLTQ  C     G   Y CVPFKR+F++
Sbjct: 1  MAPPTPVLAREELP------EIPQSKN-CVLKSLTQFQCQLRPAGSGLYECVPFKRLFQE 53

Query: 59 C------LGHALEVTDADTN 72
          C          +EVT   TN
Sbjct: 54 CRDPSGRFKSRIEVTSPLTN 73

>Smik_5.28 Chr5 complement(44691..44912) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 50.8 bits (120), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 40/77 (51%), Gaps = 9/77 (11%)

Query: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60
          MAPPT I + +Q       +  L  +  C+LK L Q  C  +   +Y+C PFKR+FE C+
Sbjct: 1  MAPPTTIRSRDQA---LAPLMALDSQASCQLKELVQWECQFKG-ADYVCSPFKRLFEHCV 56

Query: 61 GHA-----LEVTDADTN 72
           H       EVTD  TN
Sbjct: 57 EHGKPATNYEVTDTYTN 73

>YEL059C-A Chr5 complement(42400..42624) [225 bp, 74 aa] {ON}
          SOM1Subunit of the mitochondrial inner membrane
          peptidase, which is required for maturation of
          mitochondrial proteins of the intermembrane space;
          Som1p facilitates cleavage of a subset of substrates;
          contains twin cysteine-x9-cysteine motifs
          Length = 74

 Score = 50.4 bits (119), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 38/77 (49%), Gaps = 9/77 (11%)

Query: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60
          MAPPT I T +Q       +  L  +  C LK L Q  C  +   EY+C PFKR+FE C+
Sbjct: 1  MAPPTTIRTRDQA---LAPLATLDSQTNCRLKELVQWECQFKG-AEYVCSPFKRLFEHCI 56

Query: 61 -----GHALEVTDADTN 72
                   EVTD  TN
Sbjct: 57 APDKSATNYEVTDTYTN 73

>Skud_5.30 Chr5 complement(41436..41657) [222 bp, 74 aa] {ON}
          YEL059C-A (REAL)
          Length = 74

 Score = 50.1 bits (118), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 4/73 (5%)

Query: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60
          MAPPT I + +Q       +  L    +C+LK L Q  C      +Y+C PFKR+FE+C+
Sbjct: 1  MAPPTTIRSRDQALAP---LAALDSHTRCQLKELVQWECQFRE-ADYVCFPFKRLFERCI 56

Query: 61 GHALEVTDADTND 73
                TD +  D
Sbjct: 57 APDKSATDYEVTD 69

>Kwal_56.22359 s56 (64674..64949) [276 bp, 91 aa] {ON} YEL059C-A
          (SOM1) - involved in mitochondrial inner peptidase
          function [contig 186] FULL
          Length = 91

 Score = 48.9 bits (115), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 41/76 (53%), Gaps = 10/76 (13%)

Query: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60
          MAPPT +   E++      V        C  KSLTQ  C+ +   +Y+CVPFKRVF++C 
Sbjct: 1  MAPPTVVFGKEELEPLLRNVMAT-----CIFKSLTQSECNFDG-HQYVCVPFKRVFKECK 54

Query: 61 GHA----LEVTDADTN 72
                 +EVTD +TN
Sbjct: 55 VDGKSIRIEVTDRNTN 70

>KLTH0C11484g Chr3 complement(944502..944771) [270 bp, 89 aa] {ON}
          similar to uniprot|Q05676 Saccharomyces cerevisiae
          YEL059C-A SOM1 Protein whose overexpression suppresses
          the imp1 mutation may be required for the function of
          the Imp1p mitochondrial inner membrane peptidase and/or
          the protein sorting machinery
          Length = 89

 Score = 48.1 bits (113), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 41/78 (52%), Gaps = 10/78 (12%)

Query: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60
          MAPPT +   E++    E     K    C LK+L Q+ C      EY+C PFKR+F++C 
Sbjct: 1  MAPPTLVFGKEELKGIWE-----KAAEPCFLKALVQNECEFNGH-EYVCTPFKRLFKECG 54

Query: 61 GHA----LEVTDADTNDI 74
                 +EVTD DTN +
Sbjct: 55 AGKRIVRIEVTDQDTNHL 72

>TBLA0G00990 Chr7 (251428..251664) [237 bp, 78 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 78

 Score = 46.6 bits (109), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 39/77 (50%), Gaps = 5/77 (6%)

