Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F00506g6.11ON55055029580.0
Kpol_1032.26.11ON53954816720.0
TDEL0G046006.11ON52853916530.0
TPHA0M002106.11ON54555516150.0
NCAS0F002006.11ON54955415600.0
TBLA0G009806.11ON55856915600.0
SAKL0E00902g6.11ON54455915040.0
Smik_5.296.11ON55555814980.0
Kwal_56.223556.11ON54155814760.0
CAGL0B03597g6.11ON54055514680.0
YEL058W (PCM1)6.11ON55755514620.0
Skud_5.316.11ON55756014590.0
KLTH0C11506g6.11ON54455714570.0
Suva_5.106.11ON55355914480.0
NDAI0K028906.11ON56156314420.0
Ecym_30146.11ON55156513900.0
ACR015W6.11ON55256313660.0
KLLA0D00858g6.11ON54154813420.0
KNAG0E009406.11ON53855713271e-178
KAFR0L003406.11ON54055913251e-178
NCAS0C004108.840ON62555900.022
TDEL0B005708.840ON63046890.035
ZYRO0G14190g8.840ON610108870.056
CAGL0M02981g8.840ON61743870.056
NDAI0K004108.840ON62624870.061
TBLA0B032508.840ON64324870.063
Kpol_1068.88.840ON63227860.069
KLLA0D01573g8.840ON60727860.076
TPHA0I002508.840ON62924860.079
Smik_13.4918.840ON62224860.080
Ecym_46118.840ON63046850.094
KNAG0J002708.840ON62548850.10
YMR278W (PGM3)8.840ON62224840.12
Skud_13.4508.840ON62224840.13
Suva_13.4668.840ON62224840.14
Kwal_27.102588.840ON62027830.17
ABL126W8.840ON62423820.21
KLTH0C03872g8.840ON62123820.23
SAKL0H06732g8.669ON495117820.24
SAKL0D01474g8.840ON62423820.25
NCAS0B015908.669ON491122790.54
KAFR0B039208.840ON62423790.57
NDAI0E012008.669ON490134741.9
ZYRO0F07216g8.669ON488117742.2
Kpol_1073.311.467ON1024131742.4
Kwal_26.87598.669ON492117732.5
CAGL0J03762g8.669ON49454723.3
NCAS0H029701.101ON41146705.9
KLTH0D11066g8.669ON493117698.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F00506g
         (550 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...  1144   0.0  
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...   648   0.0  
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...   641   0.0  
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...   626   0.0  
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...   605   0.0  
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...   605   0.0  
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...   583   0.0  
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)   581   0.0  
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...   573   0.0  
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...   570   0.0  
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...   567   0.0  
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)   566   0.0  
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...   565   0.0  
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)   562   0.0  
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....   560   0.0  
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...   540   0.0  
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...   530   0.0  
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...   521   0.0  
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...   515   e-178
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...   514   e-178
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...    39   0.022
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...    39   0.035
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...    38   0.056
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...    38   0.056
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...    38   0.061
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...    38   0.063
Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...    38   0.069
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...    38   0.076
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...    38   0.079
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...    38   0.080
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...    37   0.094
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...    37   0.10 
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...    37   0.12 
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...    37   0.13 
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...    37   0.14 
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...    37   0.17 
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...    36   0.21 
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...    36   0.23 
SAKL0H06732g Chr8 complement(592276..593763) [1488 bp, 495 aa] {...    36   0.24 
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...    36   0.25 
NCAS0B01590 Chr2 (259518..260993) [1476 bp, 491 aa] {ON} Anc_8.669     35   0.54 
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...    35   0.57 
NDAI0E01200 Chr5 complement(238271..239743) [1473 bp, 490 aa] {O...    33   1.9  
ZYRO0F07216g Chr6 (584726..586192) [1467 bp, 488 aa] {ON} simila...    33   2.2  
Kpol_1073.31 s1073 complement(63965..67039) [3075 bp, 1024 aa] {...    33   2.4  
Kwal_26.8759 s26 (932797..934275) [1479 bp, 492 aa] {ON} YOR241W...    33   2.5  
CAGL0J03762g Chr10 complement(359858..361342) [1485 bp, 494 aa] ...    32   3.3  
NCAS0H02970 Chr8 (577211..578446) [1236 bp, 411 aa] {ON} Anc_1.1...    32   5.9  
KLTH0D11066g Chr4 (904878..906359) [1482 bp, 493 aa] {ON} simila...    31   8.0  

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 1144 bits (2958), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/550 (100%), Positives = 550/550 (100%)

Query: 1   MLAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIG 60
           MLAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIG
Sbjct: 1   MLAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIG 60

Query: 61  VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRE 120
           VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRE
Sbjct: 61  VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRE 120

Query: 121 LKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQL 180
           LKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQL
Sbjct: 121 LKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQL 180

Query: 181 HFLTSETAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQ 240
           HFLTSETAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQ
Sbjct: 181 HFLTSETAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQ 240

Query: 241 ELLSQWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDSTGLGCSYDGDADR 300
           ELLSQWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDSTGLGCSYDGDADR
Sbjct: 241 ELLSQWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDSTGLGCSYDGDADR 300

Query: 301 VVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNSTEYLQ 360
           VVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNSTEYLQ
Sbjct: 301 VVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNSTEYLQ 360

Query: 361 KTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKERSVAVE 420
           KTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKERSVAVE
Sbjct: 361 KTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKERSVAVE 420

Query: 421 TLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKVVVPDRSVFI 480
           TLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKVVVPDRSVFI
Sbjct: 421 TLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKVVVPDRSVFI 480

Query: 481 TTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLEDVEKLSNTV 540
           TTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLEDVEKLSNTV
Sbjct: 481 TTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLEDVEKLSNTV 540

Query: 541 KELVVKSVQN 550
           KELVVKSVQN
Sbjct: 541 KELVVKSVQN 550

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score =  648 bits (1672), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/548 (58%), Positives = 403/548 (73%), Gaps = 18/548 (3%)

Query: 8   TKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVTASH 67
           +KL ++YC+  D  YVYGTAGFR  A+ L+TV+F TGI+ACLRS++L G  +GVM+TASH
Sbjct: 3   SKLFEKYCTTKDHKYVYGTAGFRDNASILNTVMFTTGIVACLRSISLGGKAVGVMITASH 62

Query: 68  NPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQLQS 127
           NPP DNGVK+VEP+G+M+ +SWEP+ATELAN           A +T   L+  ++ +++ 
Sbjct: 63  NPPEDNGVKIVEPNGAMLDQSWEPMATELANI---------AANSTFDDLKAYVEEKVKK 113

Query: 128 ANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLTSE- 186
            +      + P +VVGRDSRESG  LL CL+ASA+   +AKI + GLLTTPQLHFLT+E 
Sbjct: 114 FSPESGSKVQPVVVVGRDSRESGSYLLECLLASAENYMNAKIINYGLLTTPQLHFLTNEI 173

Query: 187 TAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQELLSQW 246
             K    V ES YY +F+++W+ +  LH I +     SSLTID ANGIG PK+QELL  W
Sbjct: 174 NVKKSYAVQESSYYNYFIESWNKITALHNITDLY--CSSLTIDTANGIGGPKIQELLKSW 231

Query: 247 ACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDST---GLGCSYDGDADRVVF 303
               +V  +N++W  P+LLN  CGADFVK+NQ+ P G + ++    L CSYDGDADR+VF
Sbjct: 232 PFASKVTLVNNEWEKPDLLNKNCGADFVKTNQKLPNGVSGNSTENDLYCSYDGDADRIVF 291

Query: 304 YYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNSTEYLQKTL 363
           Y+ ++  +F LLDGD+IS LFA   A +L  A L S++SLGVVQTAYANG+ST YLQ TL
Sbjct: 292 YFQDQDKQFHLLDGDKISTLFAKLIAKLLNDANLNSKISLGVVQTAYANGSSTNYLQGTL 351

Query: 364 QVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQ---KERSVAVE 420
            VPVSCAKTGVKHLHHEAVT YDIG+YFEANGHGTIIFS  FY+V +++      S+AV 
Sbjct: 352 NVPVSCAKTGVKHLHHEAVTNYDIGVYFEANGHGTIIFSDHFYQVCEKELKANSESIAVN 411

Query: 421 TLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKVVVPDRSVFI 480
           TL A S LINQTVGDAISDMLGVL+ LSI K + + W  E+TDLPN L KV+VPDRSVFI
Sbjct: 412 TLVALSHLINQTVGDAISDMLGVLSVLSIMKLSSQQWDNEYTDLPNLLTKVIVPDRSVFI 471

Query: 481 TTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLEDVEKLSNTV 540
           TTDQER+L  PEGLQ KID+A+  F  GRSFVRASGTEDAVRVYAEA+S E+ ++L+  V
Sbjct: 472 TTDQERKLLSPEGLQSKIDKAISEFSNGRSFVRASGTEDAVRVYAEASSQEEAKELNALV 531

Query: 541 KELVVKSV 548
            +LV +SV
Sbjct: 532 TKLVKESV 539

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score =  641 bits (1653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/539 (60%), Positives = 390/539 (72%), Gaps = 20/539 (3%)

Query: 7   LTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVTAS 66
           L  LI+QYC+     YVYGTAGFR  +  LDTV+FATGI+ACLRS  L G  +GVM+TAS
Sbjct: 5   LESLIEQYCTTRGYRYVYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITAS 64

Query: 67  HNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQLQ 126
           HNP  DNGVKVVEPDGSM+ +SWE  ATELAN LA +     +A+           GQL 
Sbjct: 65  HNPSGDNGVKVVEPDGSMLIQSWESTATELANLLANRPLEDIKAKV----------GQLT 114

Query: 127 SANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLTSE 186
           S  +S    + P L+VGRDSR SGP LLSCLVASA  LF AKI D GLLTTPQLHFLT+E
Sbjct: 115 SGESS----VRPQLIVGRDSRVSGPHLLSCLVASATSLFDAKITDYGLLTTPQLHFLTNE 170

Query: 187 TAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQELLSQW 246
           T    A+V E  Y+ HFL AWD +A L  +   LP +    +D ANGIG PK+  LL+QW
Sbjct: 171 TMITGAHVDEQAYFAHFLGAWDQIAALQPV--KLPNV---VVDCANGIGGPKMSALLTQW 225

Query: 247 ACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFN-DSTGLGCSYDGDADRVVFYY 305
               Q   INDK   PELLNH CGADFVK++QR P G   ++  L CS+DGDADRVVFYY
Sbjct: 226 GFAKQCSVINDKCDEPELLNHGCGADFVKTSQRLPNGVKPNANDLYCSFDGDADRVVFYY 285

