Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F00484g6.10ON64362927220.0
TDEL0G046106.10ON63357120810.0
Kpol_1045.776.10ON65058120580.0
TBLA0G011106.10ON63857320360.0
TPHA0M002006.10ON63457120280.0
SAKL0E00880g6.10ON63657120010.0
Kwal_56.223506.10ON65857219950.0
ACR016W6.10ON64057519320.0
KLTH0C11528g6.10ON64257818910.0
CAGL0A01067g6.10ON64157718840.0
KLLA0D00836g6.10ON64057518780.0
NCAS0D021906.10ON64557518740.0
KAFR0B065006.10ON63657417660.0
NDAI0I027506.10ON66358317280.0
KNAG0E027806.10ON65057915670.0
YPL263C (KEL3)6.10ON65158314100.0
Suva_16.426.10ON65458614070.0
Skud_16.146.10ON65258513850.0
Smik_6.4716.10ON65158313840.0
Kpol_1050.695.88ON10842061493e-09
KAFR0B043205.88ON9862061333e-07
CAGL0F07997g5.88ON9363501271e-06
KLLA0E15511g5.88ON9052021243e-06
CAGL0I02090g5.88ON11362071226e-06
NCAS0F005205.88ON10862071218e-06
TPHA0A051705.88ON10161971218e-06
SAKL0H02618g5.88ON10852041201e-05
Skud_8.2225.88ON11692021201e-05
KNAG0K005605.88ON11042161191e-05
Smik_8.2425.88ON11682021191e-05
TDEL0G011205.88ON10092031191e-05
Suva_15.3575.88ON11722041182e-05
ZYRO0B08228g5.88ON12932051182e-05
YHR158C (KEL1)5.88ON11642041172e-05
TPHA0H010805.88ON8281741163e-05
TBLA0C065305.88ON11721761154e-05
KLTH0C01474g5.88ON10562031111e-04
NDAI0D026005.88ON11671741111e-04
Ecym_20615.88ON13622041111e-04
Kpol_1010.625.88ON9731751092e-04
YGR238C (KEL2)5.88ON8821891092e-04
Smik_16.685.88ON8941001074e-04
Kwal_14.10195.88ON9782051055e-04
ADL149W5.88ON12112071047e-04
Skud_7.5725.88ON8831871020.001
Suva_7.5305.88ON894219990.003
ZYRO0C03344g3.15ON65862810.35
YGR289C (MAL11)na 1ON61683761.4
KNAG0G013908.157ON156794752.2
TDEL0B045508.157ON159854742.9
CAGL0K02101g8.157ON163395743.3
TBLA0A043207.9ON83891733.4
Kpol_1014.253.15ON62986724.6
Kpol_495.28.157ON151171717.0
NCAS0A076407.9ON91386707.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F00484g
         (643 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON...  1053   0.0  
TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.1...   806   0.0  
Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON} (1807...   797   0.0  
TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {O...   788   0.0  
TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON...   785   0.0  
SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON...   775   0.0  
Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON...   773   0.0  
ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic ho...   748   0.0  
KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} simila...   733   0.0  
CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} simila...   730   0.0  
KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON...   728   0.0  
NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {O...   726   0.0  
KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6...   684   0.0  
NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {O...   670   0.0  
KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {O...   608   0.0  
YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}  K...   547   0.0  
Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}...   546   0.0  
Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}...   538   0.0  
Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C ...   537   0.0  
Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]...    62   3e-09
KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {O...    56   3e-07
CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {...    54   1e-06
KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} simi...    52   3e-06
CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa] ...    52   6e-06
NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5....    51   8e-06
TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]...    51   8e-06
SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} simil...    51   1e-05
Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {O...    51   1e-05
KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {O...    50   1e-05
Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {O...    50   1e-05
TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5....    50   1e-05
Suva_15.357 Chr15 complement(617637..618952,619001..621203) [351...    50   2e-05
ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} simil...    50   2e-05
YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON} ...    50   2e-05
TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {O...    49   3e-05
TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]...    49   4e-05
KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} simil...    47   1e-04
NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {...    47   1e-04
Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar t...    47   1e-04
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    47   2e-04
YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}  ...    47   2e-04
Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C...    46   4e-04
Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C...    45   5e-04
ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic h...    45   7e-04
Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON...    44   0.001
Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON...    43   0.003
ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {...    36   0.35 
YGR289C Chr7 complement(1073963..1075813) [1851 bp, 616 aa] {ON}...    34   1.4  
KNAG0G01390 Chr7 complement(313096..317799) [4704 bp, 1567 aa] {...    33   2.2  
TDEL0B04550 Chr2 (803410..808206) [4797 bp, 1598 aa] {ON} Anc_8....    33   2.9  
CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} simi...    33   3.3  
TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7...    33   3.4  
Kpol_1014.25 s1014 complement(42216..44105) [1890 bp, 629 aa] {O...    32   4.6  
Kpol_495.2 s495 complement(6278..9313,9316..10815) [4536 bp, 151...    32   7.0  
NCAS0A07640 Chr1 complement(1521774..1524515) [2742 bp, 913 aa] ...    32   7.4  

>ZYRO0F00484g Chr6 complement(47424..49355) [1932 bp, 643 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 643

 Score = 1053 bits (2722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/629 (84%), Positives = 530/629 (84%)

Query: 15  RGEQKLKKNQGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDK 74
           RGEQKLKKNQG                                               DK
Sbjct: 15  RGEQKLKKNQGKAELKDKKKAKKVLADDDEDDDMDLEEVLASFKKEQEQFEKVVVESVDK 74

Query: 75  PSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQNXX 134
           PSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQN  
Sbjct: 75  PSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQNAP 134

Query: 135 XXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPASRS 194
                        GIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPASRS
Sbjct: 135 MPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPASRS 194

Query: 195 GHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGHSF 254
           GHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGHSF
Sbjct: 195 GHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGHSF 254

Query: 255 IPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRVG 314
           IPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRVG
Sbjct: 255 IPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRVG 314

Query: 315 CSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVKIS 374
           CSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVKIS
Sbjct: 315 CSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVKIS 374

Query: 375 KSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQSGDEDEEESTKKQH 434
           KSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQSGDEDEEESTKKQH
Sbjct: 375 KSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQSGDEDEEESTKKQH 434

Query: 435 TISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVDGVTVYWENLA 494
           TISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVDGVTVYWENLA
Sbjct: 435 TISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVDGVTVYWENLA 494

Query: 495 EIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXXXXXXXXXXXXXXXMEIP 554
           EIEKAKKLAEQGS                    VRDQVL                 MEIP
Sbjct: 495 EIEKAKKLAEQGSDEDEDDEDEEDEDEDDDEEEVRDQVLVAEEEDAEEDEEVEEEEMEIP 554

Query: 555 DPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKSFDLCQDRWWERRDQ 614
           DPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKSFDLCQDRWWERRDQ
Sbjct: 555 DPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKSFDLCQDRWWERRDQ 614

Query: 615 VRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           VRIEEDKMEELGGVGDIVERNPAQKTKRR
Sbjct: 615 VRIEEDKMEELGGVGDIVERNPAQKTKRR 643

>TDEL0G04610 Chr7 (840098..841999) [1902 bp, 633 aa] {ON} Anc_6.10
           YPL263C
          Length = 633

 Score =  806 bits (2081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 388/571 (67%), Positives = 448/571 (78%), Gaps = 9/571 (1%)

Query: 73  DKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQN 132
           ++PS RINP +++NP HGK ELI+FGGE+T QS STTHF+N+L  F+PDN+QW++ISSQN
Sbjct: 72  ERPSRRINPSMIANPIHGKSELIMFGGEHTIQSTSTTHFFNDLVVFSPDNEQWKRISSQN 131

Query: 133 XXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPAS 192
                          G+ALLHGGEFSSPKQNTFYHYSDTWLLDC TKEWTK++QKNGP++
Sbjct: 132 SPMPRSSAAMVGHPSGVALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWTKIEQKNGPSA 191

Query: 193 RSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGH 252
           RSGHRM VWKNF I++GGFRDLGTSTTYLNDCWLFDITT+KW QVEFP+NH +PDARSGH
Sbjct: 192 RSGHRMAVWKNFIILHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPQNHPVPDARSGH 251

Query: 253 SFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPR 312
           S I DQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKM+S  SAIRW+R+K+QGFQPSPR
Sbjct: 252 SLIADQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMSSNTSAIRWDRKKRQGFQPSPR 311

Query: 313 VGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVK 372
           VGCSMVPHKGRGVLFGGVYDFEETEESL+SNFYND+FT+QI  NRWYSLSLRPQRKKQVK
Sbjct: 312 VGCSMVPHKGRGVLFGGVYDFEETEESLESNFYNDVFTYQINMNRWYSLSLRPQRKKQVK 371

Query: 373 ISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQSGDEDEEESTKK 432
           ++  STKDQEKEL+D LN+IL+ AQL DQ E++E D A      +E    D DE ES  K
Sbjct: 372 LNNRSTKDQEKELEDLLNKILRNAQLDDQGEEEEIDAAEESTAVEE----DSDESESLDK 427

Query: 433 QHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVDGVTVYWEN 492
           +H I  +LPHPRFN + AVV+DTLFI+GG+WE G+KDY+IDSFYGIDLNK DGVTVYWE+
Sbjct: 428 EHVIMNELPHPRFNAATAVVDDTLFIFGGVWEFGEKDYSIDSFYGIDLNKADGVTVYWED 487

Query: 493 LAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXXXXXXXXXXXXXXXME 552
           L  +E AK   +                         DQ L                 ME
Sbjct: 488 LTALENAKDEDDSDEDEGEEDDDDEEDSEEEQV----DQKL-VAEDEDEEEEEFEEEEME 542

Query: 553 IPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKSFDLCQDRWWERR 612
           IPDPRPWLPHPKAFESLR+FYVR G  FLEWAISNNR  +GKHLK KSF++C+ RWWERR
Sbjct: 543 IPDPRPWLPHPKAFESLRSFYVRTGATFLEWAISNNRHVKGKHLKTKSFEICESRWWERR 602

Query: 613 DQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           DQVR+EEDK+EELGGVG+I+ER+  +  KRR
Sbjct: 603 DQVRLEEDKLEELGGVGEIIERDTTKTKKRR 633

>Kpol_1045.77 s1045 (180708..182660) [1953 bp, 650 aa] {ON}
           (180710..182662) [1953 nt, 651 aa]
          Length = 650

 Score =  797 bits (2058), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/581 (65%), Positives = 455/581 (78%), Gaps = 11/581 (1%)

Query: 73  DKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQN 132
           ++PS RINPC++ NP HGK ELILFGGE TN+  STT F+N+L+++TP+NDQWR+ +S+N
Sbjct: 71  ERPSRRINPCMIENPNHGKSELILFGGESTNKDTSTTQFFNDLYSYTPENDQWRRYTSKN 130

Query: 133 XXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPAS 192
                          G+AL+HGGEFSSPKQNTFYHYSDTWLLDC+TKEWTK++QKNGP++
Sbjct: 131 SPMPRSSAAMAAHPSGVALIHGGEFSSPKQNTFYHYSDTWLLDCSTKEWTKVEQKNGPSA 190

Query: 193 RSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGH 252
           RSGHR+++WKN+F+++GGFRDLGTSTTYLNDCWLFDIT +KW Q+EFP NH IPDARSGH
Sbjct: 191 RSGHRISIWKNYFMLHGGFRDLGTSTTYLNDCWLFDITNYKWKQIEFPPNHPIPDARSGH 250

Query: 253 SFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPR 312
           SFIP QEGA+LWGGYCKVKAGKGLQKGKILTDCWYLKM + P+AIRWERRKKQGFQPSPR
Sbjct: 251 SFIPTQEGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKADPTAIRWERRKKQGFQPSPR 310

Query: 313 VGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVK 372
           VGCSMV HKGRG+LFGGVYDFEETEESLDS FYNDLF++QI+ NRW++L LRPQRKK V+
Sbjct: 311 VGCSMVHHKGRGILFGGVYDFEETEESLDSMFYNDLFSYQIEINRWFALQLRPQRKKVVR 370

Query: 373 ISKSSTKDQEKELQDHLNRILQQAQL---YDQDEDKEDDKAI-----REQFEDENQSGDE 424
           ++  S+KD+EKELQD LN+IL++A L    D+D++ ED KAI     R   +  +   D+
Sbjct: 371 LNNKSSKDKEKELQDLLNQILEKANLNDKDDKDQEDEDAKAIETELDRADHDTSDSDADD 430

Query: 425 DEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVD 484
            E+   KK++ + TQLPHPRFN ++ VVNDTLFIYGG+WELG+KDY IDSFY IDLN+ D
Sbjct: 431 VEDAKEKKEYKVLTQLPHPRFNATMTVVNDTLFIYGGVWELGEKDYTIDSFYSIDLNRTD 490

Query: 485 GVTVYWENLAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQ--VLXXXXXXXXX 542
           GVTV WE+L+EIE AK+ A                        + DQ  V          
Sbjct: 491 GVTVLWEDLSEIEAAKE-AGIVDSDEEDDEFGDSDDEDDGEEEIMDQKLVAEEEEEEEEE 549

Query: 543 XXXXXXXXMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKSFD 602
                   MEIPDP PWLPHPK FESLR FYVR G  FLEWAISNNRDARGKHLK+KSFD
Sbjct: 550 EEEEQVDEMEIPDPCPWLPHPKPFESLRVFYVRTGATFLEWAISNNRDARGKHLKKKSFD 609

Query: 603 LCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           LCQDRWW+RRDQVRIEEDKMEELGG+G+++E++ ++ TKRR
Sbjct: 610 LCQDRWWQRRDQVRIEEDKMEELGGIGEVIEKDTSKSTKRR 650

>TBLA0G01110 Chr7 complement(283630..285546) [1917 bp, 638 aa] {ON}
           Anc_6.10 YPL263C
          Length = 638

 Score =  788 bits (2036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/573 (66%), Positives = 442/573 (77%), Gaps = 10/573 (1%)

Query: 74  KPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQNX 133
           KP+ RIN C++SNP HGK ELILFGGE T+   +TT FYN+LFT+ P+NDQW+K +SQN 
Sbjct: 73  KPTKRINSCMISNPIHGKNELILFGGENTS---TTTTFYNDLFTYNPENDQWKKYTSQNS 129

Query: 134 XXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPASR 193
                         GIALLHGGEFSSPKQNTFYHYSDTWLLDC TKEW+K++ KNGP++R
Sbjct: 130 PMPRSSSAMISHPTGIALLHGGEFSSPKQNTFYHYSDTWLLDCATKEWSKVENKNGPSAR 189

Query: 194 SGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGHS 253
           SGHRMTVWKNF I++GGFRDLGTSTTYL D WLFD+T +KWTQVEFP NH IPDARSGHS
Sbjct: 190 SGHRMTVWKNFIILHGGFRDLGTSTTYLKDLWLFDVTKYKWTQVEFPPNHAIPDARSGHS 249

Query: 254 FIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRV 313
            IP Q+GA+LWGGYCKVKAGKGLQKGKIL+DCWYLKM S  S IRWERRKKQGFQPSPRV
Sbjct: 250 LIPTQDGALLWGGYCKVKAGKGLQKGKILSDCWYLKMKSDVSGIRWERRKKQGFQPSPRV 309

Query: 314 GCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVKI 373
           GCSMV HKGRG+LFGGV+DFEETEESLDS FYNDLFT+QI+ NRW+SLS+R QRKK +KI
Sbjct: 310 GCSMVHHKGRGILFGGVFDFEETEESLDSLFYNDLFTYQIEINRWFSLSMRSQRKKTIKI 369

Query: 374 SKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQF---EDENQSGDEDEEEST 430
              +TKD+EKELQD LN IL++  L   D+D ED  AI E+    +DE+ S DE ++   
Sbjct: 370 GPKTTKDKEKELQDILNSILKKNNL--TDDDSEDPNAIEEELKINDDESNSEDESKDGQV 427

Query: 431 KKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVDGVTVYW 490
            KQ+ +  QLPH RFN + AVVNDTL+I+GG WELG+KDY+IDSFY IDLNK+DGVTVYW
Sbjct: 428 TKQYEVMNQLPHVRFNATTAVVNDTLYIFGGSWELGEKDYSIDSFYSIDLNKLDGVTVYW 487