Query: 1  MAPPTPILTSEQVS-----RERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRV 55
          MAPP  I T E++        + R    K+  K +  S+TQ+ C     G+  C PFKR+
Sbjct: 1  MAPPVTIQTKEELDILEKVNRKNRKDDTKKSAKPKKYSITQYECFDNDKGQIECFPFKRI 60

Query: 56 FEKCLGHALEVTDADTN 72
          F++   +  E+TD  TN
Sbjct: 61 FQQVGEYRREITDETTN 77

>Suva_5.9 Chr5 complement(18353..18571) [219 bp, 73 aa] {ON}
          YEL059C-A (REAL)
          Length = 73

 Score = 45.8 bits (107), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 30/77 (38%), Positives = 38/77 (49%), Gaps = 9/77 (11%)

Query: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60
          MAPPT I   +Q       +  L  +  C LK L Q  C  +   +Y+C PF+R+FE C 
Sbjct: 1  MAPPTTIRARDQALAP---LATLDSRTHCHLKELVQWECQFKG-ADYVCSPFRRLFEHCT 56

Query: 61 --GHA---LEVTDADTN 72
            G A    EVTD  TN
Sbjct: 57 APGEAATNYEVTDTYTN 73

>KAFR0L00350 Chr12 (63897..64112) [216 bp, 71 aa] {ON} Anc_6.12
          YEL059C-A
          Length = 71

 Score = 40.8 bits (94), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 34/71 (47%), Gaps = 6/71 (8%)

Query: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60
          MAP   ++  +   RE      +K    C+L SL Q+ C     G   C PFKR+F +CL
Sbjct: 1  MAPMIRVMDGDAAERE------VKGAEGCQLYSLVQYNCEYRVGGTLECFPFKRMFLECL 54

Query: 61 GHALEVTDADT 71
            + ++   +T
Sbjct: 55 DKSGKLKRVET 65

>KNAG0E00930 Chr5 complement(176364..176693) [330 bp, 109 aa] {ON}
          Anc_6.12 YEL059C-A
          Length = 109

 Score = 36.2 bits (82), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 8/59 (13%)

Query: 1  MAPPTPILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKC 59
          MAP   +LT       R  V + + ++ C LK L Q  C  +   ++ C PF+R+FE+C
Sbjct: 1  MAPNVRVLT-------RNDVPLPQPQDGCVLKELVQFRCENDG-TQWQCAPFRRLFEQC 51

>Suva_10.312 Chr10 complement(545725..546069,546073..546177) [450
           bp, 149 aa] {ON} YLR218C (REAL)
          Length = 149

 Score = 28.1 bits (61), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 16/52 (30%), Positives = 21/52 (40%)

Query: 26  KNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCLGHALEVTDADTNDIQGS 77
           K  C +++L   LCHAE      C     +F KC           T D+ GS
Sbjct: 89  KTGCYVENLALQLCHAETGDWRQCFNEMELFRKCWEQNGNRERVSTVDMDGS 140

>TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.350
          YDR319C
          Length = 258

 Score = 28.1 bits (61), Expect = 2.0,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 17/27 (62%)

Query: 46 EYICVPFKRVFEKCLGHALEVTDADTN 72
          +++C+   +++ KC  HAL   DA TN
Sbjct: 67 DFVCLALVQIYVKCRNHALLPRDARTN 93

>CAGL0J08976g Chr10 complement(883894..884154) [261 bp, 86 aa]
          {ON} similar to uniprot|Q05809 Saccharomyces cerevisiae
          YLR218c
          Length = 86

 Score = 26.6 bits (57), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 15/54 (27%), Positives = 23/54 (42%)

Query: 7  ILTSEQVSRERERVQILKEKNKCELKSLTQHLCHAEAPGEYICVPFKRVFEKCL 60
          ++  EQ   ER+          C +++L   LCHAE      C P    F++C 
Sbjct: 17 MVEEEQDGSERDSWDKRITDTGCYVENLALQLCHAETNDWRQCFPEMAKFKECW 70

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 8,131,607
Number of extensions: 260865
Number of successful extensions: 735
Number of sequences better than 10.0: 22
Number of HSP's gapped: 724
Number of HSP's successfully gapped: 22
Length of query: 77
Length of database: 53,481,399
Length adjustment: 49
Effective length of query: 28
Effective length of database: 47,862,765
Effective search space: 1340157420
Effective search space used: 1340157420
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (27.3 bits)