Query: 306 INEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNSTEYLQKTLQV 365
           +++   F LLDGD+IS LFA+F A +LKQ  L S LS+GVVQTAYANG+ST+YLQ  LQV
Sbjct: 286 LDQNLGFHLLDGDKISTLFAYFVAKLLKQCKLDSILSMGVVQTAYANGSSTKYLQDNLQV 345

Query: 366 PVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKERSVAVETLEAF 425
           PVSC KTGVKHLHHEAV  YDIGIYFEANGHGT++FS KF++ +    +++  ++ L+  
Sbjct: 346 PVSCTKTGVKHLHHEAVNNYDIGIYFEANGHGTVMFSNKFHETVTNHADQTPELKILKYL 405

Query: 426 SRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKVVVPDRSVFITTDQE 485
           ++LINQTVGDAISDM+ VLA LSI +W+P  W +EFTDLPN+L KVVV DRS F TTDQE
Sbjct: 406 AKLINQTVGDAISDMMAVLAVLSILQWSPSRWDREFTDLPNKLTKVVVSDRSAFTTTDQE 465

Query: 486 RRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLEDVEKLSNTVKELV 544
           RRL  P GLQ KIDEAV   + GRSFVRASGTEDAVRVYAEAA+  + ++LS+ V +LV
Sbjct: 466 RRLVSPAGLQDKIDEAVARIKSGRSFVRASGTEDAVRVYAEAATQSEKDQLSSIVGDLV 524

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score =  626 bits (1615), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/555 (57%), Positives = 387/555 (69%), Gaps = 24/555 (4%)

Query: 5   DTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVT 64
           + L  + +  C+  +  YVYGTAGFR  A  LDTV+  TG+LACLRS+AL G  +GVM+T
Sbjct: 4   NVLESVFESCCTTRNHRYVYGTAGFRDDATVLDTVMVTTGLLACLRSIALDGKAVGVMIT 63

Query: 65  ASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQ 124
           ASHN P DNGVK+VEPDGSM+ +SWEP ATELAN          +A   HS  + +L  Q
Sbjct: 64  ASHNQPCDNGVKIVEPDGSMLDQSWEPFATELAN----------KASFCHSTQEFKLYLQ 113

Query: 125 LQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLT 184
            + A    + GI P LVVGRDSR+SGP+LL CL + A  L   KI D GLLTTPQLHFLT
Sbjct: 114 EKFAQYKVDSGITPVLVVGRDSRDSGPRLLQCLNSLAVPLMKPKIIDYGLLTTPQLHFLT 173

Query: 185 S--ETAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQEL 242
           +   T K  A VTE  YY  F+ AW  +  LHGI   +     L IDAANGIG PKV +L
Sbjct: 174 NAINTTKSRAPVTEDDYYSFFMDAWVSITALHGI--KVLQSPRLYIDAANGIGGPKVSKL 231

Query: 243 LSQWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFN-----DSTGLGCSYDGD 297
              W   GQ   +N+ W  P LLN++CGAD+VK+NQR P   +     D   L CS+DGD
Sbjct: 232 FEVWPQAGQFTLVNNHWQTPTLLNNDCGADYVKTNQRLPKNIDPAADSDPATLYCSFDGD 291

Query: 298 ADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNSTE 357
           ADR+VFYY +  N F LLDGD+IS LFA F +  LK+AGL  ++S+GVVQTAYANGNST 
Sbjct: 292 ADRIVFYYQDAQNSFHLLDGDKISTLFALFISKQLKKAGLTEKISMGVVQTAYANGNSTN 351

Query: 358 YLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYK----VIKEQK 413
           YL+  L +PVSCAKTGVKHLHHEA+T YD+GIYFEANGHGTI+FS KF++    ++KE  
Sbjct: 352 YLENVLNIPVSCAKTGVKHLHHEAITNYDVGIYFEANGHGTIMFSNKFFETCESLLKENN 411

Query: 414 ERSVAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKVVV 473
           E S+ V+TL +F+ LINQTVGDAISDMLGVLA LSI K TP  W +E+TDLPN L KVVV
Sbjct: 412 E-SLEVKTLLSFAHLINQTVGDAISDMLGVLAVLSIMKLTPSAWDKEYTDLPNLLTKVVV 470

Query: 474 PDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLEDV 533
           PDRS+F TTDQER+L  PEG Q KID  V  ++ GRSFVRASGTEDAVRVYAEA++ +D 
Sbjct: 471 PDRSLFTTTDQERKLLTPEGAQTKIDAIVAKYKNGRSFVRASGTEDAVRVYAEASTPQDA 530

Query: 534 EKLSNTVKELVVKSV 548
             L+  V + V+ SV
Sbjct: 531 AALNEEVSKAVLASV 545

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/554 (54%), Positives = 391/554 (70%), Gaps = 22/554 (3%)

Query: 7   LTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVTAS 66
           L ++ +  C+  D  Y YGTAGFR  A+ LDTV+FATGI+AC RS+ L G  +GVMVTAS
Sbjct: 8   LQQVYNSTCTTRDYKYTYGTAGFRDKASKLDTVMFATGIIACWRSMVLCGTPVGVMVTAS 67

Query: 67  HNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQLQ 126
           HNPP+DNGVKVVEP G+M+ + WEPL T+LAN  A    S E+       + ++ K   Q
Sbjct: 68  HNPPLDNGVKVVEPTGAMLIQEWEPLTTKLANIAA--NESFEKVYDFILEVSKDPKFPFQ 125

Query: 127 SANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLTS- 185
                      P+L++G DSRES P+L   LV +A E+++A IH+ GL+TTPQLHF+TS 
Sbjct: 126 ENK--------PSLIIGHDSRESSPRLTKLLVNTAVEIYNADIHNYGLVTTPQLHFITSL 177

Query: 186 ETAKGVAN----VTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQE 241
             AK   N    ++   YY +F  +W    +L+    S  +  +L ID+ANGIG PKV +
Sbjct: 178 WNAKYNKNTNDVISVDNYYNYFNASWSKFQELYDFN-SFKSFENLIIDSANGIGGPKVTD 236

Query: 242 LLSQW--ACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDSTGLG--CSYDGD 297
           L+S W    RG V  IN+ W NP LLN++CGAD+VK+NQ+ P G  + + L   CS+DGD
Sbjct: 237 LISTWPSTLRGNVSIINNSWENPNLLNNDCGADYVKTNQKLPKGIQNPSNLNLHCSFDGD 296

Query: 298 ADRVVFYYINEANE-FCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNST 356
           ADR+VFYYI+E ++ F LLDGD+I+ LFA F + +LK+  L  +L LGVVQTAYANG+ST
Sbjct: 297 ADRIVFYYISEVDQKFHLLDGDKIATLFAKFLSNLLKETNLTDKLKLGVVQTAYANGSST 356

Query: 357 EYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKERS 416
            YL   L+VPVSC KTGVKHLHHEA TKYDIGIYFEANGHGT++FS +F +V++ +  ++
Sbjct: 357 NYLTNVLKVPVSCTKTGVKHLHHEASTKYDIGIYFEANGHGTVLFSERFQQVLQNE-PKT 415

Query: 417 VAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKVVVPDR 476
            A +TL  F ++INQTVGDA++DMLGV+  LS+SK TP  W Q + DLPN+LAKV+VPDR
Sbjct: 416 TATQTLLLFQKIINQTVGDAMADMLGVITVLSVSKITPSQWDQGYKDLPNKLAKVIVPDR 475

Query: 477 SVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLEDVEKL 536
           SVFITT+QER+LT P GLQ+KID AV     GRSFVRASGTEDAVRVYAEAA+ E+ EKL
Sbjct: 476 SVFITTNQERQLTSPVGLQEKIDVAVSKVTNGRSFVRASGTEDAVRVYAEAATQEETEKL 535

Query: 537 SNTVKELVVKSVQN 550
           S  V + V+ SV N
Sbjct: 536 SQEVCKFVLSSVSN 549

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score =  605 bits (1560), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/569 (55%), Positives = 391/569 (68%), Gaps = 36/569 (6%)

Query: 2   LAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGV 61
           L +   T L  + C   +  Y YGTAGFR  AA LDTV+F TG +ACLRSL+  G  +GV
Sbjct: 5   LDLSKTTDLFHKICKTKNHVYTYGTAGFRDKAAILDTVMFTTGFVACLRSLSHDGKAVGV 64

Query: 62  MVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQREL 121
           MVTASHNPPVDNGVK+VEP+GSM+ + WEP+AT+LAN LA +G   E  Q  ++ L    
Sbjct: 65  MVTASHNPPVDNGVKIVEPNGSMLSQDWEPIATDLAN-LASQGKIDELVQFVNAKLIE-- 121

Query: 122 KGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLH 181
                      N   VPTL+VGRDSRES   LL CL   + +LF AKI D  LLTTPQLH
Sbjct: 122 ----------LNSNKVPTLIVGRDSRESSTSLLECLKEGSLKLFDAKIVDYELLTTPQLH 171

Query: 182 FLTSETAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPT--ISSLTIDAANGIGAPKV 239
           FLT+          E+ YY HF  AWD +  ++    S  +  I SL ID+ANGIG PK+
Sbjct: 172 FLTNAYNLEKDLPKETDYYHHFNNAWDQLISINNDASSSTSNKIESLIIDSANGIGGPKM 231

Query: 240 QELLSQWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGF-----NDSTG--LGC 292
           + LL  W    +V  IN+ W  PE LN+ CGAD+VK+NQ+ P G      N+S+   + C
Sbjct: 232 ENLLKYWKTNYKVRLINNNWKRPESLNNNCGADYVKTNQKLPNGITTDIINESSKNVIHC 291

Query: 293 SYDGDADRVVFYYIN-EANEFCLLDGDRISGLFAHFFAGILKQAGL--QSELSLGVVQTA 349
           S+DGDADRVVFYY + ++N F LLDGD+IS LFA+F +  LK AG+  ++E+ LGVVQTA
Sbjct: 292 SFDGDADRVVFYYQDPQSNTFNLLDGDKISTLFANFISMQLKLAGIDYENEIKLGVVQTA 351

Query: 350 YANGNSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVI 409
           YANG+ST YLQ+ L++PV+CAKTGVKHLHHEA T+YDIG+YFEANGHGTIIFS  FYK+I
Sbjct: 352 YANGSSTNYLQQNLKIPVACAKTGVKHLHHEACTRYDIGVYFEANGHGTIIFSENFYKII 411