Query: 491 ENLAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXXXXXXXXXXXXXXX 550
           E++ EIE AK+L EQ S                    + DQ L                 
Sbjct: 488 EDMEEIEAAKELGEQFS--DEEDEDDEEEDEDDGEEEIVDQKLVAEEDEEEEEIEADEDE 545

Query: 551 MEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKSFDLCQDRWWE 610
           MEIPDPRPWLPHPK FE+LRAFYVR G  FLEWAISNNRD++GKHLK+KSF+L +DRWWE
Sbjct: 546 MEIPDPRPWLPHPKPFETLRAFYVRTGATFLEWAISNNRDSKGKHLKKKSFELTEDRWWE 605

Query: 611 RRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           RRDQVRIEEDKMEELGG+ +IVER+  Q  KRR
Sbjct: 606 RRDQVRIEEDKMEELGGIENIVERDTTQVNKRR 638

>TPHA0M00200 Chr13 complement(40103..42007) [1905 bp, 634 aa] {ON}
           Anc_6.10 YPL263C
          Length = 634

 Score =  785 bits (2028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/571 (65%), Positives = 444/571 (77%), Gaps = 8/571 (1%)

Query: 73  DKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQN 132
           DKP+ RIN C+++NP HGKKEL+LFGGE T+Q    THFYN+L+TFTPDND W+KI+SQN
Sbjct: 72  DKPTRRINSCMIANPNHGKKELLLFGGENTSQEQGVTHFYNDLYTFTPDNDLWKKITSQN 131

Query: 133 XXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPAS 192
                          GIALLHGGEFSSPKQNTFYHYSDTWLLDCTT+EWTK++QKNGP++
Sbjct: 132 SPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTREWTKVEQKNGPSA 191

Query: 193 RSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGH 252
           RSGHR+TVWKN+FI++GGFRDLG++T+YLND WLFDIT++KW Q+EFP NH +PDARSGH
Sbjct: 192 RSGHRITVWKNYFILHGGFRDLGSTTSYLNDSWLFDITSYKWRQIEFPPNHPVPDARSGH 251

Query: 253 SFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPR 312
           S IP QEGA+LWGGYCKVKAGKGLQKGKIL DCWYLKM + PSA+RWERRKKQGFQPSPR
Sbjct: 252 SLIPTQEGAVLWGGYCKVKAGKGLQKGKILGDCWYLKMKADPSAVRWERRKKQGFQPSPR 311

Query: 313 VGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVK 372
           VGCSMV HKGRG+LFGGVYDFEETEESLDS FYNDLF++QI++NRWY+L LR QRKK V+
Sbjct: 312 VGCSMVHHKGRGILFGGVYDFEETEESLDSIFYNDLFSYQIESNRWYALQLRSQRKKVVR 371

Query: 373 ISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQSGDEDEEESTKK 432
           ++  S+K++E ELQ+ LN IL++A L D DED  +           +   D++ E+ +KK
Sbjct: 372 LNNKSSKEKELELQNILNEILEKANLKDDDEDANE----LSNGLGSDSDSDDESEKVSKK 427

Query: 433 QHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVDGVTVYWEN 492
           ++ +  QLPH RFN S  VV+DTLFIYGG+WELG+KDY+IDS Y IDLNK+DGVTVYWEN
Sbjct: 428 EYIVRNQLPHHRFNASTTVVDDTLFIYGGVWELGEKDYSIDSMYSIDLNKLDGVTVYWEN 487

Query: 493 LAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXXXXXXXXXXXXXXXME 552
           L +IEKAK+L   G+                      DQ L                 ME
Sbjct: 488 LHDIEKAKEL---GAINSDEEDEEDEDDEDDDEEETVDQKLVAEEEEEEEEIEDADD-ME 543

Query: 553 IPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKSFDLCQDRWWERR 612
           IPDPRPWLPHPKAFESLR FYVR G  FLEWAISNN+  RGKHLK KSF+LCQDRWWERR
Sbjct: 544 IPDPRPWLPHPKAFESLRNFYVRTGASFLEWAISNNKHTRGKHLKTKSFELCQDRWWERR 603

Query: 613 DQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           DQVRIEEDK+EELGGVG+++E++  + TKRR
Sbjct: 604 DQVRIEEDKLEELGGVGEVIEKDTTKSTKRR 634

>SAKL0E00880g Chr5 complement(66646..68556) [1911 bp, 636 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 636

 Score =  775 bits (2001), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/571 (64%), Positives = 444/571 (77%), Gaps = 5/571 (0%)

Query: 73  DKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQN 132
           D+P+ RIN  +V+NP HGK+EL+LFGGE TN +NSTT FYN+LFT++ D DQWRKISSQN
Sbjct: 71  DRPTRRINSSMVANPLHGKRELLLFGGENTNSTNSTTAFYNDLFTYSLDGDQWRKISSQN 130

Query: 133 XXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPAS 192
                          G+ L+HGGEFSSPKQNTFYHYSDTWLLDC TKEWTK++QKNGP +
Sbjct: 131 SPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLLDCNTKEWTKIEQKNGPTA 190

Query: 193 RSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGH 252
           RSGHR+TVWKN+FI++GGFRDLGT TTYL+DCWLFDITT+KW QV+FP NH IPDARSGH
Sbjct: 191 RSGHRLTVWKNYFILHGGFRDLGTMTTYLSDCWLFDITTYKWKQVDFPPNHPIPDARSGH 250

Query: 253 SFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPR 312
           S +P  +GA+LWGGYCKVKAGKGLQKGKILTDCWYLKM S   AIRWERRKKQGFQPSPR
Sbjct: 251 SLVPTPDGAVLWGGYCKVKAGKGLQKGKILTDCWYLKMKSDIGAIRWERRKKQGFQPSPR 310

Query: 313 VGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVK 372
           VGCSMV HKGRG+LFGGV+DFEETEESL+S FYNDLFTFQI+TNRWYS SLRPQRK    
Sbjct: 311 VGCSMVHHKGRGILFGGVFDFEETEESLESMFYNDLFTFQIETNRWYSASLRPQRKAAKA 370

Query: 373 ISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQSGDEDEEESTKK 432
            SK++ ++++KEL+D LN+IL++A L D + +KE    + ++  DE  S   +E  S KK
Sbjct: 371 TSKNN-RNKDKELEDILNQILEKANLNDDENEKETIGDVLKEL-DEEDSDSAEELNSEKK 428

Query: 433 QHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVDGVTVYWEN 492
           ++ I  QLPHPRFN S AVV+DTLFI+GG+WE+G+KDY+IDSFY IDLN++DG+ +YWE+
Sbjct: 429 EYPIRIQLPHPRFNASTAVVDDTLFIFGGVWEIGEKDYSIDSFYAIDLNRLDGIKIYWED 488

Query: 493 LAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXXXXXXXXXXXXXXXME 552
           L +IE AK+L ++                      + DQ L                  E
Sbjct: 489 LRDIEMAKELGDEEE--DFEDNEEDDEEDDDDEEEITDQKL-VAEDDDEEEEEEDEYEPE 545

Query: 553 IPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKSFDLCQDRWWERR 612
           IPDPRPWLPHPK FE+LR FYVR G  FLEWAIS+NRDARGKHLK+KSFDLCQDRWWERR
Sbjct: 546 IPDPRPWLPHPKPFETLRGFYVRTGADFLEWAISSNRDARGKHLKKKSFDLCQDRWWERR 605

Query: 613 DQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           DQVRIEEDK+EELGG+G++VE++ ++  KRR
Sbjct: 606 DQVRIEEDKLEELGGIGEVVEKDTSKSKKRR 636

>Kwal_56.22350 s56 complement(60828..62804) [1977 bp, 658 aa] {ON}
           YPL263C (KEL3) - Kelch-repeat protein, similar to Kel1
           and Kel2 [contig 186] FULL
          Length = 658

 Score =  773 bits (1995), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/572 (64%), Positives = 449/572 (78%), Gaps = 11/572 (1%)

Query: 73  DKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQN 132
           ++PS RIN C+V+NP HGK+EL++FGGE+TN +NS T FYNELFT++ D+DQWRKI+S+N
Sbjct: 97  ERPSQRINSCMVANPIHGKRELLIFGGEHTNSTNSLTAFYNELFTYSLDSDQWRKITSRN 156

Query: 133 XXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPAS 192
                          G+AL+HGGEFSSPKQNTFYHYSDTWLLDCTTKEWTK++QKNGP++
Sbjct: 157 SPMPRSSAAAAAHSSGVALIHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKMEQKNGPSA 216

Query: 193 RSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGH 252
           RSGHRMT+WKNFFI++GGFRDLGTSTTYLND W+FDITT+KW QVEFP NH IPDARSGH
Sbjct: 217 RSGHRMTIWKNFFILHGGFRDLGTSTTYLNDLWIFDITTYKWKQVEFPPNHPIPDARSGH 276

Query: 253 SFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPR 312
           S IP Q+GA+LWGGYCKVKAGKGLQKGK LTDCWYLKM S  SAIRWERRKKQGFQPSPR
Sbjct: 277 SIIPTQDGAVLWGGYCKVKAGKGLQKGKTLTDCWYLKMKSDVSAIRWERRKKQGFQPSPR 336

Query: 313 VGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVK 372
           VGCSMV HKGRG+LFGGVYDFEETEE L S F+NDLF++Q++ NRWYS+ +RPQ+KK V 
Sbjct: 337 VGCSMVHHKGRGMLFGGVYDFEETEEGLASEFFNDLFSYQVEANRWYSVKMRPQKKKTVA 396

Query: 373 ISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQSGDEDEE-ESTK 431
           IS+++ +++++EL++ LN ILQQA L D  +D ++      + + E Q  DE+E  E+++
Sbjct: 397 ISRNN-RNKDEELENILNDILQQANLADDTDDDDN------EIKRELQRIDEEEALENSR 449

Query: 432 KQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVDGVTVYWE 491
           KQ+ +  QLPHPRFN + AVV+D LFI+GG+WE G++D++IDSFY IDLNK+DGV VYWE
Sbjct: 450 KQYEVVGQLPHPRFNATTAVVDDFLFIFGGVWEFGERDFSIDSFYSIDLNKLDGVKVYWE 509

Query: 492 NLAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXXXXXXXXXXXXXXXM 551
           NL+E+EKAK L   G                       DQ L                  
Sbjct: 510 NLSELEKAKAL---GEDDEEEFDDDEDDDDDDEEEETADQKLVAEDEEEEEEEEEEEDEP 566

Query: 552 EIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKSFDLCQDRWWER 611
           EIPD RPWLPHPK FE+LRAFY+R G +FL+WAISNNRDA+GKHLK++SFDLCQDRWWER
Sbjct: 567 EIPDLRPWLPHPKPFETLRAFYIRTGAEFLKWAISNNRDAKGKHLKKQSFDLCQDRWWER 626

Query: 612 RDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           R+Q+RIEEDK+EELGGV ++VER+PAQ  KRR
Sbjct: 627 REQIRIEEDKLEELGGVENVVERDPAQTMKRR 658

>ACR016W Chr3 (384967..386889) [1923 bp, 640 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL263C (KEL3)
          Length = 640

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/575 (63%), Positives = 429/575 (74%), Gaps = 9/575 (1%)

Query: 73  DKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQN 132
           ++P  R +  LV+NP H K+ELILFGGEYTNQS   THFYN+LF ++ D DQW+K +SQN
Sbjct: 71  ERPHQRSSSSLVANPLHNKRELILFGGEYTNQSTGMTHFYNDLFIYSLDTDQWKKYTSQN 130

Query: 133 XXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPAS 192
                          G+ L+HGGEFSSPKQNTFYHYSDTWL DC T EWTK++QKNGP+S
Sbjct: 131 SPMPRSSAAIAAHPSGVVLIHGGEFSSPKQNTFYHYSDTWLFDCATHEWTKIEQKNGPSS 190

Query: 193 RSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGH 252
           RSGHRMTVWKN+ I++GGFRDLGTSTTYLNDCWLFDITT+KW Q++FP NH IPDARSGH
Sbjct: 191 RSGHRMTVWKNYIILHGGFRDLGTSTTYLNDCWLFDITTYKWQQLQFPANHPIPDARSGH 250

Query: 253 SFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPR 312
           S +P  EGAILWGGYCKVKAGKGLQKGKILTDCWYLKM S  +AIRWERRKKQGFQPS R
Sbjct: 251 SLLPTPEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMKSDVTAIRWERRKKQGFQPSSR 310

Query: 313 VGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVK 372
            GCSMV HKGRG+LFGGVYD+EETEE LDS FYNDLFT+ I+TNRWYS+SLR QR  +VK
Sbjct: 311 AGCSMVHHKGRGILFGGVYDYEETEEGLDSLFYNDLFTYHIETNRWYSVSLRAQRHSKVK 370

Query: 373 ISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQSGDEDEEESTKK 432
            +  S +D++KEL+D LN IL++A L D D+  ED K I E+       G  + EE TKK
Sbjct: 371 SAPKSNRDKDKELEDMLNAILKKANL-DDDDGDEDGKTIEEELNKLENDGITETEE-TKK 428

Query: 433 QHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVDGVTVYWEN 492
            + I  +LPHPRFN S A+V+DTLFI+GG+WE G+KDY IDSFY ID+NKVDGV VYWE+
Sbjct: 429 SYPIVMKLPHPRFNASTAIVDDTLFIFGGVWEQGEKDYMIDSFYSIDMNKVDGVKVYWED 488

Query: 493 LAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXXXXXXXXXXXXXXXME 552
           +A +E+AK+L E+                       R  V                   E
Sbjct: 489 MAAVERAKELGEEDEDDAEDDEDDDSEDDDEEEHSDRKLVAEEEEEEEEEDNEILP---E 545

Query: 553 IPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNR----DARGKHLKQKSFDLCQDRW 608
           IPDPRPWLPHPKAFESLRAFYVR G  FLEWAI+N      DA+GKHLK+ SFDLCQ+RW
Sbjct: 546 IPDPRPWLPHPKAFESLRAFYVRTGASFLEWAITNKHNTRSDAKGKHLKKHSFDLCQERW 605

Query: 609 WERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           WERR+QVRIEEDK+EELGGVG+++E++  + TKRR
Sbjct: 606 WERREQVRIEEDKLEELGGVGEVIEKDFTKPTKRR 640

>KLTH0C11528g Chr3 (946632..948560) [1929 bp, 642 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263C KEL3
           Cytoplasmic protein of unknown function
          Length = 642

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/578 (61%), Positives = 434/578 (75%), Gaps = 15/578 (2%)

Query: 74  KPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQNX 133
           +PS R N C+V NP+HGK+EL++FGGEYTNQ++STT FYNELFT++ D DQW+KI+S+N 
Sbjct: 72  RPSPRSNVCMVPNPSHGKRELLIFGGEYTNQTSSTTTFYNELFTYSLDTDQWKKITSRNA 131

Query: 134 XXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPASR 193
                         G+ L+HGGEFSSPKQNTFYHYSD+WLLDC++KEWTK+DQKNGP++R
Sbjct: 132 PMPRSSAAAAGHPSGVVLIHGGEFSSPKQNTFYHYSDSWLLDCSSKEWTKIDQKNGPSAR 191

Query: 194 SGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGHS 253
           SGHRMTVWKNFF+M+GGFRDLGTSTTYLNDCWLFDITT+KW QVEFP NH +PDARSGHS
Sbjct: 192 SGHRMTVWKNFFVMHGGFRDLGTSTTYLNDCWLFDITTYKWKQVEFPPNHPVPDARSGHS 251

Query: 254 FIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRV 313
            IP QEGAI+WGGYCK+KA KGLQKGKILTDCWYL+M S  + IRWERRKKQGFQPSPRV
Sbjct: 252 LIPTQEGAIVWGGYCKIKAKKGLQKGKILTDCWYLRMKSDITGIRWERRKKQGFQPSPRV 311

Query: 314 GCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVKI 373
           GCSM  HKGRG+LFGGVYD+EETEE L S F+NDL ++Q++ NRWYS+ +RPQ+KK V  
Sbjct: 312 GCSMAHHKGRGILFGGVYDYEETEEGLSSEFFNDLLSYQVEANRWYSIKMRPQKKKIVAA 371

Query: 374 SKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQSGDEDEEES-TKK 432
           SKS+ K ++ EL   LN ILQ+A L D++ ++ +  +   + E E    DE+E     +K
Sbjct: 372 SKSA-KSKDDELVGILNDILQKANLADEENEENESDS---EIEKELHRLDEEELLGHQQK 427

