Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F00462g6.9ON39339321010.0
TDEL0G046206.9ON39238615110.0
NCAS0F001906.9ON41139414380.0
Kpol_1045.786.9ON39239314070.0
NDAI0K029006.9ON43840413850.0
KNAG0E009806.9ON41438813071e-180
TPHA0M001906.9ON39138712981e-179
CAGL0B03575g6.9ON41939512951e-178
Skud_5.336.9ON40140012561e-172
Suva_5.126.9ON40140012421e-170
YEL056W (HAT2)6.9ON40140012421e-170
SAKL0E00814g6.9ON39839312301e-168
Ecym_30126.9ON39737412211e-167
Smik_5.316.9ON42740012231e-167
KLTH0C11550g6.9ON39838012091e-165
Kwal_56.223456.9ON39638111781e-160
KLLA0D00814g6.9ON40839011731e-159
ACR017W6.9ON42337211521e-156
KAFR0L003206.9ON39139011431e-155
TBLA0A071206.9ON40738310671e-143
TBLA0H036508.548ON4194313581e-37
Kpol_1024.398.548ON4174123404e-35
KAFR0I008408.548ON4134243387e-35
Ecym_70428.548ON4144043264e-33
YBR195C (MSI1)8.548ON4224213254e-33
CAGL0M05291g8.548ON4194163239e-33
ZYRO0A13068g8.548ON3974043201e-32
Kwal_27.120708.548ON4184053169e-32
KLTH0E12694g8.548ON4184063151e-31
TPHA0L017208.548ON4194083132e-31
SAKL0H09900g8.548ON4254103133e-31
AEL250C8.548ON4174083098e-31
NDAI0C055108.548ON4194153062e-30
KLLA0E23541g8.548ON4174163053e-30
Suva_4.4498.548ON4244253028e-30
Skud_2.3218.548ON4224163028e-30
NCAS0B021708.548ON4144182973e-29
Smik_2.3358.548ON4224222974e-29
TDEL0B029808.548ON4124082949e-29
KNAG0A036708.548ON4264272922e-28
Suva_13.3112.401ON5104021924e-15
YMR131C (RRB1)2.401ON5114021908e-15
Sklu_YGOB_Anc_2.4012.401ON5204011891e-14
KLLA0F17237g2.401ON5234141835e-14
KNAG0E021802.401ON5174001836e-14
KAFR0A003802.401ON5164001836e-14
TDEL0G033402.401ON5144021792e-13
Skud_13.2912.401ON5094011739e-13
TPHA0G026502.401ON5164071721e-12
NDAI0H027502.401ON5124021721e-12
Kpol_1041.202.401ON5153951702e-12
CAGL0K03861g2.401ON5133961684e-12
Smik_13.3292.401ON5094011684e-12
KLTH0E09394g2.401ON5223961667e-12
TBLA0B092502.401ON5264001659e-12
ADR242C2.401ON5213991632e-11
Kpol_1048.598.544ON8502401642e-11
Ecym_60982.431ON3182401602e-11
NCAS0F019702.401ON5114021613e-11
NCAS0G011206.276ON4943141604e-11
Kwal_47.178272.401ON5233961604e-11
TDEL0A068906.276ON4473621595e-11
Suva_14.223.25ON4692691578e-11
Skud_14.223.25ON4672691571e-10
Ecym_60672.401ON5224181552e-10
AFR199C2.431ON3341851532e-10
YKR036C (CAF4)1.247ON6432331552e-10
YNL317W (PFS2)3.25ON4652691542e-10
Smik_14.143.25ON4662691533e-10
ZYRO0A08690g2.401ON5163421533e-10
Smik_4.457.310ON12702201509e-10
Suva_11.2681.247ON6452331481e-09
Skud_4.637.310ON12732161482e-09
Kpol_1060.246.276ON4862031462e-09
ZYRO0G20152g2.431ON3192421442e-09
Skud_11.2711.247ON6462221462e-09
NDAI0G038303.25ON5102311453e-09
SAKL0E03960g2.431ON3202401433e-09
ZYRO0E08184g6.276ON5063841444e-09
NCAS0C044503.25ON4612321444e-09
KLTH0F19294g3.25ON4512261434e-09
YNL035C2.283ON3891831425e-09
ADL184W3.25ON4492631426e-09
Smik_11.2981.247ON6622211427e-09
Suva_4.537.310ON12712131437e-09
KLLA0E07085g3.25ON4522251401e-08
ZYRO0C03124g3.25ON4452701401e-08
TPHA0I018808.544ON10342111411e-08
NCAS0F018502.431ON3182391381e-08
NCAS0A042702.431ON3182391381e-08
Suva_14.3112.283ON3892031391e-08
Skud_14.2982.283ON3891851381e-08
TPHA0C033702.283ON4131851382e-08
AEL269C7.534ON4551671382e-08
TDEL0A020702.431ON3192401362e-08
KAFR0I028403.25ON4562701382e-08
Suva_13.2952.431ON3192401362e-08
Skud_13.2752.431ON3192401362e-08
Smik_13.3052.431ON3192401362e-08
YMR116C (ASC1)2.431ON3192401362e-08
Kwal_33.151365.201ON4731711373e-08
CAGL0M04081g3.25ON4552311373e-08
NDAI0A020907.322ON12002461383e-08
TDEL0A004403.25ON4512601363e-08
TPHA0G023802.431ON3182511344e-08
NDAI0F012406.276ON5241711364e-08
ZYRO0F05808g7.310ON12822171374e-08
TDEL0C023607.310ON12642141374e-08
TPHA0P014903.25ON4592701355e-08
ZYRO0G10472g4.122ON5601731355e-08
Kpol_297.72.431ON3182511335e-08
KLLA0F15598g5.201ON4782161346e-08
Kpol_1028.416.340ON5123131347e-08
TBLA0B091002.431ON3172401327e-08
TBLA0F041306.340ON5143171347e-08
KNAG0A012303.22ON13211961348e-08
Kpol_1014.193.25ON4522621338e-08
KAFR0L013907.322ON12062471349e-08
KNAG0A012503.25ON4522611321e-07
Kwal_56.236858.288ON11021401331e-07
YDL195W (SEC31)7.310ON12732161331e-07
KLTH0D04466g2.431ON3192401301e-07
TBLA0B087303.25ON4612761302e-07
Kpol_1019.307.310ON12522221312e-07
NDAI0H027102.431ON3182341282e-07
TDEL0C022407.322ON12012471303e-07
Skud_10.1021.247ON7081811293e-07
Kpol_1003.342.283ON3881191283e-07
TPHA0F007704.122ON6311441293e-07
YPL247C6.276ON5232341283e-07
CAGL0A00605g4.122ON6401731293e-07
KLLA0F05159g7.310ON12312161294e-07
TPHA0D045007.322ON12082511294e-07
Suva_16.1598.672ON4512011274e-07
ADL186C3.22ON13612011284e-07
Ecym_70388.544ON8002361284e-07
Kwal_56.245267.322ON12102471284e-07
KLTH0H01892g7.322ON12092471285e-07
KNAG0I028406.340ON5192561275e-07
SAKL0F10648g7.322ON12032471285e-07
Kpol_2001.657.322ON12062511276e-07
NCAS0E037507.310ON12762311276e-07
KLTH0B03410g5.201ON4771701267e-07
CAGL0H00781g6.276ON5132401267e-07
KAFR0F010606.276ON5532021267e-07
Smik_4.907.322ON12012471268e-07
Suva_4.997.322ON12012471268e-07
TPHA0E030805.201ON4881691258e-07
KLLA0F19734g8.288ON11331711268e-07
Skud_4.1097.322ON12012471268e-07
CAGL0D05588g5.201ON4771941249e-07
SAKL0C13266g3.25ON4592621249e-07
YJL112W (MDV1)1.247ON7141811259e-07
AAL157C5.201ON4791541241e-06
ZYRO0B10450g5.201ON4821691241e-06
KLLA0E08449g2.283ON4222041241e-06
Smik_14.2962.283ON3891771231e-06
KAFR0J009805.201ON4801821241e-06
Kpol_2002.995.201ON4871761241e-06
KAFR0L013207.310ON12402121251e-06
SAKL0H09988g8.544ON7492511241e-06
KNAG0E023102.431ON3192421221e-06
TPHA0D035906.276ON5983311231e-06
NCAS0B036908.288ON11451951241e-06
KLLA0C08547g6.340ON5153121231e-06
TBLA0F022307.322ON12162481242e-06