Query: 410 K---------EQKERSVAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQE 460
                     E   +  A++TL+  S LINQTVGDAISDM+GV+A L+I  WTP+ W +E
Sbjct: 412 NQKINAESQIENTPKLRALKTLKVLSALINQTVGDAISDMMGVMAVLAILNWTPQIWNKE 471

Query: 461 FTDLPNRLAKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDA 520
           +TDLPN+LAK+VVPDRSVF TTDQER+LT P GLQ KI++ V  ++ GRSFVRASGTEDA
Sbjct: 472 YTDLPNKLAKLVVPDRSVFETTDQERKLTSPAGLQSKINKIVAKYENGRSFVRASGTEDA 531

Query: 521 VRVYAEAASLEDVEKLSNTVKELVVKSVQ 549
           VRVYAEA+  +DV KL   V +   +SV 
Sbjct: 532 VRVYAEAS--DDVNKLCQEVLDATAESVN 558

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score =  583 bits (1504), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/559 (54%), Positives = 390/559 (69%), Gaps = 27/559 (4%)

Query: 1   MLAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIG 60
           M+ +  L +L D++C  +   Y YGTAGFR  A  LDTV+F TGILA +RS+ LKG  +G
Sbjct: 1   MVNIQLLEELYDKHC-KTGFTYTYGTAGFRYKADVLDTVMFTTGILAAIRSIYLKGQYVG 59

Query: 61  VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRE 120
           VM+TASHNPP DNGVK+V+P G M+ ++WEP ATELAN+ A KG   E  +A    + + 
Sbjct: 60  VMITASHNPPQDNGVKIVDPKGEMLDQAWEPFATELANS-ASKGK-QELIKALDKLITKL 117

Query: 121 LKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQL 180
                +SA           + + RDSRESGP+LL  ++   K L + ++ D  LLTTPQL
Sbjct: 118 GIDDTESAK----------ITISRDSRESGPRLLQAVIDGTKVLKNVQVVDFNLLTTPQL 167

Query: 181 HFLTSETAKGVAN-VTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKV 239
           HFLT +  +G ++ V ES YY  F  AW  +  LH I  SLP    + IDAANGIG PKV
Sbjct: 168 HFLTYQYNQGSSSKVEESTYYSAFSSAWTKICGLHDIN-SLPY--RVIIDAANGIGGPKV 224

Query: 240 QE-LLSQWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFN---DSTGLGCSYD 295
            E LL        V  IN++W +PELLN  CGAD+VK+NQ  P G +   ++  + CS+D
Sbjct: 225 SEMLLKNKFFSSTVSVINNQWQSPELLNESCGADYVKTNQHFPKGVSGNSENECIYCSFD 284

Query: 296 GDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNS 355
           GDADR+VFYY +E ++F LLDGD+IS LFA FF  +L  AG ++EL LGVVQTAYANG+S
Sbjct: 285 GDADRIVFYYHDEKSKFNLLDGDKISTLFAKFFKELLVAAGAENELKLGVVQTAYANGSS 344

Query: 356 TEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKE---- 411
           TEYL   L+VPVSC  TGVKHLHHEA+  YDIGIYFEANGHGT+IFS +F+K I +    
Sbjct: 345 TEYLSSILEVPVSCTATGVKHLHHEAIHNYDIGIYFEANGHGTVIFSDEFHKTIDKKLKE 404

Query: 412 -QKERSV-AVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLA 469
            Q E++  A++TL  F+ LINQTVGDAISDML VLA L I KW+P+ W QE+TDLPN+L 
Sbjct: 405 PQDEKTAKALKTLYLFTNLINQTVGDAISDMLAVLAVLCILKWSPQKWDQEYTDLPNKLV 464

Query: 470 KVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAAS 529
           KV+VPDRSVF T++ ER+L  P+GLQ+KID  V+ F+ GRSFVRASGTEDAVRVYAEAA+
Sbjct: 465 KVIVPDRSVFKTSNAERQLVSPKGLQEKIDSTVQEFEHGRSFVRASGTEDAVRVYAEAAT 524

Query: 530 LEDVEKLSNTVKELVVKSV 548
            E  ++L+ +V +LV +SV
Sbjct: 525 KEKADRLAASVSDLVSRSV 543

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score =  581 bits (1498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/558 (53%), Positives = 386/558 (69%), Gaps = 24/558 (4%)

Query: 5   DTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVT 64
           + L++L D+ C   +  Y YGTAGFR  A  LDTV+F TGILA LRSL L+G  +GVM+T
Sbjct: 6   EQLSELYDKTCRTKNVQYSYGTAGFRTLAKNLDTVMFTTGILAILRSLKLQGQYVGVMIT 65

Query: 65  ASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQ 124
           ASHNP  DNGVK+VEPDGSM+  +WEP A +LANT +   +  E         + EL   
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLATWEPYAMQLANTASFASNFEE--------FRAELTRL 117

Query: 125 LQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLT 184
           ++      +  IVP +VVGRDSRES P LL CL ++   +FHA++ D G +TTPQLH++T
Sbjct: 118 IEHEKIGLDTSIVPHIVVGRDSRESSPYLLRCLTSTMVSVFHAQVLDLGCVTTPQLHYIT 177

Query: 185 SETAK-----GVANV-TESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPK 238
             + K     G A V TE  YY  F+ A++ +   + I + L ++  L IDAANGIG P+
Sbjct: 178 DLSNKREREGGSAEVATEQDYYSFFIGAFNELFSTYEIEKRL-SVPRLFIDAANGIGGPQ 236

Query: 239 VQELLS--QWACR-GQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDST--GLGCS 293
           +++LL+   W     Q+  INDK   PELLN ECGAD+VK+NQR P G + S+   L CS
Sbjct: 237 LKKLLTSKDWVVPPDQIEVINDKSDVPELLNFECGADYVKTNQRLPKGLSPSSHDSLYCS 296

Query: 294 YDGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANG 353
           +DGDADRVVFYY++  ++F LLDGD+IS LFA F +  L+ A L++ L +GVVQTAYANG
Sbjct: 297 FDGDADRVVFYYVDSESQFHLLDGDKISTLFAKFLSKQLELAHLENSLRIGVVQTAYANG 356

Query: 354 NSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQK 413
           +ST Y++ TL+ PVSC KTGVKHLHHEA T+YDIGIYFEANGHGTIIFS KF++VIK + 
Sbjct: 357 SSTNYIENTLRCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQVIKSEL 416

Query: 414 ERS----VAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLA 469
            R+    +A++TL+ FS+LINQTVGDA+SDML VLA L+I K  P  W +E+TDLPN+L 
Sbjct: 417 SRARGDMLALKTLDCFSKLINQTVGDALSDMLAVLATLAIMKMAPMDWDKEYTDLPNKLV 476

Query: 470 KVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAAS 529
           K +VPDRS+F T DQER+L  P GLQ KID  +  +  GRSFVRASGTEDAVR+YAE   
Sbjct: 477 KCIVPDRSIFQTIDQERKLQNPVGLQAKIDLVIAKYPMGRSFVRASGTEDAVRIYAECQD 536

Query: 530 LEDVEKLSNTVKELVVKS 547
              +++  N + ELV  S
Sbjct: 537 SSQLDQFCNEIVELVKAS 554

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/558 (54%), Positives = 389/558 (69%), Gaps = 32/558 (5%)

Query: 1   MLAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIG 60
           ML    L  L + +CS +  HY YGTAGFR  A  LDTV+F TG++A LRS+ L+G  +G
Sbjct: 1   MLDTKALKSLYEAHCS-TGFHYAYGTAGFRYKADVLDTVMFTTGVVAGLRSIFLEGKTVG 59

Query: 61  VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRE 120
           VM+TASHNPP DNGVK+V+P G M+ +SWE  AT+LAN+ A +G S   A          
Sbjct: 60  VMITASHNPPEDNGVKIVDPKGEMLEQSWEVYATDLANS-ASQGFSEFVASV------ER 112

Query: 121 LKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQL 180
           L  +L+  +N +      ++VV RDSRESGP+LL   ++  K L + K+ D GLLTTPQL
Sbjct: 113 LMTKLEVGSNDHG-----SIVVARDSRESGPRLLGAFLSGVKVLANVKVTDHGLLTTPQL 167

Query: 181 HFLTS---ETAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAP 237
           HFLTS   E  KG   + +S YY++FL AW  +A+L  I +SLP    L IDAANGIGAP
Sbjct: 168 HFLTSKSNELPKGT-EIGKSLYYDNFLSAWVEIAELCKI-DSLPY--KLEIDAANGIGAP 223

Query: 238 KVQELLSQWAC-RGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGF---NDSTGLGCS 293
            V E+LSQ    +G    +ND+W  P+ LNH CGADFVK+NQ+ P G     +   + CS
Sbjct: 224 VVTEMLSQHKFFKGAFAVVNDEWETPDSLNHLCGADFVKTNQKLPHGIAPGGERNRICCS 283

Query: 294 YDGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANG 353
           +DGDADR+VFYY  +  +F LLDGD+++ LFA FF  +L+ AGLQ EL LGVVQTAYANG
Sbjct: 284 FDGDADRIVFYYCGKNGDFHLLDGDKMATLFAKFFQELLRDAGLQDELELGVVQTAYANG 343

Query: 354 NSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVI---- 409
           +ST Y+++ L + V+C  TGVKHLHHEAV KYDIG+YFEANGHGT++FS KF  VI    
Sbjct: 344 SSTAYIEQVLGISVTCTPTGVKHLHHEAV-KYDIGVYFEANGHGTVVFSSKFLDVIDRKL 402

Query: 410 KEQKERSVAVETLEA---FSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPN 466
            E+ E   A ++L+    F++LINQTVGDAISDML VLA LSI KW+PE W +E+TDLPN
Sbjct: 403 SEKLESDAAQKSLKVLHLFAKLINQTVGDAISDMLAVLAVLSILKWSPEKWDEEYTDLPN 462

Query: 467 RLAKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAE 526
           +L KV+VPDR+VF T + ER+L  P G+Q+KID  V  F +GRSFVRASGTEDAVRVYAE
Sbjct: 463 KLIKVLVPDRTVFKTKNAERQLVSPAGVQEKIDALVATFSKGRSFVRASGTEDAVRVYAE 522

Query: 527 AASLEDVEKLSNTVKELV 544
           AA+ ++ E LS  V++L+
Sbjct: 523 AATPQETEALSQQVEKLL 540

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/555 (54%), Positives = 378/555 (68%), Gaps = 33/555 (5%)