Query: 433 QHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVDGVTVYWEN 492
           Q+ +  QLPH RFN +  VV+DTLFI+GG WE G++D++IDSFY IDLN+ DGV V+WE+
Sbjct: 428 QYPVVAQLPHSRFNAATTVVDDTLFIFGGSWEYGERDFSIDSFYSIDLNRTDGVRVFWED 487

Query: 493 LAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXXXXXXXXXXXXXXXM- 551
           L EIEKAK   +QG                       D+ L                   
Sbjct: 488 LEEIEKAK---DQGLEEDEEEEEEEDDDDEDDEEETLDEELIAEMEDDKQEEEEQEEEEE 544

Query: 552 ------EIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKSFDLCQ 605
                 EIPDPRPWLPHPKAFE+LRAFY+R G +FL+WAISNNR A+GKHLK++SFDL Q
Sbjct: 545 EEEAGPEIPDPRPWLPHPKAFETLRAFYIRTGAEFLQWAISNNRSAKGKHLKKQSFDLSQ 604

Query: 606 DRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           DRWWERR+QVRIEEDK+EE+GGV +I+ER+ +  TKRR
Sbjct: 605 DRWWERREQVRIEEDKLEEMGGVENIIERDSSHSTKRR 642

>CAGL0A01067g Chr1 (106866..108791) [1926 bp, 641 aa] {ON} similar
           to uniprot|Q08979 Saccharomyces cerevisiae YPL263c KEL3
          Length = 641

 Score =  730 bits (1884), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/577 (62%), Positives = 438/577 (75%), Gaps = 10/577 (1%)

Query: 73  DKPSARINPCLVSNPA--HGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISS 130
           DK + R+NPC+V NP+    KKELI+FGGE+TN   STT FYN+L TFTP+N+QW++ +S
Sbjct: 69  DKVNKRLNPCMVGNPSASSSKKELIVFGGEFTNPQTSTTTFYNDLHTFTPENNQWKRYTS 128

Query: 131 QNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGP 190
           QN               GIALLHGGEFSSPKQNTFYHYSDTW+LDC TKEW K+D K GP
Sbjct: 129 QNAPMPRSSAAMAAHPSGIALLHGGEFSSPKQNTFYHYSDTWILDCNTKEWAKVDAKVGP 188

Query: 191 ASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARS 250
           ++RSGHR+TVWKNFFI++GGFRDLGTSTTYL+DCWLFDITT+KW QVEFP NH +PDARS
Sbjct: 189 SARSGHRITVWKNFFILHGGFRDLGTSTTYLSDCWLFDITTYKWKQVEFPSNHQVPDARS 248

Query: 251 GHSFIPDQEGAILWGGYCKVKAG-KGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQP 309
           GHSFIP  EGAILWGGYCKVKA  KG QKGKIL+DCWYLKM S  S IRWERR+KQGFQP
Sbjct: 249 GHSFIPTAEGAILWGGYCKVKANKKGYQKGKILSDCWYLKMKSDISGIRWERRRKQGFQP 308

Query: 310 SPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKK 369
           SPRVGCSM  HKGRG+LFGGVYDFEETEESL+SNF+NDLF++ I++NRWYSLS+R ++  
Sbjct: 309 SPRVGCSMAYHKGRGILFGGVYDFEETEESLESNFFNDLFSYHIESNRWYSLSIRSRKSN 368

Query: 370 QVKISKSS---TKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQSGDEDE 426
              ++K S   +K+QEKEL+  L+ IL++A L D+ +D EDD+ I       +   +E+E
Sbjct: 369 NNAVAKKSGKNSKEQEKELKMLLDSILEKANLQDKSDDDEDDEEINTALAKVDLEDEEEE 428

Query: 427 EESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVDGV 486
           + +   QHTI TQLPHPRFN +  V++DTLFI+GG+WELGDK++ IDS Y IDLNK+DGV
Sbjct: 429 QLAV--QHTILTQLPHPRFNATTTVIDDTLFIFGGIWELGDKEFMIDSLYSIDLNKLDGV 486

Query: 487 TVYWENLAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXXXXXXXXXXX 546
           T+YWE+L EIE+AK+L  + S                     +D+               
Sbjct: 487 TMYWEDLKEIERAKELGVEDSDFEDDDEDDDDEDDDEEDDNEKDEG--DDEESEEEEEEE 544

Query: 547 XXXXMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKSFDLCQD 606
               +E PDPRPWLPHPK FE+LRAFY+R G  FLEWAISNN++A+GKHLK+ SFDLCQ+
Sbjct: 545 IEEELEYPDPRPWLPHPKPFETLRAFYIREGAAFLEWAISNNKNAKGKHLKKHSFDLCQE 604

Query: 607 RWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           RWWERRDQ+RIEEDK+EE+GGVGDI+ER+ +  +KRR
Sbjct: 605 RWWERRDQLRIEEDKLEEIGGVGDIIERDKSASSKRR 641

>KLLA0D00836g Chr4 complement(78202..80124) [1923 bp, 640 aa] {ON}
           similar to uniprot|Q08979 Saccharomyces cerevisiae
           YPL263C KEL3 Cytoplasmic protein of unknown function
          Length = 640

 Score =  728 bits (1878), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/575 (61%), Positives = 428/575 (74%), Gaps = 8/575 (1%)

Query: 73  DKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQN 132
           D+P  RINPC+  NPAHGK+EL++FGGE T Q   TTHFYN+LF ++ D D W++ +SQN
Sbjct: 70  DRPDQRINPCMFVNPAHGKRELMMFGGESTTQETGTTHFYNDLFVYSLDTDTWKRYTSQN 129

Query: 133 XXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPAS 192
                          G+AL+HGGEFSSPKQNTFYHYSD+WL DC++KEWTK++QKNGP++
Sbjct: 130 SPMPRSSAAVASHPTGVALIHGGEFSSPKQNTFYHYSDSWLFDCSSKEWTKVEQKNGPSA 189

Query: 193 RSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGH 252
           RSGHRM +WKNF I++GGFRDLGTSTTYLND W+FDIT +KW QVE P NH IPDARSGH
Sbjct: 190 RSGHRMAIWKNFIILHGGFRDLGTSTTYLNDLWVFDITNYKWKQVELPANHPIPDARSGH 249

Query: 253 SFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPR 312
           S I   EGA+L+GGY KVKAGKGLQKGKIL+DCWYLKM S   +IRWERRKKQG QPSPR
Sbjct: 250 SLISTAEGAVLYGGYTKVKAGKGLQKGKILSDCWYLKMKSDLGSIRWERRKKQGSQPSPR 309

Query: 313 VGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVK 372
           VGCSMV HKGRGVLFGGVYDFEETEESL S FYN+L+T+QI+ NRWY++SLRPQRKK+  
Sbjct: 310 VGCSMVHHKGRGVLFGGVYDFEETEESLRSIFYNELYTYQIENNRWYAMSLRPQRKKKNF 369

Query: 373 ISKSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFED----ENQSGDEDEEE 428
           +   S ++++KEL+D LN+IL +A L D  ED ++ K I EQ       +    DE +++
Sbjct: 370 VQSKSNRNKDKELEDILNQILDKANLRDA-EDDDESKVIEEQLNQLDLIDFDDDDESDKK 428

Query: 429 STKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVDGVTV 488
           S K   T+ST LPH RFN + AVV+DTLFI+GG  E+G+KDY IDSFY ID+NK+DGV V
Sbjct: 429 SAKSYETMST-LPHARFNAATAVVDDTLFIFGGTVEIGEKDYPIDSFYSIDMNKLDGVKV 487

Query: 489 YWENLAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXXXXXXXXXXXXX 548
           YWE L E+E+A+KL EQ S                    + D  L               
Sbjct: 488 YWEELKEVERAEKLGEQDS--DDEFGDEDDDDEDDGEEEIVDSKLEAEDEEEEEEEEEVE 545

Query: 549 XXMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKSFDLCQDRW 608
              EIPD RPWLPHPKAFE+LRAFYVR GP FLE AIS+NRD++GKHLK KSF+LCQDRW
Sbjct: 546 EEYEIPDLRPWLPHPKAFETLRAFYVRTGPTFLELAISSNRDSKGKHLKTKSFELCQDRW 605

Query: 609 WERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           WERR+QVRIEEDK+EELGGV D++E++ ++  +RR
Sbjct: 606 WERREQVRIEEDKLEELGGVEDVIEKDTSKTQRRR 640

>NCAS0D02190 Chr4 complement(408069..410006) [1938 bp, 645 aa] {ON}
           Anc_6.10
          Length = 645

 Score =  726 bits (1874), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/575 (61%), Positives = 429/575 (74%), Gaps = 8/575 (1%)

Query: 74  KPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQNX 133
           KP+ R+N C+++ P H KKEL++FGGE+TN   S THFYNEL T++PDN QWRKI+SQN 
Sbjct: 73  KPAQRLNSCMITTPNHSKKELLIFGGEFTNPETSMTHFYNELITYSPDNGQWRKITSQNS 132

Query: 134 XXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPASR 193
                         GIALLHGGEFSSPKQNTFYHYSDTWLLD  TKEWTK+D   GP  R
Sbjct: 133 PMPRSSAAMCAHPSGIALLHGGEFSSPKQNTFYHYSDTWLLDTHTKEWTKMDSAKGPPGR 192

Query: 194 SGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGHS 253
           SGHR+T+WKN+FI+ GGF+DLG ST+Y NDCW FDITT+KW Q+EFP NH IPDARSGHS
Sbjct: 193 SGHRITIWKNYFILSGGFKDLGHSTSYFNDCWCFDITTYKWKQIEFPPNHPIPDARSGHS 252

Query: 254 FIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRV 313
           +IP +EG ILWGGYCKVKAGKGLQKGKIL DCWYLKM S  S +RWERRKKQGFQPSPRV
Sbjct: 253 WIPTEEGCILWGGYCKVKAGKGLQKGKILNDCWYLKMKSDLSQVRWERRKKQGFQPSPRV 312

Query: 314 GCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVKI 373
           GCSM  HKGRG+LFGGVYDFEETEESL+S FYNDLF++ +++NRW+SLSLR  +K + K+
Sbjct: 313 GCSMAYHKGRGILFGGVYDFEETEESLESIFYNDLFSYNVESNRWFSLSLRKAQKFK-KV 371

Query: 374 SKSS----TKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQSGDEDEEES 429
           +KSS    +K++EKELQD LN+IL++  L D D+D E       + E    S DED +E 
Sbjct: 372 AKSSNNKSSKEKEKELQDLLNQILEKNNLKDDDDDDEISTGTETETETAANSDDEDNKEH 431

Query: 430 TKK-QHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVDGVTV 488
           +K  Q T+ +QLPHPRFN +  VV+D+LFIYGG+WE+G+KDY IDS Y IDLNK+DGV+ 
Sbjct: 432 SKSAQVTVMSQLPHPRFNAATTVVDDSLFIYGGIWEMGEKDYAIDSLYSIDLNKLDGVSC 491

Query: 489 YWENLAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXXXXXXXXXXXXX 548
           YWE+L EIEKAK++ EQ S                       +++               
Sbjct: 492 YWEDLQEIEKAKEIGEQDSDEDEEEEDDEEDDDEEEI--EDKKLVAEEDDEEEEEEEEEF 549

Query: 549 XXMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKSFDLCQDRW 608
             MEIPD RPWLPHPK FESLRAFY+R G  FLEWAISNN+  RGKHLK+KSFDLC+DRW
Sbjct: 550 EEMEIPDLRPWLPHPKPFESLRAFYIREGAAFLEWAISNNKHVRGKHLKKKSFDLCEDRW 609

Query: 609 WERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           WERRDQVRIEEDK+EELG VG+++E++ +  T +R
Sbjct: 610 WERRDQVRIEEDKLEELGVVGNVIEKDTSVPTSKR 644

>KAFR0B06500 Chr2 (1347509..1349419) [1911 bp, 636 aa] {ON} Anc_6.10
           YPL263C
          Length = 636

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/574 (58%), Positives = 421/574 (73%), Gaps = 12/574 (2%)

Query: 73  DKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQN 132
           +KPS R N  ++S+    KKEL+LFGGE+T++   TT FYN+L+TF+PDN+QW++I+SQN
Sbjct: 71  EKPSIRNNGSIISSTT--KKELLLFGGEHTSKELQTTKFYNDLYTFSPDNNQWKRITSQN 128

Query: 133 XXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPAS 192
                          GIALL+GGEFSSPKQ+TFYHYSDTW+LD TTKEWTK++ K  P  
Sbjct: 129 SPMPRSSAAMAAHPSGIALLNGGEFSSPKQSTFYHYSDTWILDLTTKEWTKIEGKVKPVG 188

Query: 193 RSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGH 252
           RSGHR+T WKN+FI++GGF+DLG STTY ND WLFDITT+KW QVEFP+NH +PDARSGH
Sbjct: 189 RSGHRITTWKNYFILFGGFKDLGHSTTYYNDVWLFDITTYKWKQVEFPKNHTLPDARSGH 248

Query: 253 SFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPR 312
           S IP  EG I++GGYCK+KA KGLQKGK+L+ CW LKM +   AIRWERR+KQGFQPSPR
Sbjct: 249 SLIPTSEGCIVYGGYCKIKAKKGLQKGKLLSGCWNLKMKADVEAIRWERRRKQGFQPSPR 308

Query: 313 VGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVK 372
           VGCSM  HKGRG+LFGGVYDF+ETEESL+S FYNDLFT+ I++NRW++++L+ +      
Sbjct: 309 VGCSMAYHKGRGILFGGVYDFDETEESLESIFYNDLFTYNIESNRWFNVTLKKRSNATKT 368

Query: 373 ISKS---STKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQSGDEDEEES 429
           IS +   S+K++E+ELQD LN+IL++  L   DE++E+   I   F  +++   +DEE+ 
Sbjct: 369 ISSTKNKSSKEKERELQDLLNQILEKNNLKPDDEEEEESSDI---FGSDDE---DDEEQK 422

Query: 430 TKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVDGVTVY 489
            K      TQLPHPRFN +  V++D L+IYGG WE G+ DY+IDSFY IDLNK+DGV VY
Sbjct: 423 NKIDIKTVTQLPHPRFNATTTVIDDMLYIYGGAWEFGEIDYSIDSFYSIDLNKLDGVNVY 482

Query: 490 WENLAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXXXXXXXXXXXXXX 549
           WE+L EIE AK+L EQGS                       +++                
Sbjct: 483 WEDLNEIETAKELGEQGS-EDEDEDDFEEDEEDGEEEVEDTKLIAEDVEDEKEEEEEEYP 541

Query: 550 XMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKSFDLCQDRWW 609
            MEIPDPRPWLPHPKAFESLRAFY+R GP FLEWAISNNR  RGK LKQKSF+LCQDRWW
Sbjct: 542 EMEIPDPRPWLPHPKAFESLRAFYLREGPAFLEWAISNNRHTRGKLLKQKSFELCQDRWW 601

Query: 610 ERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           ERRDQ+ IEEDK+EE+G VGD+VER+ ++   +R
Sbjct: 602 ERRDQISIEEDKLEEIGVVGDVVERDTSKAVSKR 635

>NDAI0I02750 Chr9 complement(644137..646128) [1992 bp, 663 aa] {ON}
           Anc_6.10 YPL263C
          Length = 663

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/583 (56%), Positives = 417/583 (71%), Gaps = 16/583 (2%)

Query: 76  SARINPCLVSNP-AHGKK--ELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQN 132
           S R N  +++   AH KK  EL++FGGEYT+     THFYN+L ++TPD  QWRKI+SQN
Sbjct: 81  SPRSNSSMITAASAHNKKGKELLMFGGEYTSPETGMTHFYNDLLSYTPDTQQWRKITSQN 140

Query: 133 XXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPAS 192
                          GIA+LHGGEFSSPKQNTFYHYSDTW+LD +TKEWTK+D K  P +
Sbjct: 141 SPMPRSSAAMCYHPSGIAILHGGEFSSPKQNTFYHYSDTWILDTSTKEWTKVDIKKSPVA 200

Query: 193 RSGHRMTVWKNFFIMYGGFRDLGTS-TTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSG 251
           RSGHR+  WKN+F+++GGF+D+G + T Y ND W FDI  +KWTQVEFP+NH +PD RSG
Sbjct: 201 RSGHRIVHWKNYFVLFGGFKDIGNNQTNYFNDVWCFDILNYKWTQVEFPKNHPLPDPRSG 260