Query: 9   KLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVTASHN 68
           +L ++ C   D+HY YGTAGFR  A  LD+V+F TG++A LRS++ +   +GVM+TASHN
Sbjct: 4   QLYNKNCITRDQHYTYGTAGFRADARILDSVMFTTGVIAALRSISCQCAPVGVMITASHN 63

Query: 69  PPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQLQSA 128
           PP DNGVK+VE DGSM+ + WEPLAT LAN++A            +   +  L   +Q  
Sbjct: 64  PPRDNGVKIVESDGSMLLQDWEPLATRLANSVA-----------DYHTFESTLNAIMQEL 112

Query: 129 NNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELF-HAKIHDQGLLTTPQLHFLTSET 187
           N S   G  P +VVG DSRES P+LL+ L+   K +   A+I + GLLTTPQLHFLT+  
Sbjct: 113 NIS--PGHAPQIVVGHDSRESSPRLLANLLDGIKAVSPDARITNHGLLTTPQLHFLTANP 170

Query: 188 AKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQELLS--- 244
           A       E  YY +FL AW+ + +L+GI E   +   L ID ANGIG P+  ++LS   
Sbjct: 171 AH-----FEDYYYRYFLDAWNQLFELYGI-EGFKSFDKLVIDTANGIGGPQFLKMLSYSQ 224

Query: 245 ------QWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFN-DSTGLGCSYDGD 297
                 Q     Q+   N+ W NP +LN  CGADFVK+NQR P G N D   L CS+DGD
Sbjct: 225 TDLPHLQKIRLHQIDITNNSWLNPSMLNSGCGADFVKTNQRLPEGINADPRNLYCSFDGD 284

Query: 298 ADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNSTE 357
           ADRVVFYY++++  F LLDGD+IS L A+F   +LK+AGL  EL LGVVQTAYANG+ST 
Sbjct: 285 ADRVVFYYVDDSLTFHLLDGDKISTLLAYFINALLKEAGLAEELKLGVVQTAYANGSSTT 344

Query: 358 YLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKERSV 417
           Y+ K LQVPVS AKTGVKHLHHEAVT YDIG+YFEANGHGT+IFS  FY+VI+++  ++ 
Sbjct: 345 YVTKKLQVPVSIAKTGVKHLHHEAVTNYDIGVYFEANGHGTVIFSQHFYEVIEDRLAKNA 404

Query: 418 ---AVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKVVVP 474
              +  TL   SRLINQT+GDAISDML ++  L I  W+P  W  E+TDLPN+L KVVVP
Sbjct: 405 HDKSTLTLRLLSRLINQTIGDAISDMLAIITVLGILGWSPATWDHEYTDLPNKLTKVVVP 464

Query: 475 DRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLEDVE 534
           DRS+FITTDQERRL  P GLQ KID  V     GRSF+RASGTEDAVRVYAEA ++E  E
Sbjct: 465 DRSIFITTDQERRLVSPAGLQDKIDMLVADAPCGRSFIRASGTEDAVRVYAEAQTVEATE 524

Query: 535 KLSNTVKELVVKSVQ 549
           KLS  V + ++++V+
Sbjct: 525 KLSTEVTDALIETVK 539

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score =  567 bits (1462), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/555 (53%), Positives = 376/555 (67%), Gaps = 29/555 (5%)

Query: 7   LTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVTAS 66
           L KL D  C   +  + YGTAGFR  A  LDTV+F+TGILA LRSL L+G  +GVM+TAS
Sbjct: 8   LCKLYDDTCRTKNVQFSYGTAGFRTLAKNLDTVMFSTGILAVLRSLKLQGQYVGVMITAS 67

Query: 67  HNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQLQ 126
           HNP  DNGVK+VEPDGSM+  +WEP A +LAN  +   +  E         + EL   ++
Sbjct: 68  HNPYQDNGVKIVEPDGSMLLATWEPYAMQLANAASFATNFEE--------FRVELAKLIE 119

Query: 127 SANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLTSE 186
                 N  +VP +VVGRDSRES P LL CL +S   +FHA++ D G +TTPQLH++T  
Sbjct: 120 HEKIDLNTTVVPHIVVGRDSRESSPYLLRCLTSSMASVFHAQVLDLGCVTTPQLHYITDL 179

Query: 187 TAK-----GVANV-TESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQ 240
           + +       A V TE  YY  F+ A++ +   + + + L ++  L ID ANGIG P+++
Sbjct: 180 SNRRKLEGDTAPVATEQDYYSFFIGAFNELFATYQLEKRL-SVPKLFIDTANGIGGPQLK 238

Query: 241 ELLS--QWACRG-QVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDST--GLGCSYD 295
           +LL+   W     QV  IND+   PELLN ECGAD+VK+NQR P G + S+   L CS+D
Sbjct: 239 KLLASEDWDVPAEQVEVINDRSDVPELLNFECGADYVKTNQRLPKGLSPSSFDSLYCSFD 298

Query: 296 GDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNS 355
           GDADRVVFYY++  ++F LLDGD+IS LFA F +  L+ A L+  L +GVVQTAYANG+S
Sbjct: 299 GDADRVVFYYVDSGSKFHLLDGDKISTLFAKFLSKQLELAHLEHSLKIGVVQTAYANGSS 358

Query: 356 TEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKER 415
           T Y++ TL  PVSC KTGVKHLHHEA T+YDIGIYFEANGHGTIIFS KF++ IK +  +
Sbjct: 359 TAYIKNTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHRTIKSELSK 418

Query: 416 S------VAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLA 469
           S      +A+ TL+ FS LINQTVGDAISDML VLA L+I K +P  W +E+TDLPN+L 
Sbjct: 419 SKLNGDTLALRTLKCFSELINQTVGDAISDMLAVLATLAILKMSPMDWDEEYTDLPNKLV 478

Query: 470 KVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAAS 529
           K +VPDRS+F TTDQER+L  P GLQ KID  V  +  GRSFVRASGTEDAVRVYAE   
Sbjct: 479 KCIVPDRSIFQTTDQERKLLNPVGLQDKIDLVVAKYPMGRSFVRASGTEDAVRVYAEC-- 536

Query: 530 LEDVEKLSNTVKELV 544
            +D  KL     E+V
Sbjct: 537 -KDSSKLGQFCDEVV 550

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score =  566 bits (1459), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/560 (51%), Positives = 377/560 (67%), Gaps = 24/560 (4%)

Query: 5   DTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVT 64
           + L KL D+ C   +  Y YGTAGFR  A  LDTV+F TGILA LRSL L+G  +GVM+T
Sbjct: 6   EQLRKLYDETCRTKNVQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMIT 65

Query: 65  ASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQ 124
           ASHNP  DNGVK+VEPDGSM+  SWEP A +LAN  +      E        ++ E K  
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLASWEPYAMQLANAASFATHFEEFYAELVKLIELE-KID 124

Query: 125 LQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLT 184
           L ++N      + P +VVGRDSRES P LL CL ++   +FHA++ D G +TTPQLH++T
Sbjct: 125 LGASN------VAPHIVVGRDSRESSPYLLRCLTSTMASVFHARVLDLGCVTTPQLHYIT 178

Query: 185 S-------ETAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAP 237
                   E    +A  TE  YY  F+ A++ +   + + + L ++  L ID ANGIG P
Sbjct: 179 DLSNRREREGDSALAAATEQDYYSFFIGAFNELFTTYDMEKRL-SVPKLFIDTANGIGGP 237

Query: 238 KVQELLS--QWAC-RGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDST--GLGC 292
           ++++LL+   W     Q+  INDK   P+LLN ECGAD+VK+NQR P G + S+   L C
Sbjct: 238 QLKKLLASKDWVVPSDQIEIINDKSDVPKLLNSECGADYVKTNQRLPKGLSPSSFESLYC 297

Query: 293 SYDGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYAN 352
           S+DGDADRVVFYY++   +F LLDGD+IS LFA F +  L+ A L+  L +GVVQTAYAN
Sbjct: 298 SFDGDADRVVFYYVDSELKFHLLDGDKISTLFAKFLSKQLEMANLERSLKIGVVQTAYAN 357

Query: 353 GNSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQ 412
           G+ST Y++ TL  PVSC KTGVKHLHHEA T+YDIGIYFEANGHGTIIFS KF++ I+ +
Sbjct: 358 GSSTAYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSEKFHQTIESE 417

Query: 413 KER----SVAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRL 468
             +    ++A++TL  F++LINQTVGDA+SDML VLA L+I K  P +W +E+ DLPN+L
Sbjct: 418 LSKPNGHTLALKTLSCFAKLINQTVGDAMSDMLAVLATLAILKMAPMNWDEEYKDLPNKL 477

Query: 469 AKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAA 528
            K +VPDRS+F TTDQER+L  P GLQ KID  +  +  GRSFVRASGTEDAVRVYAE  
Sbjct: 478 VKCIVPDRSIFQTTDQERKLQNPVGLQSKIDSVIAKYPMGRSFVRASGTEDAVRVYAECQ 537

Query: 529 SLEDVEKLSNTVKELVVKSV 548
            +  +++  N +   V  SV
Sbjct: 538 DMSKLDQFCNEIVGYVKASV 557

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score =  565 bits (1457), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/557 (53%), Positives = 383/557 (68%), Gaps = 30/557 (5%)

Query: 1   MLAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIG 60
           ML   TL  L + +C  S   Y YGTAGFR  A  LDTV+F TG+LA LRS+ L+G  +G
Sbjct: 1   MLDTKTLETLYETHC-KSGFTYAYGTAGFRYKADVLDTVMFTTGVLAGLRSIYLEGRTVG 59

Query: 61  VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRE 120
           VM+TASHNPP DNGVK+V+P G M+ +SWE  AT+LAN      S+ +   A  ++LQ  
Sbjct: 60  VMITASHNPPEDNGVKIVDPKGEMLEQSWESYATDLAN------SATQSFTAFLAYLQ-N 112

Query: 121 LKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQL 180
           L  +L       +   + +L V RDSRESGP+LL  L+  ++ L + +I D GLLTTPQL
Sbjct: 113 LVSEL-----GLDTDALGSLAVARDSRESGPRLLHALLNGSRVLPNIRITDYGLLTTPQL 167

Query: 181 HFLTSETAKGVANVTESR--YYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPK 238
           HFLTS+  +   +    R  YY+ FL AWD +  L GI +SLP    L IDAANGIGAP+
Sbjct: 168 HFLTSKRNELPNDTAIDRFFYYKEFLSAWDDITALCGI-QSLPY--KLEIDAANGIGAPR 224