Query: 252 HSFIPDQEGAILWGGYCKVKA--GKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQP 309
           HS+IP +EG ILWGGY KVK+    G QKGKIL DCWYLKM S  S+IRWERRKK GFQP
Sbjct: 261 HSWIPVEEGCILWGGYTKVKSKLKSGQQKGKILNDCWYLKMKSDLSSIRWERRKKLGFQP 320

Query: 310 SPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKK 369
           SPRVGCSM  HKGRG+LFGGVYDF+ETEESL+S FYNDLF++ ++TNRW++L+LR  +K 
Sbjct: 321 SPRVGCSMAYHKGRGILFGGVYDFDETEESLESLFYNDLFSYNVETNRWFALNLRKNQKG 380

Query: 370 QVKISKS---STKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAI----REQFEDENQSG 422
              + +S   ++K++EKELQD LN+IL++  L D+D++ +++                S 
Sbjct: 381 NKSLKRSNNKNSKEKEKELQDLLNQILEKNNLKDEDDEDDEEVNENEDGSTTASTAATSD 440

Query: 423 DEDEEESTKKQH--TISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDL 480
           DED E +T++    TI  QLPHPR+N ++ VV+D LFIYGG WELG+KDY I+SFY IDL
Sbjct: 441 DEDTERTTQEAEGVTIMNQLPHPRYNVAMTVVDDLLFIYGGSWELGEKDYFINSFYSIDL 500

Query: 481 NKVDGVTVYWENLAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXXXXX 540
           N++DGVT YWE+L EIEKAK+L EQ S                    ++DQ L       
Sbjct: 501 NRIDGVTCYWEDLKEIEKAKELGEQDSDEEDDEDDEEDDDEDDDEEEIKDQKL-VADDED 559

Query: 541 XXXXXXXXXXMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKS 600
                     MEIPD RPWLPHPK FESLRAFY+R GP FLEWAISNN+  RGKHLK+KS
Sbjct: 560 EEEEEEDVQEMEIPDLRPWLPHPKPFESLRAFYIREGPAFLEWAISNNKHVRGKHLKKKS 619

Query: 601 FDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           F+LC+DRWWERRDQ+RIEEDK+EELG VGD++E++ ++   +R
Sbjct: 620 FELCEDRWWERRDQIRIEEDKLEELGVVGDVIEKDTSKGASKR 662

>KNAG0E02780 Chr5 complement(559180..561132) [1953 bp, 650 aa] {ON}
           Anc_6.10 YPL263C
          Length = 650

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/579 (53%), Positives = 387/579 (66%), Gaps = 14/579 (2%)

Query: 75  PSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQNXX 134
           P+ R N CLV+N +  K EL+LFGGE TN   + T FYN+L  + P N+QW+K +SQN  
Sbjct: 75  PTPRNNACLVTNAS--KPELLLFGGERTNNETNMTKFYNDLHVYNPQNNQWKKFTSQNSP 132

Query: 135 XXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPASRS 194
                        G+ +L GGEFSSPKQNTFYHY+DTWLLD TT+EW+KLD KNGP++RS
Sbjct: 133 MPRSSAAMCSHQSGVTILFGGEFSSPKQNTFYHYNDTWLLDNTTREWSKLDFKNGPSARS 192

Query: 195 GHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGHSF 254
           GHR+T WKN+FI++GGF+DL   T+Y ND WLF++   KWT+ E   N   PD RSGHS+
Sbjct: 193 GHRITTWKNYFILFGGFKDLNQGTSYFNDVWLFNVVDFKWTKWE-TTNKNQPDPRSGHSW 251

Query: 255 IPDQEGAILWGGYCKVKA--GKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPR 312
           I   EG I++GGYCKVKA   K L KGK LTDCW LKM+   + I+WERR K+G QPSPR
Sbjct: 252 IGSNEGPIVYGGYCKVKAKNNKSLHKGKTLTDCWILKMSQNVNEIKWERRAKKGQQPSPR 311

Query: 313 VGCSMVPHK-GRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRP-QRKKQ 370
           VGCSM  H+  RG+LFGGVYD EETEE L S +YNDL+++ I++NRWY L LR   +   
Sbjct: 312 VGCSMALHRNNRGILFGGVYDLEETEEDLSSIYYNDLYSYNIESNRWYPLKLRKVTQNSN 371

Query: 371 VKISKSS----TKDQEKELQDHLNRILQQAQLYDQDEDK-EDDKAIREQFEDENQSGDED 425
              +KSS    +K+QEKELQD LN+IL+Q  L D++ +         E+   + +  D +
Sbjct: 372 ANRNKSSNNTVSKEQEKELQDLLNKILEQNDLKDEETNSYSGSNTPHEETTTDREQDDNE 431

Query: 426 EEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDLNKVDG 485
           EEE  +       QLPH RFN    V+NDT +IYGG+WE  D DY IDSFY IDLNK+DG
Sbjct: 432 EEEKMRTNLPKLNQLPHERFNACTTVLNDTFYIYGGMWEFKDNDYTIDSFYSIDLNKLDG 491

Query: 486 VTVYWENLAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXXXXXXXXXX 545
           +T Y+ENL EIE+ K+L +  S                      +++             
Sbjct: 492 ITQYYENLQEIEEVKRLGDVQS-EDDFEYEDDDDEDDGEAEPTNERLEAEDDDEEENEED 550

Query: 546 XXXXXMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKSFDLCQ 605
                MEIPDPRPWLPHPKAFESLR FY+R GP+FLEWAISNN+ A+GKHLKQKSF+LCQ
Sbjct: 551 EGIDEMEIPDPRPWLPHPKAFESLREFYIREGPKFLEWAISNNKHAKGKHLKQKSFELCQ 610

Query: 606 DRWWERRDQVRIEEDKMEELGGVGDIVERNP-AQKTKRR 643
           DRWWERRDQ++IEEDK++ELG  GDI+ER+  +  T RR
Sbjct: 611 DRWWERRDQIQIEEDKLQELGVGGDIIERDAQSPPTARR 649

>YPL263C Chr16 complement(44551..46506) [1956 bp, 651 aa] {ON}
           KEL3Cytoplasmic protein of unknown function
          Length = 651

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 287/583 (49%), Positives = 377/583 (64%), Gaps = 18/583 (3%)

Query: 73  DKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQN 132
           +KPS R +P + +NP H K EL +FGGE+T+     THFYN+L++++  N+ W+K  SQN
Sbjct: 74  EKPSCRTHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQN 133

Query: 133 XXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLD---QKNG 189
                          GIALLHGGEFSSPKQ+ FYHYSDTWL DC  +++TKL+   + + 
Sbjct: 134 APLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFTKLEFGGRDSS 193

Query: 190 PASRSGHRMTVWKNFFIMYGGFRDLGTS-TTYLNDCWLFDITTHKWTQVEFPRNHLIPDA 248
           P++RSGHR+  WKN+FI++GGFRDLG   T+YLND W FDI+T+KWT++E    +  PDA
Sbjct: 194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISTYKWTKLE---TNSKPDA 250

Query: 249 RSGHSFIPDQEGAILWGGYCKV--KAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQG 306
           RSGH FIP    AIL GGYCK+  K  K L KGKIL D W L +   P   +WE+ K   
Sbjct: 251 RSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFK 310

Query: 307 FQPSPRVGCSM-VPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRP 365
            QPSPRVG S  +  + + V FGGVYD +ETEESL+S FYNDL+ F ++ N+W  L ++P
Sbjct: 311 NQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKLRIKP 370

Query: 366 QRKKQVKIS-----KSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQ 420
           QR+   K S     + S KDQEKELQD LN IL ++ L D D+D +D+        D+++
Sbjct: 371 QRQTNSKNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDDDDDNDDNSTTGPNSIDDDE 430

Query: 421 SGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDL 480
             ++D +   ++  TIS QLPHPRFN +  VV D+LFIY G+WELG+KDY I+SFY IDL
Sbjct: 431 DNEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVWELGEKDYPINSFYSIDL 490

Query: 481 NKVDGVTVYWENLAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXXXXX 540
           NK+DGV VYWE+L+ IE+AK+L ++ S                         L       
Sbjct: 491 NKLDGVKVYWEDLSAIEEAKRLGDRDSDEDEFEYEDDEEDEDDGEEEQDAGPLEGDEDEE 550

Query: 541 XXXXXXXXXXMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKS 600
                     MEIPD R WLPHPK FE+LRAFY+R G  FL W+ISNNR+ +GK LK KS
Sbjct: 551 SESDDDKQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISNNRNLKGKQLKTKS 610

Query: 601 FDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           F+LC+DRWWERRDQV +EE+++E+ GG   I+ER+   K  +R
Sbjct: 611 FELCEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKPSKR 650

>Suva_16.42 Chr16 complement(60142..62106) [1965 bp, 654 aa] {ON}
           YPL263C (REAL)
          Length = 654

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/586 (48%), Positives = 378/586 (64%), Gaps = 21/586 (3%)

Query: 73  DKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQN 132
           ++PS R++P + +NP H K EL +FGGE+T+     THFYN+L++++  N+ W+K  SQN
Sbjct: 74  ERPSCRVHPLMFANPQHNKHELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSQN 133

Query: 133 XXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLD---QKNG 189
                          GIALLHGGEFSSPKQ+ FYHYSDTWL DC  K++TKL+   + + 
Sbjct: 134 APLPRSSGAVAVHSSGIALLHGGEFSSPKQSKFYHYSDTWLFDCHEKKFTKLEFGGRDSS 193

Query: 190 PASRSGHRMTVWKNFFIMYGGFRDLGTS-TTYLNDCWLFDITTHKWTQVEFPRNHLIPDA 248
           P++RSGHR+  WKN+FI++GGFRDLG+  T+YLND W FDI+ +KWT++E    +  PDA
Sbjct: 194 PSARSGHRIIAWKNYFILFGGFRDLGSGQTSYLNDLWCFDISNYKWTKLE---TNTKPDA 250

Query: 249 RSGHSFIPDQEGAILWGGYCK--VKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQG 306
           RSGH F+P    AIL GGYCK   K  K L KGKIL D W L +   P   +WE+ K   
Sbjct: 251 RSGHCFVPTDNSAILMGGYCKTIAKNNKNLMKGKILNDSWKLTLTPDPKKWQWEKLKNFK 310

Query: 307 FQPSPRVGCSM-VPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRP 365
            QPSPRVG S  +  + + V FGGVYD +ETEESLDS FYNDL+ F ++ N+W  L ++P
Sbjct: 311 NQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLDSIFYNDLYMFHLELNKWSKLRIKP 370

Query: 366 QRKKQVKIS-----KSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQ 420
           QR    + +     + S KDQEKELQD LN IL ++ L D+++D +D  A        N 
Sbjct: 371 QRHTNNRNAPATSKRKSNKDQEKELQDLLNSILAKSNLNDEEDDNDDSTATTTGANSSND 430

Query: 421 SGDEDEEESTKKQH--TISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGI 478
            GD++++   + Q   TIS QLPHPRFN +  VV+D+LFIY G+WELG+KDY I+SFY I
Sbjct: 431 EGDDEDDSDFENQENITISNQLPHPRFNAATCVVDDSLFIYSGVWELGEKDYPINSFYSI 490

Query: 479 DLNKVDGVTVYWENLAEIEKAKKLAEQ-GSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXX 537
           DLNK+DGV VYWE+L+ +E+AK+L ++                          ++L    
Sbjct: 491 DLNKLDGVKVYWEDLSTVEEAKRLGDRDSDEEEFEYEDEDDDEDDDEEEPQDTRLLEDDD 550

Query: 538 XXXXXXXXXXXXXMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLK 597
                        MEIPD R WLPHPK FE+LRAFY+R G  FL W+ISNNR+ +GK LK
Sbjct: 551 DEESEEEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISNNRNLKGKQLK 610

Query: 598 QKSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
            KSF+LC+DRWWERRDQV +EE+++E+ GG   I+ER+   K  +R
Sbjct: 611 TKSFELCEDRWWERRDQVTLEEERLEDTGG---IIERDATAKPSKR 653

>Skud_16.14 Chr16 complement(23637..25595) [1959 bp, 652 aa] {ON}
           YPL263C (REAL)
          Length = 652

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/585 (48%), Positives = 375/585 (64%), Gaps = 21/585 (3%)

Query: 73  DKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQN 132
           ++ S R +P + +NP H K+EL +FGGE+T+     THFYN+L++++  N+ W+K  S+N
Sbjct: 74  ERLSCRTHPLMFANPQHNKRELFIFGGEFTDPETKLTHFYNDLYSYSIKNNSWKKYVSKN 133

Query: 133 XXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLD---QKNG 189
                          GIALLHGGEFSSPKQ+ FYHYSDTWL DC  +++TKL+   + + 
Sbjct: 134 APLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCAERKFTKLEFGGRDSS 193

Query: 190 PASRSGHRMTVWKNFFIMYGGFRDLGTS-TTYLNDCWLFDITTHKWTQVEFPRNHLIPDA 248
           P++RSGHR+  WKN+FI++GGFRDLG   T+YLND W FDI+ +KWT++E    +  P+A
Sbjct: 194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWTKLE---TNTKPEA 250

Query: 249 RSGHSFIPDQEGAILWGGYCKV--KAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQG 306
           RSGH FIP    AIL GGYCK+  K  K L KGKIL D W L +   P   +WE+ K   
Sbjct: 251 RSGHCFIPTDNSAILMGGYCKIIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFK 310

Query: 307 FQPSPRVGCSM-VPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRP 365
            QPSPRVG S  +  + + V FGGVYD +ETEESL+S FYNDL+ F ++ N+W  L ++P
Sbjct: 311 NQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKLRIKP 370

Query: 366 QRKKQVKIS-----KSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQ 420
           QR+   K +     + S KDQEKELQD LN IL ++ L D D+D           + +++
Sbjct: 371 QRQTNNKNAPLTSKRKSNKDQEKELQDLLNSILAKSNLNDDDDDDNTTTG-SNSIDGDDE 429

Query: 421 SGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDL 480
             D+D +    +  TIS QLPHPRFN +  VV+D+LFIY G+WELG+KDY I+SFY IDL
Sbjct: 430 GEDDDSDLDNPENITISNQLPHPRFNAATCVVDDSLFIYSGVWELGEKDYPINSFYSIDL 489

Query: 481 NKVDGVTVYWENLAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQV--LXXXXX 538
           NK+DGV VYWE+L+ IE+AK+L ++ S                        V  L     
Sbjct: 490 NKLDGVNVYWEDLSTIEEAKRLGDRDSDEDDFEYEDDDDDDGEDNDEEEQDVALLEGDED 549

Query: 539 XXXXXXXXXXXXMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQ 598
                       MEIPD R WLPHPK FE+LRAFY+R G  FL W+ISNN+D +GKHLK 
Sbjct: 550 EEGENEDNGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISNNKDLKGKHLKT 609

Query: 599 KSFDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           KSF++C+DRWWERRDQV +EE+++E+ GG   I+ER+   K  +R
Sbjct: 610 KSFEICEDRWWERRDQVTLEEERLEDTGG---IIERDTTTKISKR 651

>Smik_6.471 Chr6 (774663..776618) [1956 bp, 651 aa] {ON} YPL263C
           (REAL)
          Length = 651

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/583 (48%), Positives = 372/583 (63%), Gaps = 18/583 (3%)

Query: 73  DKPSARINPCLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQN 132
           ++PS R +P + +NP H K EL +FGGE+T+     THFYN+L++++  N+ W+K  SQN
Sbjct: 74  ERPSCRTHPLMFANPQHNKHELFIFGGEFTDSETKLTHFYNDLYSYSIKNNSWKKYVSQN 133

Query: 133 XXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLD---QKNG 189
                          GIALLHGGEFSSPKQ+ FYHYSDTWL DC  +++ KL+   + + 
Sbjct: 134 APLPRSSAAVAVHPSGIALLHGGEFSSPKQSKFYHYSDTWLFDCVERKFNKLEFGGRDSS 193

Query: 190 PASRSGHRMTVWKNFFIMYGGFRDLGTS-TTYLNDCWLFDITTHKWTQVEFPRNHLIPDA 248
           P++RSGHR+  WKN+FI++GGFRDLG   T+YLND W FDI+ +KW+++E    +  PDA
Sbjct: 194 PSARSGHRIIAWKNYFILFGGFRDLGNGQTSYLNDLWCFDISNYKWSKIE---TNSKPDA 250