Query: 239 VQELLSQWAC-RGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGF---NDSTGLGCSY 294
           V+E+LS      G    +ND W  P  LNH CGAD+VK+NQR P G    ND   + CS+
Sbjct: 225 VKEMLSTHKFFDGVFRVVNDDWETPASLNHLCGADYVKTNQRLPYGIQANNDCQRICCSF 284

Query: 295 DGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGN 354
           DGDADR+VFY+ +   +F LLDGD+++ LFA FF  IL  A LQ  LSLGVVQTAYANG+
Sbjct: 285 DGDADRIVFYFCDSEGQFRLLDGDKMATLFAKFFQDILSSANLQERLSLGVVQTAYANGS 344

Query: 355 STEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVI----- 409
           ST Y+++ L +PV+C  TGVKHLHHEA+  YDIG+YFEANGHGT++FS KF +V+     
Sbjct: 345 STHYIERVLGIPVTCTPTGVKHLHHEAI-NYDIGVYFEANGHGTVVFSKKFDEVVNSGLS 403

Query: 410 -KEQKERSV-AVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNR 467
            K Q + S+ ++E L  F+ LINQTVGDAISDM+GVLA LSI KWTP+ W QE+TDLPN+
Sbjct: 404 NKHQSDSSLQSLEVLSKFANLINQTVGDAISDMMGVLAVLSILKWTPQKWNQEYTDLPNK 463

Query: 468 LAKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEA 527
           L KV+VPDR+VF TT+ ER+L  P GLQ KI+  V  + Q RSFVRASGTEDAVRVYAEA
Sbjct: 464 LVKVLVPDRTVFKTTNAERQLLSPLGLQPKINALVAEYHQARSFVRASGTEDAVRVYAEA 523

Query: 528 ASLEDVEKLSNTVKELV 544
           ++ E+ + L++ V ++V
Sbjct: 524 STREEADSLASRVSQVV 540

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/559 (52%), Positives = 375/559 (67%), Gaps = 26/559 (4%)

Query: 5   DTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVT 64
           D L KL ++ C   +  Y YGTAGFR  A  LDTV+F TGILA LRSL L+G  +GVM+T
Sbjct: 6   DQLRKLYEETCCTKNLQYSYGTAGFRTLAKDLDTVMFTTGILAVLRSLKLQGQYVGVMIT 65

Query: 65  ASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQ 124
           ASHNP  DNGVK+VEPDGSM+  +WEP A +LAN  +   +  E        ++ E K  
Sbjct: 66  ASHNPYQDNGVKIVEPDGSMLLAAWEPYAMQLANAASFAATFDEFYAELVKLIEHE-KID 124

Query: 125 LQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLT 184
           L +A         P +VVGRDSRES P LL CL ++   +FHA + D G +TTPQLH++T
Sbjct: 125 LDAA---------PHVVVGRDSRESSPFLLRCLTSTMASVFHAHVVDLGCVTTPQLHYVT 175

Query: 185 SETAK-----GVANV-TESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPK 238
           + + K     G A V TE  YY  F+ A++ +     I + L ++  L +D ANGIG P+
Sbjct: 176 NLSNKRQREGGSAQVATEQDYYSFFINAFNELFTTCQIEKRL-SVPKLFVDTANGIGGPQ 234

Query: 239 VQELLS--QWAC-RGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDST--GLGCS 293
           +++LL+   WA    ++  +NDK   P+LLN ECGAD+VK+NQR P G + S+   L CS
Sbjct: 235 LKKLLASKDWAVPSDEIEIVNDKSDVPKLLNFECGADYVKTNQRLPKGLSPSSPDSLYCS 294

Query: 294 YDGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANG 353
           +DGDADRVVFYY++  ++F LLDGD+IS LFA F +  L+ A L   L +GVVQTAYANG
Sbjct: 295 FDGDADRVVFYYVDPESKFHLLDGDKISTLFAKFLSKQLELANLTDSLKIGVVQTAYANG 354

Query: 354 NSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQK 413
           +ST Y++ TL  PVSC KTGVKHLHHEA T+YDIGIYFEANGHGTIIFS KF++ I+ + 
Sbjct: 355 SSTSYIKDTLHCPVSCTKTGVKHLHHEAATQYDIGIYFEANGHGTIIFSKKFHQTIESEL 414

Query: 414 ERS----VAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLA 469
            R+    +A+ TL  F+ LINQTVGDAISDML VLA LSI    P  W +E+TDLPN+L 
Sbjct: 415 SRAQGSLLALNTLRCFANLINQTVGDAISDMLAVLATLSILHMAPTDWDKEYTDLPNKLV 474

Query: 470 KVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAAS 529
           K +VPDRS+F TTDQER+L  P GLQ KID  +  +  GRSFVRASGTEDAVRVYAE   
Sbjct: 475 KCIVPDRSIFQTTDQERKLQNPAGLQTKIDSVIGKYAMGRSFVRASGTEDAVRVYAECQD 534

Query: 530 LEDVEKLSNTVKELVVKSV 548
              +++  N V E V  SV
Sbjct: 535 PTKLDQFCNEVVEYVKSSV 553

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score =  560 bits (1442), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/563 (53%), Positives = 381/563 (67%), Gaps = 33/563 (5%)

Query: 5   DTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLAL----KGDVIG 60
           D L    ++ C   + HY YGTAGFR  A  LDTV+F TGI+ACLRSL L    K   IG
Sbjct: 10  DQLKSCFNEICQTKNYHYTYGTAGFRDNAKRLDTVMFTTGIVACLRSLTLQTSNKHSAIG 69

Query: 61  VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRE 120
           VMVTASHNPP DNGVK++EP+GSM+ + WEP AT+ AN +A   S  E  Q         
Sbjct: 70  VMVTASHNPPEDNGVKIIEPNGSMLLQEWEPKATQFAN-IAANESFDEFYQL-------- 120

Query: 121 LKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQL 180
           L   + +  N  N    PTL++G DSR+S P L++ ++ SA  +F+AKI +   +TTPQL
Sbjct: 121 LIDSIVTLENDLNIKQPPTLILGHDSRDSSPTLMNHIIKSATLIFNAKIINYNYVTTPQL 180

Query: 181 HFLTSETAKGVANVTESRYYEHFLQAWDYVAQLHGIGE--SLPTISSLTIDAANGIGAPK 238
           HFLT+ T        E  YY+HF +   Y++QL  +    +LP   +L IDAANGIGAP+
Sbjct: 181 HFLTNLTNTTGT-AEEINYYDHFNK---YLSQLQSLYPPFNLP-FDNLIIDAANGIGAPQ 235

Query: 239 VQELL------SQWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGF----NDST 288
           V++LL           +  +  IN+   NP LLN  CGAD+VK+NQ+ P G     + ++
Sbjct: 236 VEKLLFTKNKFPPLNIKNPIKIINNDSKNPNLLNMNCGADYVKTNQKLPQGIPKDIDANS 295

Query: 289 GLGCSYDGDADRVVFYYINE-ANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQ 347
            L CSYDGDADR+VFYYI+   N F LLDGD+I+ LFA FF+ +L  A L   L LGVVQ
Sbjct: 296 TLFCSYDGDADRIVFYYIDPMTNNFNLLDGDKIATLFAKFFSNLLTIAKLNHILKLGVVQ 355

Query: 348 TAYANGNSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYK 407
           TAYANG+ST Y+   L+VPVSC KTGVKHLHHEA+TKYDIGIYFEANGHGT+IFS KF+ 
Sbjct: 356 TAYANGSSTNYISSKLKVPVSCTKTGVKHLHHEAITKYDIGIYFEANGHGTVIFSDKFHS 415

Query: 408 VIKEQKER--SVAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLP 465
            + + KE   S  ++TL  FS LINQTVGDA+SDML V+A LSI + +P  W +E+ DLP
Sbjct: 416 ELTKLKESGSSREIKTLLLFSELINQTVGDAMSDMLAVIAVLSILQLSPNSWDKEYKDLP 475

Query: 466 NRLAKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYA 525
           N+LAKV+VPDRS FITTDQER+L +P+GLQ  ++EAV     GRSFVRASGTEDAVRVYA
Sbjct: 476 NKLAKVIVPDRSKFITTDQERKLVEPKGLQPLLEEAVASVSLGRSFVRASGTEDAVRVYA 535

Query: 526 EAASLEDVEKLSNTVKELVVKSV 548
           EA + E+ E LS  V +LV++SV
Sbjct: 536 EAKTQEETEWLSKKVCQLVIESV 558

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score =  540 bits (1390), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/565 (50%), Positives = 364/565 (64%), Gaps = 36/565 (6%)

Query: 1   MLAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIG 60
           M  V+ ++KL D++C  S   Y+YGTAGFR  A  LDTVLF TG+LACLRS+ LKG  +G
Sbjct: 1   MSVVEEVSKLYDKHCC-SRFKYIYGTAGFRYKAEILDTVLFTTGVLACLRSMHLKGQYVG 59

Query: 61  VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQR- 119
            M+TASHNPP DNGVK+V+P G M+ + WE  ATELAN           +   H +L R 
Sbjct: 60  AMITASHNPPQDNGVKLVDPKGEMLKQEWEVYATELANC---------ASDGKHQFLHRL 110

Query: 120 -ELKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTP 178
            EL  Q     +S        +VV RDSRESG +LL  LV       +  I D  +LTTP
Sbjct: 111 QELMNQFGIKADSE-----ARIVVARDSRESGSRLLKALVDGTSVFTNVDIVDYDMLTTP 165

Query: 179 QLHFLTSET-----AKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANG 233
           QLHFLT        ++ V  V E+ YY HFL A   + +L  I   LP    L IDAANG
Sbjct: 166 QLHFLTYHLNRQMESERVIEVNEAFYYSHFLSALKELTELFNI-PGLPY--PLVIDAANG 222

Query: 234 IGAPKVQEL-LSQWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFN---DSTG 289
           +G  K +EL +     +     IN  W+  +LLN  CGAD+VK+NQ  P G +   D   
Sbjct: 223 VGGAKAEELFMKNTFFKDSTTIINGNWSQHDLLNSFCGADYVKTNQCLPQGISAATDINS 282

Query: 290 LGCSYDGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTA 349
           L CS+DGDADRV+FYY +    F LLDGD+IS LFA FF  +L  AG+Q  + LGVVQTA
Sbjct: 283 LHCSFDGDADRVIFYYRDVDGMFHLLDGDKISTLFAKFFQSMLPVAGIQDNVKLGVVQTA 342

Query: 350 YANGNSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVI 409
           YANG+ST YL + L VPVSC  TGVK+LH +AV  YD+GIYFEANGHGT+IFS  F   +
Sbjct: 343 YANGSSTRYLSEVLIVPVSCTPTGVKYLHRKAVENYDVGIYFEANGHGTVIFSENFNNTV 402

Query: 410 KEQ-------KERSVAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFT 462
            ++        E  +A++TL++FS+LINQTVGDA+SDM+ VLA L I KWTP+ W  E+T
Sbjct: 403 SKRLKEGSLSAESKMALKTLQSFSKLINQTVGDAMSDMMAVLAVLCILKWTPQQWDGEYT 462

Query: 463 DLPNRLAKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVR 522
           DLPN L KVVVPDRS+F TT+ ER+L  P+GLQ +ID+ +K +   RSFVRASGTEDAVR
Sbjct: 463 DLPNTLMKVVVPDRSLFKTTNAERQLVSPKGLQAQIDKVIKSYDNARSFVRASGTEDAVR 522

Query: 523 VYAEAASLEDVEKLSNTVKELVVKS 547
           +YAEAA+ E  + LS  + +LV+ +
Sbjct: 523 IYAEAATKEQADDLSIKISQLVISA 547

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score =  530 bits (1366), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/563 (50%), Positives = 364/563 (64%), Gaps = 29/563 (5%)

Query: 1   MLAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIG 60
           M  V  + KL D++     R Y YGTAGFR  A  L  V+FATG+LACLRSL L G  +G
Sbjct: 1   MRTVQEMVKLYDRH-RGCGRVYAYGTAGFRSRAEVLAPVVFATGLLACLRSLYLGGAYVG 59

Query: 61  VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRE 120
           VM+TASHNPP DNGVK+V+P G M+   WE  AT LAN  A +G   E   A H  + R 
Sbjct: 60  VMLTASHNPPEDNGVKLVDPHGEMLAAEWEKHATALANC-ASQGQ-QELLDALHMLVDRL 117

Query: 121 LKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQL 180
                       +  +   +VV RDSR SGP+LL  L+   + L   ++ D G+LTTPQL
Sbjct: 118 ----------GLDLALRARVVVARDSRASGPQLLDALLDGTRMLEDVEVVDCGMLTTPQL 167

Query: 181 HFLTSETAK--GVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPK 238
           HFLT    +    A V E  YY HF+ A + +A LHG+ E+LP    L +D ANG+GA K
Sbjct: 168 HFLTCACNERGSAAGVREDLYYAHFVAALEELAALHGL-ETLPF--PLVVDTANGVGALK 224

Query: 239 VQELLSQWAC-RGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDST---GLGCSY 294
            +EL  +    + +V  IND W+  ELLN  CGAD+VK+ Q  P G +       L CSY
Sbjct: 225 ARELFRRSPLFKNRVSIINDNWSQHELLNSGCGADYVKTKQCLPQGISADLLRESLFCSY 284

Query: 295 DGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGN 354
           DGDADRV+FYYI+    F LLDGD+IS L A F    L  AG+  ++ LGVVQTAYANG+
Sbjct: 285 DGDADRVIFYYIDGQERFHLLDGDKISTLIAKFLQSALLTAGINDDVCLGVVQTAYANGS 344

Query: 355 STEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKE 414
           ST YL + L+VPVSC  TGVKHLH EAV KYD+GIYFEANGHGT+IFS  F   ++   E
Sbjct: 345 STRYLSEVLEVPVSCTPTGVKHLHREAVQKYDVGIYFEANGHGTVIFSEHFTLTVERALE 404

Query: 415 R-------SVAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNR 467
                    ++++TL+ F+ LINQT+GDAI+DML V+A LSI  W+PE W +++TDLPN 
Sbjct: 405 NPALSAKARLSLQTLKTFANLINQTIGDAIADMLAVIAILSILHWSPEDWDKQYTDLPNN 464

Query: 468 LAKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEA 527
           L KVVVPDRS+F TT+ E++LT P GLQ+ ID+ V  +  GRSFVRASGTEDAVR+YAEA
Sbjct: 465 LVKVVVPDRSMFKTTNAEQQLTSPAGLQELIDDIVMVYDSGRSFVRASGTEDAVRIYAEA 524

Query: 528 ASLEDVEKLSNTVKELVVKSVQN 550
           AS +  ++L+  V  LVV+S  +
Sbjct: 525 ASQQQADELATKVSTLVVESTND 547

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score =  521 bits (1342), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/548 (52%), Positives = 362/548 (66%), Gaps = 29/548 (5%)

Query: 10  LIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVTASHNP 69
           L +QYC      Y YGTAGFR   + LDTV+F TGI+A LRS+ LK   +GVM+TASHNP
Sbjct: 6   LYEQYCKQG-HAYTYGTAGFRAHNSVLDTVMFTTGIVAVLRSIYLKSKFVGVMITASHNP 64

Query: 70  PVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQLQSAN 129
           P DNGVKVVEP G M+ ++WEP+AT+LAN             A+ S+ Q E   Q   A 
Sbjct: 65  PEDNGVKVVEPYGEMLVQNWEPIATKLANA------------ASSSFTQLESTLQSIIAE 112

Query: 130 NSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFL--TSET 187
            + +   +  + V RDSRESGP+LL+ L A        KI D  LLTTPQLHFL  +  T
Sbjct: 113 LNIDTTQLANITVARDSRESGPRLLAALKAGISVFPAVKIIDFELLTTPQLHFLVYSLNT 172

Query: 188 AKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQELLSQWA 247
           +   + V +S YY+HF+  W+ + QL+ + E LP    LTID ANGIGA KV++L+SQ  
Sbjct: 173 SSQPSQVRDSTYYDHFVSIWNQLTQLYEVTE-LPF--HLTIDCANGIGADKVKQLISQAG 229

Query: 248 --CRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFN-DSTGLGCSYDGDADRVVFY 304
                 +  +N +    +LLN  CGADFVK+NQ  P   N   + L CS+DGDADRVVFY
Sbjct: 230 HMLENSLTAVNGETKTFQLLNESCGADFVKTNQTFPANCNPKPSQLYCSFDGDADRVVFY 289

Query: 305 YIN-EANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNSTEYLQKTL 363
           Y++ + N+F LLDGD+I+ L A   A +L+  GL   L LGVVQTAYANG+ST+Y+   L
Sbjct: 290 YVDGKENKFHLLDGDKIATLLAKLIADLLRDCGLSDTLKLGVVQTAYANGSSTKYITDKL 349

Query: 364 QVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKERSVAVE--- 420
           ++PVSC KTGVKHLHHEAV++YDIGIYFEANGHGT+IFS +F + +  + + +   E   
Sbjct: 350 KIPVSCTKTGVKHLHHEAVSRYDIGIYFEANGHGTVIFSREFLETVDSRLQETSGNEQQY 409

Query: 421 ----TLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKVVVPDR 476
               +L+  S+LINQTVGDAISDML V+A LSI    PE W   + DLPNRL KV+VPDR
Sbjct: 410 KSLLSLKLLSQLINQTVGDAISDMLAVIATLSIFNLKPEDWDGCYQDLPNRLTKVIVPDR 469

Query: 477 SVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLEDVEKL 536
           SVF++T+ ER+L  PEGLQ KID  V  F   RSFVRASGTEDAVRVYAEA + E   +L
Sbjct: 470 SVFVSTNAERQLLSPEGLQAKIDLLVTQFPNSRSFVRASGTEDAVRVYAEAETTESAIEL 529

Query: 537 SNTVKELV 544
           +  V ELV
Sbjct: 530 ATKVGELV 537

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score =  515 bits (1327), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 281/557 (50%), Positives = 355/557 (63%), Gaps = 29/557 (5%)

Query: 2   LAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGV 61
           ++ + +  + D  C+     Y YGTAGFR  AA LDTV+FATG +A LRS  L G  +GV
Sbjct: 1   MSREAVRAVFDAVCTTKGYTYTYGTAGFRDKAAVLDTVMFATGCVAVLRSWRLNGAQVGV 60

Query: 62  MVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQREL 121
           MVTASHNPP DNGVKVV+P+G M+PE WEPLAT LAN LA  G+  +  +   S ++   
Sbjct: 61  MVTASHNPPEDNGVKVVDPEGGMLPEQWEPLATRLAN-LAANGTFDQWWEYWTSLVEE-- 117

Query: 122 KGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKI--HDQGLLTTPQ 179
                    +Y  G    L VG D+RES P+LL  L+ +A  +    I      +   PQ
Sbjct: 118 --------GNYTGG--ARLCVGHDTRESSPRLLKNLMDAALAVSGGSITISKPWITNHPQ 167

Query: 180 LHFLTSETAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKV 239
           LH+LTS    GV +   + Y +HF   W    +L   G        L ID ANG+GA ++
Sbjct: 168 LHYLTSLQRDGVTDA--AAYNDHFQGCWQ---KLFPDGVVAWPFDRLFIDTANGVGAVQL 222

Query: 240 QELLSQWAC-RGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGFNDSTG-------LG 291
           Q+    WA  + +   +N  +  PE LN +CGADFVK+N R P    D  G       L 
Sbjct: 223 QQFFKGWAVDQNKFRLLNTDYGTPENLNVKCGADFVKTNHRLPSEVPDQRGTSGALPDLY 282

Query: 292 CSYDGDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYA 351
           CS+DGDADR+VFY++    +F LLDGD+IS LFA F   +  +AG   +L++GVVQTAYA
Sbjct: 283 CSFDGDADRIVFYFVKN-KQFHLLDGDKISTLFAKFIGQLTARAGADDKLTVGVVQTAYA 341

Query: 352 NGNSTEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKE 411
           NGNST Y+   L +P +C KTGVKHLHH A T+YDIGIYFEANGHGT++FS KF +V+  
Sbjct: 342 NGNSTRYIASELGIPSACTKTGVKHLHHVAKTQYDIGIYFEANGHGTVVFSDKFNEVVAG 401

Query: 412 QKERSVAVETLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRLAKV 471
               + A  TL  FS+LINQTVGDAI+DMLGVLA L   +WTPE WG E+TDLPN L KV
Sbjct: 402 VASTNDAASTLYHFSKLINQTVGDAIADMLGVLAVLIKLQWTPEVWGAEYTDLPNLLTKV 461