Query: 249 RSGHSFIPDQEGAILWGGYCK--VKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQG 306
           RSGH FIP    AIL GGYCK   K  K L KGKIL D W L +   P   +WE+ K   
Sbjct: 251 RSGHCFIPTDNSAILMGGYCKTIAKNNKNLMKGKILNDAWKLNLTPDPKKWQWEKLKNFK 310

Query: 307 FQPSPRVGCSM-VPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSLSLRP 365
            QPSPRVG S  +  + + V FGGVYD +ETEESL+S FYNDL+ F ++ N+W  L ++ 
Sbjct: 311 NQPSPRVGYSFNLWKQNKSVAFGGVYDLQETEESLESVFYNDLYMFHLELNKWSKLRIKS 370

Query: 366 QRKKQVKIS-----KSSTKDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQ 420
           QR+   + S     + S KDQEKELQD LN IL ++ L D D++ +D  A      D ++
Sbjct: 371 QRQTSNRNSPATSKRKSNKDQEKELQDLLNSILAKSNLNDDDDENDDYTATGSNSIDGDE 430

Query: 421 SGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGLWELGDKDYNIDSFYGIDL 480
             ++D +   ++  TIS QLPHPRFN +  VV D+LFIY G+WELG+KDY I+SFY IDL
Sbjct: 431 DEEDDSDLDNQEDITISNQLPHPRFNAATCVVGDSLFIYSGVWELGEKDYPINSFYSIDL 490

Query: 481 NKVDGVTVYWENLAEIEKAKKLAEQGSXXXXXXXXXXXXXXXXXXXXVRDQVLXXXXXXX 540
           NK+DGV VYWE L+ IE+AK+L ++ S                        +L       
Sbjct: 491 NKLDGVKVYWEELSAIEEAKRLGDRDSDEEEFEYEDEEDDEDQSEEEQDAGLLESDEDEE 550

Query: 541 XXXXXXXXXXMEIPDPRPWLPHPKAFESLRAFYVRAGPQFLEWAISNNRDARGKHLKQKS 600
                     MEIPD R WLPHPK FE+LRAFY+R G  FL W+ISNNR+ +GK LK KS
Sbjct: 551 SDDEDDGQAQMEIPDERSWLPHPKPFETLRAFYLREGANFLTWSISNNRNLKGKQLKTKS 610

Query: 601 FDLCQDRWWERRDQVRIEEDKMEELGGVGDIVERNPAQKTKRR 643
           F+LC+DRWWERRDQV +EE+++E+ GG   I+ER+   K  +R
Sbjct: 611 FELCEDRWWERRDQVTLEEERLEDTGG---IIERDVTTKPSKR 650

>Kpol_1050.69 s1050 complement(150301..153555) [3255 bp, 1084 aa]
           {ON} complement(150301..153555) [3255 nt, 1085 aa]
          Length = 1084

 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/206 (29%), Positives = 85/206 (41%), Gaps = 38/206 (18%)

Query: 168 YSDTWLLDCTTKEWTKLDQK------NGPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTY 220
           Y DTW++ C   + T+   K      N P  R GH  T+  N FI++GG    +      
Sbjct: 178 YGDTWIISCN-PDATQFSSKSVDIGENTPPPRVGHAATLCGNAFIVFGGDTHKVNKEGLM 236

Query: 221 LNDCWLFDITTHKWTQVE--FPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAGKGLQK 278
            +D +LF+I ++KWT      PR    P  R GH         IL     K K       
Sbjct: 237 DDDIYLFNINSYKWTIPNPIGPR----PLGRYGHKI------CILATSTVKTKL---YLF 283

Query: 279 GKILTDCWY--LKMNSTPSAIR----WERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYD 332
           G    D ++  L +    S  R    WE  K +GF P P    +MV +     ++GG   
Sbjct: 284 GGQFDDTYFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPPLTNHTMVTYGSDLWIYGG--- 340

Query: 333 FEETEESLDSNFYNDLFTFQIKTNRW 358
             +T++ L     ND+F F   TN W
Sbjct: 341 --DTQQGL----INDIFKFSPNTNTW 360

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/191 (23%), Positives = 80/191 (41%), Gaps = 22/191 (11%)

Query: 82  CLVSNPAHGKKELILFGGEYTNQSNSTTHFYN----ELFTFTPDNDQWRKISSQNXXXXX 137
           C+++  +  K +L LFGG++ +     T+F +    +L +F   +  W  I S+      
Sbjct: 269 CILAT-STVKTKLYLFGGQFDD-----TYFNDLAVFDLSSFRRQDSHWEFIKSKGFMPPP 322

Query: 138 XXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQK-NGPASRSGH 196
                         ++GG+      N  + +S        T  WTK++     P     H
Sbjct: 323 LTNHTMVTYGSDLWIYGGDTQQGLINDIFKFS------PNTNTWTKVETTGTKPPPMQEH 376

Query: 197 RMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGHSF-I 255
              V+KN   + GG  +   +  YLN  +LF+  + KW      ++ +I   RSGHS  +
Sbjct: 377 AAVVYKNIMCVVGGKDE---NDMYLNSVYLFNFDSSKWYTFPDFKSGII-QGRSGHSVTL 432

Query: 256 PDQEGAILWGG 266
            + +  ++ GG
Sbjct: 433 LNNDKLLIMGG 443

 Score = 32.3 bits (72), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 45/109 (41%), Gaps = 9/109 (8%)

Query: 111 FYNELFTFTPDNDQWRKISSQNXXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSD 170
             N++F F+P+ + W K+ +                  I  + GG+     +N  Y  S 
Sbjct: 346 LINDIFKFSPNTNTWTKVETTGTKPPPMQEHAAVVYKNIMCVVGGK----DENDMYLNS- 400

Query: 171 TWLLDCTTKEW-TKLDQKNGPA-SRSGHRMTVWKN--FFIMYGGFRDLG 215
            +L +  + +W T  D K+G    RSGH +T+  N    IM G   D  
Sbjct: 401 VYLFNFDSSKWYTFPDFKSGIIQGRSGHSVTLLNNDKLLIMGGDKYDFA 449

>KAFR0B04320 Chr2 complement(893930..896890) [2961 bp, 986 aa] {ON}
           Anc_5.88 YGR238C
          Length = 986

 Score = 55.8 bits (133), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 55/206 (26%), Positives = 82/206 (39%), Gaps = 32/206 (15%)

Query: 168 YSDTWLLDCTTKEWTKLDQK-----NGPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTYL 221
           Y DTW+L         + Q      N P  R GH  T+  N FI++GG    +       
Sbjct: 173 YGDTWILTSENNASRFISQTVDISDNTPPPRVGHAATLCGNAFIIFGGDTHKVNKDGLMD 232

Query: 222 NDCWLFDITTHKWT--QVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVK--AGKGLQ 277
           +D +LF+I +HKWT      PR    P  R GH        +I+     K +     G  
Sbjct: 233 DDLYLFNINSHKWTIPNPVGPR----PLGRYGHKI------SIIATANSKTRLYLFGGQF 282

Query: 278 KGKILTDCWYLKMNS--TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEE 335
                 D     ++S   P + RWE  K + F P P    +MV +  +  +FGG     +
Sbjct: 283 DDAYFNDLVVFDLSSFRRPDS-RWEFVKPKSFVPPPLTNHTMVSYDNKLWVFGG-----D 336

Query: 336 TEESLDSNFYNDLFTFQIKTNRWYSL 361
           T + L     N +F +    N W ++
Sbjct: 337 TLQGL----TNRVFMYDPMINDWTTI 358

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 86/214 (40%), Gaps = 33/214 (15%)

Query: 88  AHGKKELILFGGEYTNQSNSTTHFYNELFTFT------PDNDQWRKISSQNXXXXXXXXX 141
           A+ K  L LFGG++ +       ++N+L  F       PD+ +W  +  ++         
Sbjct: 269 ANSKTRLYLFGGQFDDA------YFNDLVVFDLSSFRRPDS-RWEFVKPKSFVPPPLTNH 321

Query: 142 XXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNGPASRSGHRMTVW 201
                     + GG+      N  + Y D  + D TT E +  +  N       H   V+
Sbjct: 322 TMVSYDNKLWVFGGDTLQGLTNRVFMY-DPMINDWTTIETSSDNPNNIAPPMQEHAAIVY 380

Query: 202 KNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEF--PRNHLIPDARSGHSF-IPDQ 258
           K+   ++GG  +     TYLN  +  ++ T KW ++    P    IP  RSGHS  +   
Sbjct: 381 KDLMCIFGGKDE---QDTYLNGVYFLNLRTLKWYKLPIFAPG---IPQGRSGHSITLLKN 434

Query: 259 EGAILWGG----YCKV------KAGKGLQKGKIL 282
           +  ++ GG    Y +V       +   + KG IL
Sbjct: 435 DKLLIMGGDKFDYARVDNFDLHTSETNMGKGTIL 468

>CAGL0F07997g Chr6 complement(785803..788613) [2811 bp, 936 aa] {ON}
           weakly similar to uniprot|P50090 Saccharomyces
           cerevisiae YGR238c KEL2 or uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1
          Length = 936

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 82/350 (23%), Positives = 133/350 (38%), Gaps = 71/350 (20%)

Query: 168 YSDTWLL----DCTTKEWTKLD-QKNGPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTYL 221
           Y DTW+L    D T      +D   N P  R GH  T+  N  +++GG    L +     
Sbjct: 201 YGDTWMLTANSDSTNFTTQVIDLTVNTPPPRVGHAATLCGNALVIFGGDTHKLNSEGLLD 260

Query: 222 NDCWLFDITTHKWTQVEFPRNHLIPDARSGH-----SFIPDQEGAILWGGYCKVKAGKGL 276
           +D +LF++ +H+WT +  P     P  R GH     +  P +    L+GG         L
Sbjct: 261 DDLYLFNVDSHRWT-IPTPIGTR-PLGRYGHQVSVIATTPKKAKLYLFGGQLDDNYFNDL 318

Query: 277 QKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEET 336
                    + L     P + RW+  K + F P P    +MV +  +  +FGG       
Sbjct: 319 A-------MYDLSDFRNPHS-RWQFLKSKAFTPPPLTNHTMVAYDYKLWVFGG------- 363

Query: 337 EESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVKISKSSTKDQEKELQDHLNRILQQA 396
             S      N L+ +    N W  L               +  D+ + +Q+H   I +  
Sbjct: 364 --SSRGELQNQLYVYIPDLNEWRCL--------------ETEGDKPQPIQEHSATIYKNL 407

Query: 397 QLYDQDEDKEDDKAIREQFEDENQSGDEDEEESTKKQHTISTQL---PHPRFNTSLAVV- 452
                 ++K+D+      F +            T K + + T     P PR   S++++ 
Sbjct: 408 MCVFGGKNKDDEYQNTMYFLN----------LQTLKWYRLDTSHCNEPLPRSGQSMSLMQ 457

Query: 453 NDTLFIYGGLWELGDKDYNIDSFYGIDLNKVD------GVTVYWENLAEI 496
           ND + I GG       DY ++   G +LN +D      GV  Y  +L  +
Sbjct: 458 NDKILIMGG----DKNDYCVN---GANLNDIDEYDRGYGVASYTLDLKNL 500

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 58/138 (42%), Gaps = 17/138 (12%)

Query: 96  LFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQNXXXXXXXXXXXXXXXGIALLHGG 155
           +FGG      +S     N+L+ + PD ++WR + ++                 +  + GG
Sbjct: 360 VFGG------SSRGELQNQLYVYIPDLNEWRCLETEGDKPQPIQEHSATIYKNLMCVFGG 413

Query: 156 EFSSPK-QNTFYHYSDTWLLDCTTKEWTKLDQK--NGPASRSGHRMTVWKN--FFIMYGG 210
           +    + QNT Y       L+  T +W +LD    N P  RSG  M++ +N    IM G 
Sbjct: 414 KNKDDEYQNTMY------FLNLQTLKWYRLDTSHCNEPLPRSGQSMSLMQNDKILIMGGD 467

Query: 211 FRDLGTSTTYLNDCWLFD 228
             D   +   LND   +D
Sbjct: 468 KNDYCVNGANLNDIDEYD 485

>KLLA0E15511g Chr5 (1388626..1391343) [2718 bp, 905 aa] {ON} similar
           to uniprot|P50090 Saccharomyces cerevisiae YGR238C KEL2
           Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate AND similar to YHR158C
           uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 905

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 80/202 (39%), Gaps = 30/202 (14%)

Query: 168 YSDTWL---LDCTT--KEWTKLDQKNGPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTYL 221
           Y DTW+   LD  T  K  T       P  R GH  T+  N F+++GG    +  +    
Sbjct: 132 YGDTWIIKSLDNATSFKSITVPIADATPPPRVGHASTLCGNAFVIFGGDTHKVNDAGLMD 191

Query: 222 NDCWLFDITTHKWT--QVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVK--AGKGLQ 277
           +D +LF+I +HKWT    + PR    P  R GH        +I+     K K     G  
Sbjct: 192 DDIYLFNINSHKWTIPTPQGPR----PLGRYGHKI------SIIAANQMKTKLYVFGGQF 241

Query: 278 KGKILTDCWYLKMNS-TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEET 336
                 D     ++S   S   WE  K   F P P    +M+    +  +FGG     +T
Sbjct: 242 DDTYFNDLAEFDLSSFRRSDSHWEFIKPATFMPPPLANHTMISFDHKLWVFGG-----DT 296

Query: 337 EESLDSNFYNDLFTFQIKTNRW 358
            + L     N++F F    N W
Sbjct: 297 PQGL----TNEVFMFDPAANDW 314

>CAGL0I02090g Chr9 complement(177324..180734) [3411 bp, 1136 aa]
           {ON} some similarities with uniprot|P38853 Saccharomyces
           cerevisiae YHR158c KEL1 involved in cell fusion and
           morphology
          Length = 1136

 Score = 51.6 bits (122), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 49/207 (23%), Positives = 82/207 (39%), Gaps = 36/207 (17%)

Query: 168 YSDTWLLDCTT----------KEWTKLDQKNGPASRSGHRMTVWKNFFIMYGG-FRDLGT 216
           Y DTW+L  +           K  T    ++ P  R GH  T+  N F+++GG    + +
Sbjct: 186 YGDTWILTASDIDKTGAINSFKSTTIEITESTPPPRVGHASTLCGNAFVVFGGDTHKVNS 245

Query: 217 STTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGHSFI---PDQEGAILWGGYCKVKAG 273
                +D +L +I ++KWT +  P     P  R GH  +    +Q    L+GG       
Sbjct: 246 DGLMDDDLYLLNINSYKWT-IPKPVGQR-PLGRYGHKIVTISAEQTKLYLFGGQFD---- 299

Query: 274 KGLQKGKILTDCWYLKMNS--TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVY 331
                     D     ++S   P +  W   K  GF P P    +MV ++ +  +FGG  
Sbjct: 300 -----DTYFGDLAVFDLSSFRRPDS-HWVFLKPSGFNPPPLTNHTMVTYQDKIWVFGG-- 351

Query: 332 DFEETEESLDSNFYNDLFTFQIKTNRW 358
                 ++L+    N ++ +    N W
Sbjct: 352 ------DTLEEGLINRVYLYSPTNNSW 372

>NCAS0F00520 Chr6 (100048..103308) [3261 bp, 1086 aa] {ON} Anc_5.88
           YGR238C
          Length = 1086

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 55/207 (26%), Positives = 84/207 (40%), Gaps = 38/207 (18%)

Query: 168 YSDTWLLDCTTKEWTKL-------DQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTY 220
           Y DTW+L C   + + +         +  P  R GH  T+  N F+++GG          
Sbjct: 170 YGDTWVLTCEDPQTSTMFSSRTVDITETTPPPRVGHASTLCGNAFVIFGGDTHKKNEMGE 229

Query: 221 L-NDCWLFDITTHKWTQVEFPRNHLI---PDARSGH--SFIPD---QEGAILWGGYCKVK 271
           + +D +LF+I ++KWT    P  H I   P  R GH  S I     Q    L+GG     
Sbjct: 230 MDDDIYLFNINSYKWT---IP--HPIGPRPKGRYGHKISIIARKQMQTKLYLFGGQFDDN 284

Query: 272 AGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVY 331
               L    ++ D    + + +     WE  K + F P P    +MV +  +  +FGG  
Sbjct: 285 YFNDL----VVFDLSSFRRDDS----HWEFIKPRSFIPPPITNHTMVSYDFKLWVFGG-- 334

Query: 332 DFEETEESLDSNFYNDLFTFQIKTNRW 358
              +T E L     N +F +    N W
Sbjct: 335 ---DTLEGL----LNQVFMYDPAVNDW 354

>TPHA0A05170 Chr1 complement(1161610..1164660) [3051 bp, 1016 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1016

 Score = 51.2 bits (121), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 79/197 (40%), Gaps = 34/197 (17%)

Query: 168 YSDTWLLDCT-------TKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGG-FRDLGTSTT 219
           Y DTW +  T       +K    LD    P  R GH  T+  N F+++GG    +     
Sbjct: 181 YGDTWSITSTNNGTQFISKALEILDL--SPPPRVGHASTLCGNAFVVFGGDTHKVNKDGL 238

Query: 220 YLNDCWLFDITTHKWT--QVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVK--AGKG 275
             +D +LF+I +HKWT      PR    P  R GH        +I+     K K     G
Sbjct: 239 MDDDIYLFNINSHKWTIPSPVGPR----PLGRYGHKI------SIIATSSSKTKLYLFGG 288

Query: 276 LQKGKILTDCWYLKMNSTPSA-IRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFE 334
                   D     ++S   A   WE  K +G  P P    +MV +  +  +FGG     
Sbjct: 289 QFDDTYFNDIAVFDLSSFRRADSHWEFIKPKGLIPPPMTNHTMVTYDNKLWVFGG----- 343

Query: 335 ETEESLDSNFYNDLFTF 351
           +T++ L     ND++ F
Sbjct: 344 DTKDGL----INDIYAF 356

>SAKL0H02618g Chr8 (259684..262941) [3258 bp, 1085 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1085

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/204 (26%), Positives = 79/204 (38%), Gaps = 34/204 (16%)

Query: 168 YSDTWLLDCTTKEWTKLDQKN------GPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTY 220
           Y DTW+L       T+   K        P  R GH  T+  N F+++GG    +      
Sbjct: 112 YGDTWILTAHANN-TRFTSKTVDISDTTPPPRVGHASTLCGNAFVIFGGDTHKVNNEGLM 170

Query: 221 LNDCWLFDITTHKWT--QVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKA---GKG 275
            +D +LF+I ++KWT      PR    P  R GH        +++     K K    G  
Sbjct: 171 DDDVYLFNINSYKWTIPHPVGPR----PLGRYGHKI------SVIATSQMKTKLYVFGGQ 220

Query: 276 LQKGKILTDCWY-LKMNSTPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFE 334
                    C Y L     P +  WE  K Q F P P    +MV +  +  +FGG     
Sbjct: 221 FDDTYFNDLCVYDLSSFRRPDS-HWEFLKPQSFVPPPLTNHTMVSYDYKLWIFGG----- 274

Query: 335 ETEESLDSNFYNDLFTFQIKTNRW 358
           +T + L     N++F +    N W
Sbjct: 275 DTAQGL----INEVFMYDPTVNDW 294

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 5/84 (5%)

Query: 170 DTWLLDCTTKEWTKLDQKNG-PASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFD 228
           + ++ D T  +WT ++     P +   H   V+K+   + GG  +     +Y ND +  +
Sbjct: 283 EVFMYDPTVNDWTVVETTGSKPPAIQEHAAVVYKDLMCVTGGKDE---QDSYSNDVYFLN 339

Query: 229 ITTHKWTQVEFPRNHLIPDARSGH 252
           + + KW ++ F +N  +P  RSGH
Sbjct: 340 LKSFKWFKLPFFKNG-VPQGRSGH 362

>Skud_8.222 Chr8 complement(385114..388623) [3510 bp, 1169 aa] {ON}
           YHR158C (REAL)
          Length = 1169

 Score = 50.8 bits (120), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 83/202 (41%), Gaps = 28/202 (13%)

Query: 168 YSDTWLL---DCTTK-EWTKLD-QKNGPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTYL 221
           Y DTW+L   D  TK   T +D  +  P  R GH   +  N F+++GG    +       
Sbjct: 152 YGDTWILTALDNATKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD 211

Query: 222 NDCWLFDITTHKWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVK--AGKGLQKG 279
           +D +L +I ++KWT V  P     P  R GH        +I+     K K     G    
Sbjct: 212 DDIYLLNINSYKWT-VPAPVGPR-PLGRYGHKI------SIIATTQMKTKLYVFGGQFDD 263

Query: 280 KILTDCWYLKMNS--TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETE 337
               D     ++S   P +  WE  K + F P P    +M+ +  +  +FGG     +T 
Sbjct: 264 TYFNDLAVYDLSSFRRPDS-HWEFLKPKAFTPPPITNFTMISYDSKLWVFGG-----DTL 317

Query: 338 ESLDSNFYNDLFTFQIKTNRWY 359
           + L     ND+F +    N W+
Sbjct: 318 QGL----INDVFMYDPAINDWF 335

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 53/126 (42%), Gaps = 16/126 (12%)

Query: 169 SDTWLLDCTTKEWTKLDQK-NGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLF 227
           +D ++ D    +W  ++     P     H   V+ +   + GG  +      YLN  +  
Sbjct: 322 NDVFMYDPAINDWFIIETTGEKPPPVQEHASVVYNDLMCVVGGKDE---HDAYLNSVYFL 378

Query: 228 DITTHKWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGG-----YCKVK------AGKGL 276
           ++ +HKW ++       IP  RSGHS    ++  IL  G     Y +V+      +   L
Sbjct: 379 NLKSHKWFKLPV-FTAGIPQGRSGHSLTLLKDDKILIMGGDKFDYARVEEFDLHTSDIDL 437

Query: 277 QKGKIL 282
           Q+G I+
Sbjct: 438 QRGTIV 443

>KNAG0K00560 Chr11 complement(96678..99992) [3315 bp, 1104 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1104

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/216 (25%), Positives = 87/216 (40%), Gaps = 34/216 (15%)

Query: 168 YSDTWLL----DCTTKEWTKLD-QKNGPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTYL 221
           + D W++    + T    T +D  +N P  R GH  T+  N F+++GG    +       
Sbjct: 236 FGDVWIIKSLENGTKFTSTTIDITENTPPPRVGHAATLCGNAFVVFGGDTHKVNKDGLMD 295

Query: 222 NDCWLFDITTHKWTQVE--FPRNHLIPDARSGH-----SFIPDQEGAILWGGYCKVKAGK 274
           +D +LF+I ++KWT      PR    P  R GH     +  P +    L+GG        
Sbjct: 296 DDLYLFNINSYKWTIPNPIGPR----PLGRYGHKVSIIATTPMKTKLYLFGGQFDDTYFN 351

Query: 275 GLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFE 334
            L         + L     P +  WE  K + F P P    +MV ++ +  +FGG     
Sbjct: 352 NLA-------VFDLSQFRRPDS-HWEFLKPKSFMPPPLTNHTMVSYQNKLWIFGG----- 398

Query: 335 ETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQ 370
           +T + L     N +F +  + N W  +   P    Q
Sbjct: 399 DTLQGL----INKIFMYDPEVNDWTVVETFPANNDQ 430

>Smik_8.242 Chr8 complement(390631..394137) [3507 bp, 1168 aa] {ON}
           YHR158C (REAL)
          Length = 1168

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 54/202 (26%), Positives = 83/202 (41%), Gaps = 28/202 (13%)

Query: 168 YSDTWLL---DCTTK-EWTKLD-QKNGPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTYL 221
           Y DTW+L   D  TK   T +D  +  P  R GH   +  N F+++GG    +       
Sbjct: 152 YGDTWILTAFDNATKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD 211

Query: 222 NDCWLFDITTHKWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVK--AGKGLQKG 279
           +D +L +I ++KWT V  P     P  R GH        +I+     K K     G    
Sbjct: 212 DDIYLLNINSYKWT-VPAPVGPR-PLGRYGHKI------SIIATNQMKTKLYVFGGQFDD 263

Query: 280 KILTDCWYLKMNS--TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETE 337
               D     ++S   P +  WE  K + F P P    +M+ +  +  +FGG     +T 
Sbjct: 264 TYFNDLAVYDLSSFRRPDS-HWEFLKPKTFSPPPITNFTMISYDSKLWVFGG-----DTL 317

Query: 338 ESLDSNFYNDLFTFQIKTNRWY 359
           + L     ND+F +    N W+
Sbjct: 318 QGL----VNDVFMYDPALNDWF 335

>TDEL0G01120 Chr7 (229805..232834) [3030 bp, 1009 aa] {ON} Anc_5.88
           YGR238C
          Length = 1009

 Score = 50.4 bits (119), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 81/203 (39%), Gaps = 32/203 (15%)

Query: 168 YSDTWLLDCTTKEWTKLDQKN------GPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTY 220
           Y DTW+++      T+   K        P  R GH  T+  N F+++GG    + +    
Sbjct: 133 YGDTWIINVD-DSGTQFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKVNSEGLM 191

Query: 221 LNDCWLFDITTHKWT--QVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAG--KGL 276
            +D +LF+I + KWT      PR    P  R GH        +I+     K K     G 
Sbjct: 192 DDDLYLFNINSFKWTIPHPVGPR----PLGRYGHKI------SIIATNQMKTKLYLFGGQ 241

Query: 277 QKGKILTDCWYLKMNS-TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEE 335
                  D     ++S   S   WE  K + F P P    +MV +  +  +FGG     +
Sbjct: 242 FDDTFFNDLAVYDLSSFRRSDSHWEFLKPKTFVPPPLANHTMVSYDHKLWIFGG-----D 296

Query: 336 TEESLDSNFYNDLFTFQIKTNRW 358
           T + L     N +F + I +N W
Sbjct: 297 TMQGL----INKVFVYDIMSNDW 315

 Score = 35.0 bits (79), Expect = 0.73,   Method: Compositional matrix adjust.
 Identities = 28/114 (24%), Positives = 49/114 (42%), Gaps = 7/114 (6%)

Query: 275 GLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFE 334
           GL    +  D W + ++ + +    +      F P PRVG +        V+FGG     
Sbjct: 126 GLHDESVYGDTWIINVDDSGTQFSSKTVDISEFTPPPRVGHAATLCGNAFVIFGGDTHKV 185

Query: 335 ETEESLDSNFYNDLFTFQIKTNRW---YSLSLRPQRKKQVKISKSSTKDQEKEL 385
            +E  +D    +DL+ F I + +W   + +  RP  +   KIS  +T   + +L
Sbjct: 186 NSEGLMD----DDLYLFNINSFKWTIPHPVGPRPLGRYGHKISIIATNQMKTKL 235

>Suva_15.357 Chr15 complement(617637..618952,619001..621203) [3519
           bp, 1172 aa] {ON} YHR158C (REAL)
          Length = 1172

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/204 (25%), Positives = 83/204 (40%), Gaps = 28/204 (13%)

Query: 168 YSDTWLL----DCTTKEWTKLD-QKNGPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTYL 221
           Y DTW+L    D T    T +D  +  P  R GH   +  N F+++GG    +       
Sbjct: 152 YGDTWILSAFDDATKFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNREGLMD 211

Query: 222 NDCWLFDITTHKWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVK--AGKGLQKG 279
           +D +L ++ ++KWT V  P     P  R GH        +I+     K K     G    
Sbjct: 212 DDIYLLNVNSYKWT-VPAPVGPR-PLGRYGHKI------SIIATTQMKTKLYVFGGQFDD 263

Query: 280 KILTDCWYLKMNS--TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETE 337
               D     ++S   P +  W+  K   F P P    +M+ +  +  +FGG     +T 
Sbjct: 264 TYFNDLAVYDLSSFRRPDS-HWDFLKPMTFTPPPMTNFTMISYDSKLWVFGG-----DTL 317

Query: 338 ESLDSNFYNDLFTFQIKTNRWYSL 361
           + L     ND+F +    N W+++
Sbjct: 318 QGL----INDVFMYDPAKNDWFTI 337

 Score = 38.5 bits (88), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 24/100 (24%), Positives = 43/100 (43%), Gaps = 6/100 (6%)

Query: 169 SDTWLLDCTTKEWTKLDQK-NGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLF 227
           +D ++ D    +W  ++     P     H   V+ +   + GG  +      YLN  +  
Sbjct: 322 NDVFMYDPAKNDWFTIETSGEKPPPVQEHATVVYNDLMCVVGGKDE---HDAYLNTVYFL 378

Query: 228 DITTHKWTQVEFPRNHLIPDARSGHSF-IPDQEGAILWGG 266
           ++ THKW ++       IP  RSGHS  +   +  ++ GG
Sbjct: 379 NLKTHKWFKLPIFAAG-IPQGRSGHSLTLLKNDKVLIMGG 417

>ZYRO0B08228g Chr2 (641988..645869) [3882 bp, 1293 aa] {ON} similar
           to uniprot|Q75AR9 Ashbya gossypii ADL149W ADL149Wp and
           some similarites with YHR158C uniprot|P38853
           Saccharomyces cerevisiae YHR158C KEL1 Protein required
           for proper cell fusion and cell morphology functions in
           a complex with Kel2p to negatively regulate mitotic exit
           interacts with Tem1p and Lte1p localizes to regions of
           polarized growth potential Cdc28p substrate
          Length = 1293

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 81/205 (39%), Gaps = 36/205 (17%)

Query: 168 YSDTWLLDCTTKEWTKLDQKN------GPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTY 220
           Y DTW++  T    T+   K        P  R GH  T+  N F+++GG    + +    
Sbjct: 180 YGDTWII-STNDNGTQFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKVNSEGLM 238

Query: 221 LNDCWLFDITTHKWTQVEFPRNHLI---PDARSGHSFIPDQEGAILWGGYCKVKAG--KG 275
            +D +LF++ ++KWT    P  H I   P  R GH        +I+     K K     G
Sbjct: 239 DDDLYLFNVNSYKWT---IP--HPIGPRPLGRYGHKI------SIMAANQMKTKLYLFGG 287

Query: 276 LQKGKILTDCWYLKMNS--TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDF 333
                   D     ++S   P +  WE  K   F P P    +M+ +     +FGG    
Sbjct: 288 QFDDTYFNDLAVFDLSSFRRPDS-HWEFLKPTTFSPPPLTNHTMISYDNHLWVFGG---- 342

Query: 334 EETEESLDSNFYNDLFTFQIKTNRW 358
            +T + L     N +F + +  N W
Sbjct: 343 -DTLQGL----INQVFKYDVANNDW 362

 Score = 33.9 bits (76), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 43/103 (41%), Gaps = 7/103 (6%)

Query: 275 GLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFE 334
           GL    +  D W +  N   +  + +  +     P PRVG +        VLFGG     
Sbjct: 173 GLHDQSVYGDTWIISTNDNGTQFQSKTVEISETTPPPRVGHAATLCGNAFVLFGGDTHKV 232

Query: 335 ETEESLDSNFYNDLFTFQIKTNRW---YSLSLRPQRKKQVKIS 374
            +E  +D    +DL+ F + + +W   + +  RP  +   KIS
Sbjct: 233 NSEGLMD----DDLYLFNVNSYKWTIPHPIGPRPLGRYGHKIS 271

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 2/49 (4%)

Query: 219 TYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGHSF-IPDQEGAILWGG 266
           TYLN  +  ++ TH+W ++   +   IP  RSGHS  + + +  ++ GG
Sbjct: 398 TYLNSVYFLNLKTHEWFKLPTFKAG-IPQGRSGHSLTLLNNDKLLIMGG 445

>YHR158C Chr8 complement(413685..417179) [3495 bp, 1164 aa] {ON}
           KEL1Protein required for proper cell fusion and cell
           morphology; functions in a complex with Kel2p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 1164

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 83/204 (40%), Gaps = 28/204 (13%)

Query: 168 YSDTWLL----DCTTKEWTKLD-QKNGPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTYL 221
           Y DTW+L    + T    T +D  +  P  R GH   +  N F+++GG    +       
Sbjct: 152 YGDTWILTAFDNATRFSTTTIDISEATPPPRVGHAAVLCGNAFVVFGGDTHKVNKEGLMD 211

Query: 222 NDCWLFDITTHKWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVK--AGKGLQKG 279
           +D +L +I ++KWT V  P     P  R GH        +I+     K K     G    
Sbjct: 212 DDIYLLNINSYKWT-VPAPVGPR-PLGRYGHKI------SIIATTQMKTKLYVFGGQFDD 263