Query: 472 VVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAASLE 531
           VVPDRS+F TTDQERRL  PEGLQ+KID  V  F++ RSFVRASGTE+AVR+Y EA   +
Sbjct: 462 VVPDRSIFETTDQERRLVSPEGLQEKIDACVGRFKRARSFVRASGTENAVRIYCEAEDPQ 521

Query: 532 DVEKLSNTVKELVVKSV 548
           +V++LS  V E V+ SV
Sbjct: 522 EVQELSKQVTEAVLNSV 538

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score =  514 bits (1325), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 273/559 (48%), Positives = 369/559 (66%), Gaps = 31/559 (5%)

Query: 1   MLAVDTLTKLIDQYCSNSDRHYVYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIG 60
           M  +  L     +YC+  +  Y YGTAGFR  A+TLDTV+F TGI+A LRSL L+G  IG
Sbjct: 1   MFDITQLEPAFIKYCTTRNHSYTYGTAGFRANASTLDTVMFTTGIVAILRSLVLQGKYIG 60

Query: 61  VMVTASHNPPVDNGVKVVEPDGSMMPESWEPLATELANTLAIKGSSHERAQATHSWLQRE 120
           VM+TASHNPP DNGVK+VEP G+M+ ESWE +AT+LAN      +SH    A    L + 
Sbjct: 61  VMITASHNPPQDNGVKIVEPSGAMLIESWEQIATDLANI-----ASHGNFTAFVMHLSQV 115

Query: 121 LKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELFHAKIHDQGLLTTPQL 180
           +      A  + +E   P L+VG DSRES P L+ CL A+A  +F   + +  L+TTPQL
Sbjct: 116 I------AKLNIDETTTPRLIVGHDSRESSPYLMECLQAAAP-VFDTIVINHTLITTPQL 168

Query: 181 HFLTSETAKGVANVTESRYYEHFLQAWDYVAQLHGIGESLPTISSLTIDAANGIGAPKVQ 240
           H+LT      V   TE  YY+ F  +W+ +  L+   +   T ++L +D ANG+G+ +  
Sbjct: 169 HYLTMLQNDVV---TEVDYYKFFSTSWNNLFSLYP--DLNLTFNNLIVDGANGVGSVQFS 223

Query: 241 ELLS---QWACRGQVHFINDKWTNPELLNHECGADFVKSNQRCPLGF--NDSTGLGCSYD 295
           + L    Q A    +  INDK   P++LN +CGADFVK+NQ+ P G    + + L  S+D
Sbjct: 224 KFLPYLPQLATLTTI--INDKHNVPQMLNVDCGADFVKTNQKLPNGIVNPNPSDLYASFD 281

Query: 296 GDADRVVFYYINEANEFCLLDGDRISGLFAHFFAGILKQAGLQSELSLGVVQTAYANGNS 355
           GDADR+VFYY++   +F LLDGD+IS +       +L+++ L ++++LGVVQTAYANG+S
Sbjct: 282 GDADRIVFYYVDNNKKFHLLDGDKISTILTKCLISMLRESELLNDINLGVVQTAYANGSS 341

Query: 356 TEYLQKTLQVPVSCAKTGVKHLHHEAVTKYDIGIYFEANGHGTIIFSPKFYKVIKEQKER 415
           T+Y+ K+L+VPV C KTGVKHLHH A +K+DIGIYFEANGHGT++FS KFY+V+++  + 
Sbjct: 342 TKYITKSLKVPVECTKTGVKHLHHIAESKFDIGIYFEANGHGTVLFSNKFYEVLQKAIDN 401

Query: 416 SVAVE-------TLEAFSRLINQTVGDAISDMLGVLAALSISKWTPEHWGQEFTDLPNRL 468
             + E       +L  FS+LINQTVGD+++D+L V+A LSI + +P  W  E+ DLPN L
Sbjct: 402 GSSSEKIHKARLSLFYFSKLINQTVGDSMADLLAVIATLSILQLSPSDWDTEYQDLPNLL 461

Query: 469 AKVVVPDRSVFITTDQERRLTKPEGLQQKIDEAVKCFQQGRSFVRASGTEDAVRVYAEAA 528
            K  V +R VF TTD ER+LT P GLQ+KID AV  +  GRSFVRASGTEDAVR+YAEA 
Sbjct: 462 TKCTVLNRFVFKTTDMERKLTSPSGLQEKIDAAVSKYDSGRSFVRASGTEDAVRIYAEAK 521

Query: 529 SLEDVEKLSNTVKELVVKS 547
           +  +VE LS  V +LV  S
Sbjct: 522 TKAEVEALSKEVTQLVENS 540

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 39.3 bits (90), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 30/55 (54%), Gaps = 2/55 (3%)

Query: 23  VYGTAGFRGPAATLDTVLFATGILACLRSLALKGDVIGVMVTASHNPPVDNGVKV 77
           ++  AGF+    T D     T  L     L LK  V GVM+TASHNP +DNG KV
Sbjct: 119 IFLRAGFKVFYLTPDDQFVHTP-LVPFSVLNLKASV-GVMITASHNPKMDNGYKV 171

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 30/46 (65%), Gaps = 5/46 (10%)

Query: 56  GDVIGVMVTASHNPPVDNGVKVVEPDG-SMMPESWEPLATELANTL 100
           G  +GVM+TASHNP +DNG KV   +G  ++P    P  +E+A ++
Sbjct: 156 GASVGVMITASHNPKMDNGYKVYYSNGCQIIP----PHDSEIAQSI 197

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 51/108 (47%), Gaps = 25/108 (23%)

Query: 59  IGVMVTASHNPPVDNGVKVVEPDG-SMMPESWEPLATELANTLAIKGSSHERAQATHSWL 117
           +GVM+TASHNP +DNG KV   +G  ++P    P  + +A ++    S+ E       W 
Sbjct: 147 VGVMITASHNPKLDNGYKVYYANGCQIIP----PHDSAIARSIE---SNLEPGNGVWDW- 198

Query: 118 QRELKGQLQSANNSYNEGIVPTLVVGRDSRESGPKLLSCLVASAKELF 165
                   Q+   + +EG    L+ GRD      K+L   ++  K+ F
Sbjct: 199 -------DQTMQQAADEG---KLIYGRD------KMLEQYISCVKDSF 230

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score = 38.1 bits (87), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 1/43 (2%)

Query: 59  IGVMVTASHNPPVDNGVKVVEPDG-SMMPESWEPLATELANTL 100
           +GVM+TASHNP +DNG KV   +G  ++P     +A  + N L
Sbjct: 148 VGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAETINNNL 190

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score = 38.1 bits (87), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 19/24 (79%)

Query: 59  IGVMVTASHNPPVDNGVKVVEPDG 82
           IGVM+TASHNP +DNG KV   +G
Sbjct: 154 IGVMITASHNPKMDNGYKVYYSNG 177

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score = 38.1 bits (87), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 19/24 (79%)

Query: 59  IGVMVTASHNPPVDNGVKVVEPDG 82
           +GVMVTASHNP +DNG KV   +G
Sbjct: 166 VGVMVTASHNPKMDNGYKVYYSNG 189

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 37.7 bits (86), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%)

Query: 56  GDVIGVMVTASHNPPVDNGVKVVEPDG 82
           G  +GVM+TASHNP +DNG KV   +G
Sbjct: 154 GASVGVMITASHNPKMDNGYKVYYSNG 180

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score = 37.7 bits (86), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 20/27 (74%)

Query: 56  GDVIGVMVTASHNPPVDNGVKVVEPDG 82
           G  +G+M+TASHNP +DNG KV   +G
Sbjct: 151 GASVGIMITASHNPKMDNGYKVYYTNG 177

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 19/24 (79%)

Query: 59  IGVMVTASHNPPVDNGVKVVEPDG 82
           IGVM+TASHNP +DNG KV   +G
Sbjct: 157 IGVMITASHNPEMDNGYKVYYNNG 180

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.7 bits (86), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 16/24 (66%), Positives = 19/24 (79%)

Query: 59  IGVMVTASHNPPVDNGVKVVEPDG 82
           +GVMVTASHNP +DNG KV   +G
Sbjct: 151 VGVMVTASHNPKMDNGYKVYYSNG 174

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score = 37.4 bits (85), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 56  GDVIGVMVTASHNPPVDNGVKVVEPDG-SMMPESWEPLATELANTL 100
           G   G+M+TASHNP +DNG KV   +G  + P   + +A+E+   L
Sbjct: 160 GASCGIMITASHNPKMDNGYKVYYSNGCQITPPHDKKIASEIDANL 205

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score = 37.4 bits (85), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 20/48 (41%), Positives = 26/48 (54%), Gaps = 15/48 (31%)

Query: 59  IGVMVTASHNPPVDNGVKVVEPDG-SMMP--------------ESWEP 91
           +GVM+TASHNP +DNG KV   +G  ++P              E WEP
Sbjct: 154 VGVMITASHNPKMDNGYKVYFANGCQIIPPHDLNIARSIDQNLEPWEP 201

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 19/24 (79%)

Query: 59  IGVMVTASHNPPVDNGVKVVEPDG 82
           +GVM+TASHNP +DNG KV   +G
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNG 174

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 19/24 (79%)

Query: 59  IGVMVTASHNPPVDNGVKVVEPDG 82
           +GVM+TASHNP +DNG KV   +G
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNG 174

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score = 37.0 bits (84), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 15/24 (62%), Positives = 19/24 (79%)

Query: 59  IGVMVTASHNPPVDNGVKVVEPDG 82
           +GVM+TASHNP +DNG KV   +G
Sbjct: 151 VGVMITASHNPKMDNGYKVYYSNG 174

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score = 36.6 bits (83), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 19/27 (70%)

Query: 56  GDVIGVMVTASHNPPVDNGVKVVEPDG 82
           G   GVM+TASHNP +DNG KV   +G
Sbjct: 152 GASAGVMITASHNPKMDNGYKVYYSNG 178

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 18/23 (78%)

Query: 60  GVMVTASHNPPVDNGVKVVEPDG 82
           GVM+TASHNP +DNG KV   +G
Sbjct: 160 GVMITASHNPKMDNGYKVYYANG 182

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score = 36.2 bits (82), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 18/23 (78%)

Query: 60  GVMVTASHNPPVDNGVKVVEPDG 82
           G+M+TASHNP +DNG KV   +G
Sbjct: 157 GIMITASHNPKMDNGYKVYYSNG 179

>SAKL0H06732g Chr8 complement(592276..593763) [1488 bp, 495 aa] {ON}
           highly similar to gnl|GLV|KLLA0F11297g Kluyveromyces
           lactis KLLA0F11297g and similar to YOR241W
           uniprot|Q08645 Saccharomyces cerevisiae YOR241W MET7
           Folylpolyglutamate synthetase catalyzes extension of the
           glutamate chains of the folate coenzymes required for
           methionine synthesis and for maintenance of
           mitochondrial DNA present in both the cytoplasm and
           mitochondria
          Length = 495