Query: 280 KILTDCWYLKMNS--TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETE 337
               D     ++S   P +  WE  K + F P P    +M+ +  +  +FGG     +T 
Sbjct: 264 TYFNDLAVYDLSSFRRPDS-HWEFLKPRTFTPPPITNFTMISYDSKLWVFGG-----DTL 317

Query: 338 ESLDSNFYNDLFTFQIKTNRWYSL 361
           + L     ND+F +    N W+ +
Sbjct: 318 QGL----VNDVFMYDPAINDWFII 337

>TPHA0H01080 Chr8 complement(232804..235290) [2487 bp, 828 aa] {ON}
           Anc_5.88 YGR238C
          Length = 828

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 72/174 (41%), Gaps = 21/174 (12%)

Query: 190 PASRSGHRMTVWKNFFIMYGG-FRDLGTSTTYLND-CWLFDITTHKWTQVEFPRNHLIPD 247
           P  R GH  T+  N  I++GG    +  S   ++D  +  ++ T KWT +  P+  + P 
Sbjct: 95  PPPRVGHAATLCGNALIVFGGDTHKVNVSNGLMDDDLYFLNLDTTKWT-IPSPKG-IRPL 152

Query: 248 ARSGHSFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGF 307
            R GH          L+GG         L K  +L    +   NS     +WE  K +GF
Sbjct: 153 GRYGHKISVINSNLYLFGGQFDETYFNDLVKFDLLN---FKDANS-----QWEFIKPKGF 204

Query: 308 QPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRWYSL 361
            P P    SM   + +  +FGG     +T + L     N+ F +  + N W  L
Sbjct: 205 IPPPLSNFSMCTFENKLYVFGG-----DTYQVLT----NETFVYDPELNEWSIL 249

>TBLA0C06530 Chr3 complement(1577728..1581246) [3519 bp, 1172 aa]
           {ON} Anc_5.88 YGR238C
          Length = 1172

 Score = 48.9 bits (115), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 50/176 (28%), Positives = 71/176 (40%), Gaps = 27/176 (15%)

Query: 190 PASRSGHRMTVWKNFFIMYGGFRDLGTSTTYL-NDCWLFDITTHKWT--QVEFPRNHLIP 246
           P  R GH  T+  N F+++GG          + +D +LF+I ++KWT  Q   PR    P
Sbjct: 140 PPPRVGHASTLCGNAFVIFGGDTHKTNKDGLMDDDIYLFNINSYKWTIPQPVGPR----P 195

Query: 247 DARSGHSFIPDQEGAILWGGYCKVKA---GKGLQKGKILTDCWY-LKMNSTPSAIRWERR 302
             R GH        +I+     K K    G           C Y L     P +  WE  
Sbjct: 196 LGRYGHKI------SIIATSQMKTKLYVFGGQFDDSYFNDLCVYDLSSFRKPES-HWEFL 248

Query: 303 KKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRW 358
           K + F P P    +MV +  +  +FGG     +T++ L     N LF F    N W
Sbjct: 249 KPKSFIPPPLTNHTMVSYDYKLWVFGG-----DTQQGL----INQLFMFDPVINDW 295

 Score = 34.7 bits (78), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 36/141 (25%), Positives = 58/141 (41%), Gaps = 16/141 (11%)

Query: 74  KPSARINPCLVSNPAHGKK-ELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQN 132
           KP + I P L ++       +L +FGG+ T Q        N+LF F P  + WR + +  
Sbjct: 249 KPKSFIPPPLTNHTMVSYDYKLWVFGGD-TQQG-----LINQLFMFDPVINDWRVVETTG 302

Query: 133 XXXXXXXXXXXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLD--QKNGP 190
                           +  + GG     K     + +  + L+  + +W K +  + N P
Sbjct: 303 EKPPPVQEHAAVMFNDLMCIMGG-----KDEQDVYLNSVYFLNLKSLKWFKFNDYKLNIP 357

Query: 191 ASRSGHRMTVWKN--FFIMYG 209
             RSGH +T+ KN    IM G
Sbjct: 358 QGRSGHSITLLKNNRLLIMGG 378

>KLTH0C01474g Chr3 (131243..134413) [3171 bp, 1056 aa] {ON} similar
           to uniprot|P38853 Saccharomyces cerevisiae YHR158C KEL1
           Protein required for proper cell fusion and cell
           morphology functions in a complex with Kel2p to
           negatively regulate mitotic exit interacts with Tem1p
           and Lte1p localizes to regions of polarized growth
           potential Cdc28p substrate
          Length = 1056

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 81/203 (39%), Gaps = 32/203 (15%)

Query: 168 YSDTWLLDCTTKEWTKLDQKN------GPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTY 220
           Y DTW++       +K   K        P  R GH  T+  N F+++GG    + +    
Sbjct: 117 YGDTWIISAHDN-GSKFSSKTVDITDTTPPPRVGHASTLCGNAFVIFGGDTHKVNSDGLM 175

Query: 221 LNDCWLFDITTHKWTQVEFPRN-HLIPDARSGHSFIPDQEGAILWGGYCKVK--AGKGLQ 277
            +D +LF+I ++KWT    PR     P  R GH        +I+     + K     G  
Sbjct: 176 DDDVYLFNINSYKWT---IPRPVGPRPLGRYGHKI------SIIATSQMRTKLYVFGGQF 226

Query: 278 KGKILTDCWYLKMNS--TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEE 335
                 D     ++S   P +  W+  K   F P P    +M+ +  +  +FGG     +
Sbjct: 227 DDTYFNDLTVFDLSSFRRPDS-HWQFIKPNTFTPPPLTNHTMISYDYKLWVFGG-----D 280

Query: 336 TEESLDSNFYNDLFTFQIKTNRW 358
           T + L     ND+F F  + N W
Sbjct: 281 TPQGL----INDVFMFDPQINDW 299

>NDAI0D02600 Chr4 complement(600880..604383) [3504 bp, 1167 aa] {ON}
           Anc_5.88 YGR238C
          Length = 1167

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 46/174 (26%), Positives = 72/174 (41%), Gaps = 21/174 (12%)

Query: 168 YSDTWLLD------CTTKEWTKLD-QKNGPASRSGHRMTVWKNFFIMYGG-FRDLGTSTT 219
           Y DTW+L        TT     +D  +N P  R GH  T+  N F+++GG    +    +
Sbjct: 199 YGDTWILSYENNGLSTTITSKTVDISENTPPPRVGHAATLCGNAFVIFGGDTHKVNKDGS 258

Query: 220 YLNDCWLFDITTHKWTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAG--KGLQ 277
             +D +LF+I ++KWT +  P     P  R GH        +I+     K K     G  
Sbjct: 259 MDDDIYLFNINSYKWT-IPKPVGQR-PLGRYGHKI------SIIATSQMKTKLYLFGGQF 310

Query: 278 KGKILTDCWYLKMNS--TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGG 329
                 D     ++S   P +  WE  + + F P P    +M  +  +  +FGG
Sbjct: 311 DDTYFNDLVVFDLSSFRRPDS-HWEFIRPKSFIPPPLTNHTMCSYDHKLWVFGG 363

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 25/82 (30%), Positives = 38/82 (46%), Gaps = 4/82 (4%)

Query: 185 DQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHL 244
           D  N P     H   ++K+   + GG  +   S  YLND +  ++ T KW ++ F +   
Sbjct: 394 DVSNIPPPIQEHAAVLYKDLMCVIGGKDE---SDNYLNDVYFLNLKTLKWFKLPFYKEG- 449

Query: 245 IPDARSGHSFIPDQEGAILWGG 266
           +P  RSGHS    +   IL  G
Sbjct: 450 VPQGRSGHSVTLLKNDKILIMG 471

>Ecym_2061 Chr2 (99788..103876) [4089 bp, 1362 aa] {ON} similar to
           Ashbya gossypii ADL149W
          Length = 1362

 Score = 47.4 bits (111), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 83/204 (40%), Gaps = 34/204 (16%)

Query: 168 YSDTWLLDCT------TKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYL 221
           Y DTW++         T +  ++ +   P  R GH  T+  N F+++GG      +   +
Sbjct: 197 YGDTWIIKSHENGNKFTSKTVEITETT-PPPRVGHASTLCGNAFVIFGGDTHKTNAEGLM 255

Query: 222 -NDCWLFDITTHKWT--QVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVK--AGKGL 276
            +D +L +I +HKWT  +   PR    P  R GH        +I+     K K     G 
Sbjct: 256 DDDVYLLNINSHKWTIPRPVGPR----PLGRYGHKI------SIIATSQMKTKLYVFGGQ 305

Query: 277 QKGKILTDCWYLKMNS--TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFE 334
                  D     ++S   P +  W+  K   F P P    +MV +  +  +FGG     
Sbjct: 306 FDDTYFNDLAVYDLSSFRRPDS-HWQFLKPVSFVPPPLTNHTMVSYDYKLWVFGG----- 359

Query: 335 ETEESLDSNFYNDLFTFQIKTNRW 358
           +T + L     N+LF +   TN W
Sbjct: 360 DTPQGL----INELFMYDPTTNDW 379

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 73/175 (41%), Gaps = 25/175 (14%)

Query: 190 PASRSGHRMTVWKNFFIMYGG-FRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDA 248
           P  R GH  T+  N  I++GG    +       +D +LF++ ++KWT  E P   L P  
Sbjct: 102 PPPRVGHASTICGNALILFGGDTHKVNEDGLMDDDLYLFNLNSYKWTIPE-PIG-LRPLG 159

Query: 249 RSGH--SFI---PDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNSTPSAIRWERRK 303
           R GH  S I   P +    L+GG         L         + L     P A +WE  K
Sbjct: 160 RYGHKISIIATQPTKTKLFLFGGQFDDTYFNDLS-------MFDLSTFRKPDA-QWEFIK 211

Query: 304 KQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQIKTNRW 358
            + F P P    +M+ +  +  +FGG     ET + L     N++F +    N W
Sbjct: 212 PKSFFPPPVSNHTMISYDNKLWVFGG-----ETLQGL----INEVFVYDPIVNDW 257

>YGR238C Chr7 complement(966039..968687) [2649 bp, 882 aa] {ON}
           KEL2Protein that functions in a complex with Kel1p to
           negatively regulate mitotic exit, interacts with Tem1p
           and Lte1p; localizes to regions of polarized growth;
           potential Cdc28p substrate
          Length = 882

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 51/189 (26%), Positives = 82/189 (43%), Gaps = 26/189 (13%)

Query: 168 YSDTWLL----DCTTKEWTKLD-QKNGPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTYL 221
           Y D W +    D T+    ++D  +N P  R GH  T+  N ++++GG    L  +    
Sbjct: 112 YGDVWQIAANADGTSFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLD 171

Query: 222 NDCWLFDITTHKWTQVEFPRNHLIPDARSGH--SFI---PDQEGAILWGGYCKVKAGKGL 276
           +D +LF+I ++KWT +  P     P  R GH  S I   P Q    L+GG         L
Sbjct: 172 DDLYLFNINSYKWT-IPQPIGRR-PLGRYGHKISIIASNPMQTKLYLFGGQVDETYFNDL 229

Query: 277 QKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEET 336
               +     + + NS      WE  +  G  P P    +MV +  +  +FGG     ET
Sbjct: 230 V---VFDLSSFRRPNS-----HWEFLEPVGDLPPPLTNHTMVAYDNKLWVFGG-----ET 276

Query: 337 EESLDSNFY 345
            +++ ++ Y
Sbjct: 277 PKTISNDTY 285

 Score = 38.1 bits (87), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 48/125 (38%), Gaps = 13/125 (10%)

Query: 234 WTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNST 293
           W +V+  +N   P  R   SFI   +  I   G        GL    +  D W +  N+ 
Sbjct: 73  WNRVKL-KNSPFPRYRHSSSFIVTNDNRIFVTG--------GLHDQSVYGDVWQIAANAD 123

Query: 294 PSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQI 353
            ++   +R       P PRVG +        V+FGG          LD    +DL+ F I
Sbjct: 124 GTSFTSKRIDIDQNTPPPRVGHASTICGNAYVVFGGDTHKLNKNGLLD----DDLYLFNI 179

Query: 354 KTNRW 358
            + +W
Sbjct: 180 NSYKW 184

>Smik_16.68 Chr16 (128068..130752) [2685 bp, 894 aa] {ON} YGR238C
           (REAL)
          Length = 894

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 50/100 (50%), Gaps = 6/100 (6%)

Query: 169 SDTWLLDCTTKEWTKLDQK-NGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLF 227
           +DT+  D     W+K++     P     H   V+K+   ++GG +D+    TY ND +  
Sbjct: 282 NDTYCYDPIQNAWSKVETTGEKPPPVQEHASVVYKHLMCVFGG-KDI--HNTYSNDVYFL 338

Query: 228 DITTHKWTQVEFPRNHLIPDARSGHSF-IPDQEGAILWGG 266
           ++ + KW ++   +   IP  RSGHS  + + E  ++ GG
Sbjct: 339 NLLSLKWFKLPCVKEG-IPQERSGHSLTLMNNEKLVIMGG 377

 Score = 40.4 bits (93), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 38/155 (24%), Positives = 62/155 (40%), Gaps = 16/155 (10%)

Query: 234 WTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAGKGLQKGKILTDCWYLKMNST 293
           W +++  ++   P  R   SFI   +  I   G        GL    +  D W +  N+ 
Sbjct: 73  WNRIKL-KDSPFPRYRHSSSFITTNDNRIFVTG--------GLYDQSVYGDVWEITANAN 123

Query: 294 PSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEETEESLDSNFYNDLFTFQI 353
            ++   +R +     P PRVG +        V+FGG          LD    +DL+ F I
Sbjct: 124 GTSFTSKRIQIDHNTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLLD----DDLYLFNI 179

Query: 354 KTNRW---YSLSLRPQRKKQVKISKSSTKDQEKEL 385
            + +W   + +  RP  +   KIS  ++K    EL
Sbjct: 180 NSYKWTIPHPIGSRPLGRYGHKISIIASKQMHTEL 214

 Score = 40.0 bits (92), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 82/206 (39%), Gaps = 38/206 (18%)

Query: 168 YSDTWLLDCT------TKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTY 220
           Y D W +         T +  ++D  N P  R GH  T+  N ++++GG    L  +   
Sbjct: 112 YGDVWEITANANGTSFTSKRIQIDH-NTPPPRVGHASTMCGNAYVVFGGDTHKLNKNRLL 170

Query: 221 LNDCWLFDITTHKWTQVEFPRNHLI---PDARSGH--SFIPDQEGAI---LWGGYCKVKA 272
            +D +LF+I ++KWT    P  H I   P  R GH  S I  ++      L+GG      
Sbjct: 171 DDDLYLFNINSYKWT---IP--HPIGSRPLGRYGHKISIIASKQMHTELYLFGGQIDETY 225

Query: 273 GKGLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYD 332
              L    +     + + NS      WE  +     P P    +MV    +  +FGG   
Sbjct: 226 FNDLA---VFDLSSFRRPNS-----HWEFLEPISALPPPLTNHTMVTFDNKLWVFGG--- 274

Query: 333 FEETEESLDSNFYNDLFTFQIKTNRW 358
             ET +++     ND + +    N W
Sbjct: 275 --ETPKTIS----NDTYCYDPIQNAW 294

>Kwal_14.1019 s14 (159934..162870) [2937 bp, 978 aa] {ON} YHR158C
           (KEL1) - involved in cell fusion and morphology;
           contains six Kelch repeats [contig 244] FULL
          Length = 978

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 81/205 (39%), Gaps = 36/205 (17%)

Query: 168 YSDTWLLDC-------TTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGG-FRDLGTSTT 219
           Y DTW++         T+K     D    P  R GH  T+  N F+++GG    + +   
Sbjct: 115 YGDTWIVTSHENGARFTSKTVEISDAT--PPPRVGHASTLCGNAFVIFGGDTHKVNSDGL 172

Query: 220 YLNDCWLFDITTHKWT--QVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVK--AGKG 275
             +D +LF+I ++KWT      PR    P  R GH        +I+     K K     G
Sbjct: 173 MDDDVYLFNINSYKWTIPNPVGPR----PLGRYGHKI------SIIAMSPMKTKLYVFGG 222

Query: 276 LQKGKILTDCWYLKMNS--TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDF 333
                   D     ++S   P +  W+      F P P    +M+ +  +  +FGG    
Sbjct: 223 QFDDTYFNDLAVFDLSSFRRPDS-SWQFITPNSFTPPPLTNHAMISYDYKLWVFGG---- 277