 Score = 36.2 bits (82), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 50/117 (42%), Gaps = 6/117 (5%)

Query: 92  LATELANTLAIKGSSHERAQATHSWLQRELKGQLQSANNSYNEGIVPTLVVGRDSRESGP 151
           L +  AN +AI+ S  +R    + W  +E   ++  +   YN+     L +   +   G 
Sbjct: 29  LQSNYANIMAIRASG-DRKNMMNIWEMQEWSRRIGYSTKDYNK-----LNIIHITGTKGK 82

Query: 152 KLLSCLVASAKELFHAKIHDQGLLTTPQLHFLTSETAKGVANVTESRYYEHFLQAWD 208
              +    S    ++ ++ + GL T+P L  +          +TE ++ ++F + WD
Sbjct: 83  GSTAAFTQSILSQYNDRLSNIGLYTSPHLKSVRERIRINGNPITEEKFSQYFFEVWD 139

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 18/23 (78%)

Query: 60  GVMVTASHNPPVDNGVKVVEPDG 82
           G+M+TASHNP +DNG KV   +G
Sbjct: 156 GIMITASHNPKMDNGYKVYYSNG 178

>NCAS0B01590 Chr2 (259518..260993) [1476 bp, 491 aa] {ON} Anc_8.669
          Length = 491

 Score = 35.0 bits (79), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 54/122 (44%), Gaps = 8/122 (6%)

Query: 88  SWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQLQSANNSYNE-GIVPTLVVGRDS 146
           S   L +  AN +AI+  S +R    + W  +E   ++    + +N+  I+   + G   
Sbjct: 20  SLNSLQSNYANIMAIR-ESGDRKNMMNIWEMKEWSRRIGYNVSEFNKLNIIH--ITGTKG 76

Query: 147 RESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLTSETAKGVANVTESRYYEHFLQA 206
           + S     S ++   KE    K+   GL T+P L  +        A ++E ++ ++F + 
Sbjct: 77  KGSTAAFTSSILNQYKE----KLPKVGLYTSPHLKSVRERIRINGAPISEDKFTKYFFEV 132

Query: 207 WD 208
           WD
Sbjct: 133 WD 134

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score = 35.0 bits (79), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (73%)

Query: 60  GVMVTASHNPPVDNGVKVVEPDG 82
           GVM+TASHNP  DNG KV   +G
Sbjct: 158 GVMITASHNPKDDNGYKVYYSNG 180

>NDAI0E01200 Chr5 complement(238271..239743) [1473 bp, 490 aa] {ON}
           Anc_8.669 YOR241W
          Length = 490

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/134 (20%), Positives = 52/134 (38%), Gaps = 6/134 (4%)

Query: 88  SWEPLATELANTLAIKGSSHERAQATHSWLQRELKGQLQSANNSYNEGIVPTLVVGRDSR 147
           S   L +  AN +AI+ S   R Q  + W  +E   ++      YN      L V   + 
Sbjct: 20  SLNSLQSNYANIMAIRESGDRRNQM-NIWEMQEWSKRI-----GYNVSDFNKLNVIHITG 73

Query: 148 ESGPKLLSCLVASAKELFHAKIHDQGLLTTPQLHFLTSETAKGVANVTESRYYEHFLQAW 207
             G    +   +S    ++ K+   GL T+P L  +          ++E ++ ++F + W
Sbjct: 74  TKGKGSTAAFTSSILRQYNDKLPKIGLYTSPHLKTVRERIRINGEPISEDKFTKYFFEVW 133

Query: 208 DYVAQLHGIGESLP 221
           + +       E  P
Sbjct: 134 NKLGNTKSNLEKFP 147

>ZYRO0F07216g Chr6 (584726..586192) [1467 bp, 488 aa] {ON} similar
           to uniprot|Q08645 Saccharomyces cerevisiae YOR241W MET7
           Folylpolyglutamate synthetase catalyzes extension of the
           glutamate chains of the folate coenzymes required for
           methionine synthesis and for maintenance of
           mitochondrial DNA present in both the cytoplasm and
           mitochondria
          Length = 488

 Score = 33.1 bits (74), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 49/117 (41%), Gaps = 8/117 (6%)

Query: 92  LATELANTLAIKGSSHERAQATHSWLQRELKGQLQSANNSYNEGIVPTLVVGRDSRESGP 151
           L +  AN +AI+  S +R    + W  +E   ++      YN      L V   +   G 
Sbjct: 24  LQSNYANIMAIR-ESGDRKNQMNIWEMQEWSRRI-----GYNVSEFDKLNVVHITGTKGK 77

Query: 152 KLLSCLVASAKELFHAKIHDQGLLTTPQLHFLTSETAKGVANVTESRYYEHFLQAWD 208
              +  VAS   L   K+   GL T+P L  +T         ++E ++ ++F + WD
Sbjct: 78  GSTAAFVASI--LGKYKVPKVGLYTSPHLKSVTERIRINGNPISEDKFAKYFFEVWD 132

>Kpol_1073.31 s1073 complement(63965..67039) [3075 bp, 1024 aa] {ON}
           complement(63965..67039) [3075 nt, 1025 aa]
          Length = 1024

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 60/131 (45%), Gaps = 20/131 (15%)

Query: 312 FCLLDGDRISGLFAHFFAGILKQAGLQSELSL-GV--VQTAYANGNSTEYLQKTLQVPVS 368
           +C L  D+I  LFAH+   +++  G++S+  L GV  V        + E+      V  S
Sbjct: 703 YCTLYSDKIEWLFAHYL--VMRSYGIESDTILPGVKYVLLKRTKSKNDEFNSCFTNVISS 760

Query: 369 CAKT------GVKHLHHEAVTKYDIGIYFEANGHGTIIFSPK---FYKVIKEQKE-RSVA 418
            A T      GV  L++  +   D+G     N   +I+F+     F+  I+E  + R+V 
Sbjct: 761 LASTKSEYTEGVLELYNTLIAAIDVG-----NSEASILFAKSISVFFTQIEEYLDFRNVI 815

Query: 419 VETLEAFSRLI 429
           ++ L +   L+
Sbjct: 816 LQVLNSIQELL 826

>Kwal_26.8759 s26 (932797..934275) [1479 bp, 492 aa] {ON} YOR241W
           (MET7) - Folylpolyglutamate synthetase [contig 67] FULL
          Length = 492

 Score = 32.7 bits (73), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 24/117 (20%), Positives = 47/117 (40%), Gaps = 6/117 (5%)

Query: 92  LATELANTLAIKGSSHERAQATHSWLQRELKGQLQSANNSYNEGIVPTLVVGRDSRESGP 151
           L +  AN +AI+ S  +R    + W  +E   ++  + + +N+     L +   +   G 
Sbjct: 27  LQSNYANIMAIRASG-DRKNKMNIWEMQEWSRRIGYSTSDFNK-----LNIVHITGTKGK 80

Query: 152 KLLSCLVASAKELFHAKIHDQGLLTTPQLHFLTSETAKGVANVTESRYYEHFLQAWD 208
              +    S  + +  KI   GL T+P L  +          + E ++  +F   WD
Sbjct: 81  GSTAAFTHSILQQYGDKIKKVGLYTSPHLKSVRERIQINGQPICEEKFSRYFFDVWD 137

>CAGL0J03762g Chr10 complement(359858..361342) [1485 bp, 494 aa]
           {ON} highly similar to uniprot|Q08645 Saccharomyces
           cerevisiae YOR241w MET7 tetrahydrofolylpolyglutamate
           synthase
          Length = 494

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 14/54 (25%), Positives = 26/54 (48%)

Query: 155 SCLVASAKELFHAKIHDQGLLTTPQLHFLTSETAKGVANVTESRYYEHFLQAWD 208
           +   +S  + +  K+   GL T+P L  +          ++ES++ E+F Q WD
Sbjct: 82  AAFTSSILQQYQDKLTKIGLYTSPHLRSVRERIRINGEPISESKFTEYFFQVWD 135

>NCAS0H02970 Chr8 (577211..578446) [1236 bp, 411 aa] {ON} Anc_1.101
           YDR058C
          Length = 411

 Score = 31.6 bits (70), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/46 (39%), Positives = 26/46 (56%), Gaps = 2/46 (4%)

Query: 104 GSSHERAQATHSWLQRELK--GQLQSANNSYNEGIVPTLVVGRDSR 147
           GS  ERA+A HS+L++E K  G LQ + N     ++   + G D R
Sbjct: 175 GSIEERAEALHSFLEKETKKLGTLQDSANPVKLNLIAHSMGGLDCR 220

>KLTH0D11066g Chr4 (904878..906359) [1482 bp, 493 aa] {ON} similar
           to uniprot|Q08645 Saccharomyces cerevisiae YOR241W MET7
           Folylpolyglutamate synthetase catalyzes extension of the
           glutamate chains of the folate coenzymes required for
           methionine synthesis and for maintenance of
           mitochondrial DNA present in both the cytoplasm and
           mitochondria
          Length = 493

 Score = 31.2 bits (69), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 23/117 (19%), Positives = 47/117 (40%), Gaps = 6/117 (5%)

Query: 92  LATELANTLAIKGSSHERAQATHSWLQRELKGQLQSANNSYNEGIVPTLVVGRDSRESGP 151
           L +  AN +AI+ S  +R    + W  +E   ++  + + +N+     L +   +   G 
Sbjct: 27  LQSNYANIMAIRASG-DRKNKMNIWEMQEWSRRIGYSTSDFNK-----LNIVHITGTKGK 80

Query: 152 KLLSCLVASAKELFHAKIHDQGLLTTPQLHFLTSETAKGVANVTESRYYEHFLQAWD 208
              +    S  + +  +I   GL T+P L  +          + E ++  +F   WD
Sbjct: 81  GSTAAFTQSVLQQYGDQIRKIGLYTSPHLKSVRERIRINGQPICEEKFSSYFFDVWD 137

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 55,914,645
Number of extensions: 2321485
Number of successful extensions: 5883
Number of sequences better than 10.0: 51
Number of HSP's gapped: 5932
Number of HSP's successfully gapped: 51
Length of query: 550
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 435
Effective length of database: 40,294,809
Effective search space: 17528241915
Effective search space used: 17528241915
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 68 (30.8 bits)