Query: 334 EETEESLDSNFYNDLFTFQIKTNRW 358
            +T + L     +D+F F  + N W
Sbjct: 278 -DTPQGL----IDDVFVFDPQVNDW 297

>ADL149W Chr4 (427096..430731) [3636 bp, 1211 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR158C (KEL1) and
           YGR238C (KEL2)
          Length = 1211

 Score = 44.7 bits (104), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 79/207 (38%), Gaps = 40/207 (19%)

Query: 168 YSDTWLL---------DCTTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTST 218
           Y DTW+L            T E T+      P  R GH  T+  N F+++GG      + 
Sbjct: 91  YGDTWILRAQDNGKQFSARTIEITE----TTPPPRVGHAATLCGNAFVIFGGDTHKTNNE 146

Query: 219 TYL-NDCWLFDITTHKWT--QVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVK--AG 273
             + +D +L ++ +HKWT      PR    P  R GH        +I+     K K    
Sbjct: 147 GLMDDDVYLLNVNSHKWTIPHPVGPR----PLGRYGHKI------SIIATSQMKTKLYVF 196

Query: 274 KGLQKGKILTDCWYLKMNS--TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVY 331
            G        D     ++S   P +  W   K   F P P    +MV +  +  +FGG  
Sbjct: 197 GGQFDDTYFNDLAVYDLSSFRRPDS-HWVFVKPASFVPPPLTNHTMVSYDYKLWVFGG-- 253

Query: 332 DFEETEESLDSNFYNDLFTFQIKTNRW 358
              +T + L     N+LF +    N W
Sbjct: 254 ---DTPQGL----INELFVYDPVVNDW 273

 Score = 39.3 bits (90), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 43/205 (20%), Positives = 81/205 (39%), Gaps = 42/205 (20%)

Query: 170 DTWLLDCTTKEWTKLDQKNGP--ASRSGHRMTVWKN------FFIMYGGFRDLGTSTTYL 221
           D +LL+  + +WT +    GP    R GH++++          ++  G F D     TY 
Sbjct: 152 DVYLLNVNSHKWT-IPHPVGPRPLGRYGHKISIIATSQMKTKLYVFGGQFDD-----TYF 205

Query: 222 NDCWLFDITTHK-----WTQVEFPRNHLIPDARSGHSFIPDQEGAILWGGYCKVKAGKGL 276
           ND  ++D+++ +     W  V+      +P   + H+ +       ++GG       +GL
Sbjct: 206 NDLAVYDLSSFRRPDSHWVFVK--PASFVPPPLTNHTMVSYDYKLWVFGG----DTPQGL 259

Query: 277 QKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFEET 336
                + D         P    W   +  G +P P    + V ++    + GG  D +  
Sbjct: 260 INELFVYD---------PVVNDWSVVETTGAKPPPLQEHAAVLYRDLMCVVGGKDDQD-- 308

Query: 337 EESLDSNFYNDLFTFQIKTNRWYSL 361
                 N+  D++   +KT RW+ L
Sbjct: 309 ------NYSQDVYFMNMKTFRWFKL 327

>Skud_7.572 Chr7 complement(940820..943471) [2652 bp, 883 aa] {ON}
           YGR238C (REAL)
          Length = 883

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/187 (23%), Positives = 74/187 (39%), Gaps = 15/187 (8%)

Query: 82  CLVSNPAHGKKELILFGGEYTNQSNSTTHFYNELFTFTPDNDQWRKISSQNXXXXXXXXX 141
            +  NP   K  L LFGG+      +    + +L +F   N  W  +             
Sbjct: 202 IIAYNPMQTK--LYLFGGQLDKTYFNDLAMF-DLSSFRRRNSHWEFLEPATTVPPPLANH 258

Query: 142 XXXXXXGIALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQKNG-PASRSGHRMTV 200
                     + GGE  +PK  +    ++T+  D    +W+K++     P     H   V
Sbjct: 259 TMVTYGNKLWVFGGE--TPKTVS----NETYCYDPIQNDWSKIETTGEIPPPVQEHASVV 312

Query: 201 WKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPRNHLIPDARSGHSF-IPDQE 259
           +K+   ++GG     T   Y ND +  D+ + KW ++   +   IP  RSGHS  +   E
Sbjct: 313 YKHIMCVFGGKY---THNAYSNDVYFLDLLSFKWYKLPHIKEG-IPRERSGHSLTLMKNE 368

Query: 260 GAILWGG 266
             ++ GG
Sbjct: 369 KILIMGG 375

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 71/174 (40%), Gaps = 23/174 (13%)

Query: 168 YSDTWLLDCT------TKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTY 220
           Y D W +         T +  ++D +N P  R GH  T+  N ++++GG    L      
Sbjct: 110 YGDVWQITANADGTSFTPKAIQID-RNTPPPRVGHASTLCGNAYVVFGGDTHKLNEDKLL 168

Query: 221 LNDCWLFDITTHKWTQVEFPRNHLIPDARSGH-----SFIPDQEGAILWGGYCKVKAGKG 275
            +D +LF++ ++KWT +  P     P  R GH     ++ P Q    L+GG         
Sbjct: 169 DDDIYLFNVNSYKWT-IPQPIGSR-PLGRYGHKISIIAYNPMQTKLYLFGGQLDKTYFND 226

Query: 276 LQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGG 329
           L    +     + + NS      WE  +     P P    +MV +  +  +FGG
Sbjct: 227 L---AMFDLSSFRRRNS-----HWEFLEPATTVPPPLANHTMVTYGNKLWVFGG 272

>Suva_7.530 Chr7 complement(920446..923130) [2685 bp, 894 aa] {ON}
           YGR238C (REAL)
          Length = 894

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 88/219 (40%), Gaps = 36/219 (16%)

Query: 168 YSDTWL----LDCTT--KEWTKLDQKNGPASRSGHRMTVWKNFFIMYGG-FRDLGTSTTY 220
           Y DTW     LD T+   +  ++ Q N P  R GH  T+  N ++++GG    L  +   
Sbjct: 112 YGDTWQITGNLDGTSFVSKTIQIGQ-NTPPPRVGHASTICGNAYVVFGGDTHKLNMNRLL 170

Query: 221 LNDCWLFDITTHKWTQVEFPRNHLIPDARSGH--SFI---PDQEGAILWGGYCKVKAGKG 275
            +D +LF+I ++KWT +  P     P  R GH  S I   P Q    L+GG         
Sbjct: 171 DDDLYLFNINSYKWT-IPQPVGTR-PLGRYGHKISIIANNPMQTKLFLFGGQI------- 221

Query: 276 LQKGKILTDCWYLKMNS--TPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDF 333
                   D     ++S   P++  W   K     P P    +MV    +  +FGG    
Sbjct: 222 --DETYFNDLAMFDLSSFRRPNS-HWVFLKPVSIVPPPLTNHTMVTFDNKLWVFGG---- 274

Query: 334 EETEESLDSNFYNDLFTFQIKTNRWYSLSLRPQRKKQVK 372
            +T  +L     N+ F +    N W  +    +R   V+
Sbjct: 275 -KTPNTLS----NETFCYDPVQNDWSKIQTTGERPPAVQ 308

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 45/207 (21%), Positives = 84/207 (40%), Gaps = 46/207 (22%)

Query: 170 DTWLLDCTTKEWTKLDQKNG--PASRSGHRMTVWKNF-----FIMYGGFRDLGTSTTYLN 222
           D +L +  + +WT + Q  G  P  R GH++++  N        ++GG  D     TY N
Sbjct: 173 DLYLFNINSYKWT-IPQPVGTRPLGRYGHKISIIANNPMQTKLFLFGGQID----ETYFN 227

Query: 223 DCWLFDITTHKWTQVEFPRNH--------LIPDARSGHSFIPDQEGAILWGGYCKVKAGK 274
           D  +FD+++ +      P +H        ++P   + H+ +       ++GG    K   
Sbjct: 228 DLAMFDLSSFRR-----PNSHWVFLKPVSIVPPPLTNHTMVTFDNKLWVFGG----KTPN 278

Query: 275 GLQKGKILTDCWYLKMNSTPSAIRWERRKKQGFQPSPRVGCSMVPHKGRGVLFGGVYDFE 334
            L      T C+       P    W + +  G +P      + V +K    +FGG     
Sbjct: 279 TLSNE---TFCY------DPVQNDWSKIQTTGERPPAVQEHASVVYKHLMCIFGG----- 324

Query: 335 ETEESLDSNFYNDLFTFQIKTNRWYSL 361
              + + + + ND++   + T +WY L
Sbjct: 325 ---KDIQNAYSNDVYFLNLITFKWYKL 348

>ZYRO0C03344g Chr3 complement(259809..261785) [1977 bp, 658 aa] {ON}
           similar to similar to uniprot|Q08282 YOL141w
           Saccharomyces cerevisiae PPM2 Putative carboxyl methyl
           transferase
          Length = 658

 Score = 35.8 bits (81), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 31/62 (50%), Gaps = 5/62 (8%)

Query: 175 DCTTKEWTKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKW 234
           DC   E    D+   P +R+ H  T+  N   M  G R        L+D W+F++++H+W
Sbjct: 397 DC---EAVPFDKTTAPVARACHTFTLVNNDTAMVVGGRR--NPWQPLSDTWMFNLSSHEW 451

Query: 235 TQ 236
           T+
Sbjct: 452 TR 453

>YGR289C Chr7 complement(1073963..1075813) [1851 bp, 616 aa] {ON}
           MAL11Inducible high-affinity maltose transporter
           (alpha-glucoside transporter); encoded in the MAL1
           complex locus; broad substrate specificity that includes
           maltotriose; required for isomaltose utilization
          Length = 616

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 8/83 (9%)

Query: 379 KDQEKELQDHLNRILQQAQLYDQDEDKEDDKAIREQFEDENQSGDEDEEESTKKQHTI-S 437
           KD   EL DHL      AQL D DED E+         + N + D +E  S +K  T+  
Sbjct: 46  KDSAFEL-DHLEFTTNSAQLGDSDEDNEN------VINEMNATDDANEANSEEKSMTLKQ 98

Query: 438 TQLPHPRFNTSLAVVNDTLFIYG 460
             L +P+      +V+ TL + G
Sbjct: 99  ALLKYPKAALWSILVSTTLVMEG 121

>KNAG0G01390 Chr7 complement(313096..317799) [4704 bp, 1567 aa] {ON}
           Anc_8.157 YGL197W
          Length = 1567

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 37/94 (39%), Gaps = 14/94 (14%)

Query: 151 LLHGGEFSSPKQN-TFYHYSDTWLLDCTTKEWTKLDQKNGPASRSGHRMTVWKNF----- 204
            + GG   SP+        ++ W LD  T +WT L +    A R  H + V         
Sbjct: 192 FIFGGLVVSPQNGYELVATNELWKLDLLTNKWTLLSRNPSIARRFNHTVHVKNELRDTRD 251

Query: 205 --FIMYGGFRDLGTSTTYLN------DCWLFDIT 230
              I+ GG  +L      ++      +CW F++T
Sbjct: 252 TKLIIVGGLNNLNEPINTIDIYNVTQNCWQFEVT 285

>TDEL0B04550 Chr2 (803410..808206) [4797 bp, 1598 aa] {ON} Anc_8.157
           YGL197W
          Length = 1598

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 29/54 (53%), Gaps = 6/54 (11%)

Query: 409 KAIREQFEDENQSGDEDEEESTKKQHTISTQLPHPRFNTSLAVVNDTLFIYGGL 462
           K +   FEDEN++GDE ++E++        +    R   S+  VN  L+ +GGL
Sbjct: 113 KRVETTFEDENENGDEQDDENS------GLRFFKERIFHSMCFVNSCLYTFGGL 160

>CAGL0K02101g Chr11 (182946..187847) [4902 bp, 1633 aa] {ON} similar
           to uniprot|P32634 Saccharomyces cerevisiae YER132c PMD1
           or uniprot|P53094 Saccharomyces cerevisiae YGL197w MDS3
          Length = 1633

 Score = 33.1 bits (74), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/95 (24%), Positives = 40/95 (42%), Gaps = 11/95 (11%)

Query: 148 GIALLHGGEFSSP-KQNTFYHYSDTWLLDCTTKEWTKLDQKNGPASRSGHRMTVWKN--- 203
           G   + GG   SP  +  F   +D W LD    +W+ L +  G   R  H M V  +   
Sbjct: 170 GFLYIFGGLMISPHNEYEFVATNDLWQLDLRGNKWSLLSKDPGVGRRYNHEMHVLNSEDP 229

Query: 204 ----FFIMYGGFRDLGTSTTYLNDCWLFDITTHKW 234
                 ++ GG  ++      ++   +F++TT +W
Sbjct: 230 TKDTKLVIVGGIDNMDEPVAKID---IFNLTTLQW 261

>TBLA0A04320 Chr1 (1068199..1070715) [2517 bp, 838 aa] {ON} Anc_7.9
           YAL056W
          Length = 838

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 26/91 (28%), Positives = 38/91 (41%), Gaps = 10/91 (10%)

Query: 182 TKLDQKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPR 241
           TK +  +GP  +     T   +  +M+GG      +T   +D W FD  T  W Q+E   
Sbjct: 636 TKSNGPSGPVLQLHINETSEGHTLVMHGG----SNATHIYSDMWWFDFETESWVQIETQA 691

Query: 242 NH----LIPD--ARSGHSFIPDQEGAILWGG 266
                 L+P   A +GHS       +I  GG
Sbjct: 692 QTEDKGLVPIEMALAGHSMATVGSASIFVGG 722

>Kpol_1014.25 s1014 complement(42216..44105) [1890 bp, 629 aa] {ON}
           complement(42216..44105) [1890 nt, 630 aa]
          Length = 629

 Score = 32.3 bits (72), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 22/86 (25%), Positives = 41/86 (47%), Gaps = 10/86 (11%)

Query: 183 KLDQKNGPASRSGHRMT-VWKNFFIMYGGFRDLGTSTTYLNDCWLFDITTHKWTQVEFPR 241
           K+D  + P  R  H ++ + ++  I  GG +  G      ++CW  D++T +W+     +
Sbjct: 371 KIDTTDTPIGRMCHTLSRISESEIISIGGRKAPGQG---FDECWKLDLSTKQWS-----K 422

Query: 242 NHLIPDARSGHS-FIPDQEGAILWGG 266
              +   R  HS F+ D E  ++ GG
Sbjct: 423 GAQLNAKRYRHSAFMVDDENVLICGG 448

>Kpol_495.2 s495 complement(6278..9313,9316..10815) [4536 bp, 1511
           aa] {ON} complement(6278..9313,9316..10815) [4536 nt,
           1512 aa]
          Length = 1511

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 19/71 (26%), Positives = 31/71 (43%), Gaps = 10/71 (14%)

Query: 174 LDCTTKEWTKLD------QKNGPASRSGHRMTVWKNFFIMYGGFRDLGTSTTY----LND 223
           LD  +++W+K+D        +   SR  H +    +   ++GG      +  Y     ND
Sbjct: 146 LDLISRKWSKIDTIIPNDNTDFALSRLFHSIVYLDSAIYLFGGLILCPRAENYKLVPTND 205

Query: 224 CWLFDITTHKW 234
            W  D+TT KW
Sbjct: 206 LWKLDLTTKKW 216

>NCAS0A07640 Chr1 complement(1521774..1524515) [2742 bp, 913 aa]
           {ON} Anc_7.9 YAL056W
          Length = 913

 Score = 31.6 bits (70), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 34/86 (39%), Gaps = 17/86 (19%)

Query: 149 IALLHGGEFSSPKQNTFYHYSDTWLLDCTTKEWTKLDQ-----------KNGPASRSGHR 197
           + ++HGG       N    Y D W  D   ++WTK+D             N   +  GH 
Sbjct: 728 MIIIHGG------SNDHKVYGDMWWFDVEMEKWTKIDMYAETNDAKEGLVNCDLALVGHT 781

Query: 198 MTVWKNFFIMYGGFRDLGTSTTYLND 223
           M +  ++ I  GG       T ++++
Sbjct: 782 MAIIGHYAISVGGLIQQDVDTLFISE 807

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.420 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,347,062
Number of extensions: 2858792
Number of successful extensions: 32510
Number of sequences better than 10.0: 699
Number of HSP's gapped: 30308
Number of HSP's successfully gapped: 1109
Length of query: 643
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 527
Effective length of database: 40,180,143
Effective search space: 21174935361
Effective search space used: 21174935361
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)