SAKL0G12892g5.201ON4761691222e-06
Kwal_56.244787.310ON12962241232e-06
SAKL0F10384g7.310ON12611711232e-06
Ecym_24986.340ON5421821222e-06
SAKL0H06666g8.672ON4412181222e-06
Kwal_23.63246.340ON5142561222e-06
KLTH0A06754g6.340ON5142681222e-06
AER255C5.429ON4671611212e-06
TBLA0C050107.356ON5721701222e-06
TBLA0C018408.672ON4232341212e-06
ZYRO0D08206g6.340ON5152551212e-06
NDAI0J018504.122ON5751441212e-06
KNAG0A030808.651ON4462341212e-06
CAGL0I03718g7.322ON12012471223e-06
YDL145C (COP1)7.322ON12012471223e-06
SAKL0E07766g2.283ON3981801203e-06
TDEL0F022304.122ON5561221213e-06
NDAI0G006302.283ON3972021203e-06
KNAG0B027207.322ON12042461223e-06
Smik_6.4516.276ON5231701213e-06
Smik_10.1261.247ON7122371213e-06
KNAG0I010508.288ON11591421213e-06
Suva_16.5107.534ON4652071203e-06
TPHA0M018306.340ON5153171203e-06
KAFR0A005102.431ON3192421193e-06
AEL246C8.544ON8152371213e-06
Ecym_80617.310ON12281751214e-06
Ecym_25236.363ON6462531204e-06
NCAS0G038702.283ON3891101194e-06
NCAS0F033405.429ON4481871194e-06
AGL234W6.363ON6292531195e-06
Kwal_55.220763.22ON12862681205e-06
NCAS0A139407.322ON12052471195e-06
AER263C6.340ON5132991186e-06
KLTH0G10296g2.283ON4261911186e-06
ADR090W7.310ON12331821196e-06
KLTH0G13068g8.288ON11011611196e-06
CAGL0G01628g2.283ON3761111176e-06
TBLA0H002303.22ON13332341188e-06
KLLA0E12277g2.431ON3262441168e-06
SAKL0A02970g6.276ON4152481168e-06
AFL157C6.276ON4382621168e-06
TDEL0G021402.283ON3921261169e-06
KNAG0H020402.283ON3991811161e-05
Kwal_27.120538.544ON7552381171e-05
NCAS0D027305.201ON4751851161e-05
TDEL0A075506.340ON5152021161e-05
KAFR0A064804.122ON5682221161e-05
YPL151C (PRP46)8.672ON4512031151e-05
ZYRO0F07282g8.672ON4272031151e-05
Ecym_80727.322ON12012971161e-05
SAKL0A01276g6.340ON5153191151e-05
Smik_6.3488.672ON4511931151e-05
KLLA0F04884g7.322ON12122471162e-05
NDAI0I004606.325ON9171681152e-05
TDEL0A061808.672ON4342001142e-05
TDEL0E042805.201ON4812521142e-05
Skud_16.326.276ON5222481142e-05
Suva_16.606.276ON5261911142e-05
KAFR0H033402.283ON3671891132e-05
TBLA0H036208.544ON8122531142e-05
Skud_12.565.201ON4891921142e-05
KNAG0A03070na 1ON4412561132e-05
KLTH0F16192g5.429ON4622201132e-05
Suva_6.1871.247ON7141781142e-05
KAFR0H024508.672ON4172211132e-05
KLTH0F19338g3.22ON12901981142e-05
KAFR0F043506.340ON5153151132e-05
TBLA0B059202.283ON4031771132e-05
KNAG0D007406.276ON5041621133e-05
Ecym_21396.276ON4353221123e-05
Kpol_1024.428.544ON8432571133e-05
Ecym_74032.469ON5171781133e-05
ZYRO0F09922g5.429ON4552231123e-05
Smik_12.525.201ON4891901123e-05
Ecym_33212.283ON4091101123e-05
NCAS0B01440na 1ON4282361123e-05
TPHA0G031002.469ON5092571123e-05
Smik_16.4427.534ON4702071123e-05
KNAG0I025406.325ON9181661133e-05
Kwal_26.75702.431ON2181731084e-05
Skud_3.1456.340ON5152631114e-05
Kwal_27.115502.283ON4071731114e-05
TPHA0G028402.431ON1801821074e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F00462g
         (393 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON...   813   0.0  
TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9...   586   0.0  
NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}...   558   0.0  
Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON} (1830...   546   0.0  
NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9     538   0.0  
KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {O...   508   e-180
TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON...   504   e-179
CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {...   503   e-178
Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)   488   e-172
Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)   483   e-170
YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit ...   483   e-170
SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON...   478   e-168
Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON} s...   474   e-167
Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)   475   e-167
KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} simila...   470   e-165
Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON...   458   e-160
KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON...   456   e-159
ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic ho...   448   e-156
KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9 ...   444   e-155
TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa] ...   415   e-143
TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.5...   142   1e-37
Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa] ...   135   4e-35
KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {O...   134   7e-35
Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to ...   130   4e-33
YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}  ...   129   4e-33
CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa] ...   129   9e-33
ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} simi...   127   1e-32
Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR1...   126   9e-32
KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} simi...   125   1e-31
TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8....   125   2e-31
SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {...   125   3e-31
AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON} S...   123   8e-31
NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON} Anc_8...   122   2e-30
KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} simi...   122   3e-30
Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON...   120   8e-30
Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON...   120   8e-30
NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {O...   119   3e-29
Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON...   119   4e-29
TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {O...   117   9e-29
KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {O...   117   2e-28
Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {...    79   4e-15
YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON} ...    78   8e-15
Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 52...    77   1e-14
KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} high...    75   5e-14
KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.4...    75   6e-14
KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401...    75   6e-14
TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.4...    74   2e-13
Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {...    71   9e-13
TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.4...    71   1e-12
NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.4...    71   1e-12
Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {O...    70   2e-12
CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa] ...    69   4e-12
Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {...    69   4e-12
KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {...    69   7e-12
TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON} Anc_2...    68   9e-12
ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}...    67   2e-11
Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa] ...    68   2e-11
Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa] ...    66   2e-11
NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {O...    67   3e-11
NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {O...    66   4e-11
Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {...    66   4e-11
TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON} Anc_6...    66   5e-11
Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W (...    65   8e-11
Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W (...    65   1e-10
Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar t...    64   2e-10
AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,...    64   2e-10
YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON} ...    64   2e-10
YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integra...    64   2e-10
Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W (...    64   3e-10
ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly...    64   3e-10
Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W (R...    62   9e-10
Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {...    62   1e-09
Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W ...    62   2e-09
Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {O...    61   2e-09
ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408) ...    60   2e-09
Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {...    61   2e-09
NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25      60   3e-09
SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963...    60   3e-09
ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} simila...    60   4e-09
NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25      60   4e-09
KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]...    60   4e-09
YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON} ...    59   5e-09
ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic ho...    59   6e-09
Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {...    59   7e-09
Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W (R...    60   7e-09
KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} simila...    59   1e-08
ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {...    59   1e-08
TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {...    59   1e-08
NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 ...    58   1e-08
NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa...    58   1e-08
Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {...    58   1e-08
Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {...    58   1e-08
TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {O...    58   2e-08
AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON} S...    58   2e-08
TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa...    57   2e-08
KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {O...    58   2e-08
Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960...    57   2e-08
Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960...    57   2e-08
Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960...    57   2e-08
YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,...    57   2e-08
Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011...    57   3e-08
CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa] ...    57   3e-08
NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {...    58   3e-08
TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25 ...    57   3e-08
TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa...    56   4e-08
NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {O...    57   4e-08
ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa] ...    57   4e-08
TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7....    57   4e-08
TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {...    57   5e-08
ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {...    57   5e-08
Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON...    56   5e-08
KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} high...    56   6e-08
Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON} (1007...    56   7e-08
TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [...    55   7e-08
TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa] ...    56   7e-08
KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON...    56   8e-08
Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {O...    56   8e-08
KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON} Anc_7...    56   9e-08
KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25 ...    55   1e-07
Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa] ...    56   1e-07
YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}  SEC31Comp...    56   1e-07
KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 a...    55   1e-07
TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa] ...    55   2e-07
Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON} (56367...    55   2e-07
NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 ...    54   2e-07
TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {...    55   3e-07
Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112...    54   3e-07
Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {O...    54   3e-07
TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.1...    54   3e-07
YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON} Pu...    54   3e-07
CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON...    54   3e-07
KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} simil...    54   4e-07
TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7....    54   4e-07
Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {...    54   4e-07
ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON} ...    54   4e-07
Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to ...    54   4e-07
Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON} YDL...    54   4e-07
KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa] ...    54   5e-07
KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.3...    54   5e-07
SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highl...    54   5e-07
Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON} (178...    54   6e-07
NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {...    54   6e-07
KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {...    53   7e-07
CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON...    53   7e-07
KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {O...    53   7e-07
Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON...    53   8e-07
Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON...    53   8e-07
TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {O...    53   8e-07
KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON} sim...    53   8e-07
Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {O...    53   8e-07
CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly...    52   9e-07
SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]...    52   9e-07
YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}  MDV1Perip...    53   9e-07
AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON} Syn...    52   1e-06
ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {...    52   1e-06
KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} simila...    52   1e-06
Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {...    52   1e-06
KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5....    52   1e-06
Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON} (2370...    52   1e-06
KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa] ...    53   1e-06
SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {...    52   1e-06
KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa...    52   1e-06
TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.2...    52   1e-06
NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {...    52   1e-06
KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly...    52   1e-06
TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7....    52   2e-06
SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]...    52   2e-06
Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa...    52   2e-06
SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa] ...    52   2e-06
Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}...    52   2e-06
SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {...    52   2e-06
Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa] ...    52   2e-06
KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {...    52   2e-06
AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}...    51   2e-06
TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa] ...    52   2e-06
TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.6...    51   2e-06
ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly...    51   2e-06
NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4....    51   2e-06
KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {O...    51   2e-06
CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa] ...    52   3e-06
YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON} ...    52   3e-06
SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} simila...    51   3e-06
TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.1...    51   3e-06
NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {O...    51   3e-06
KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {...    52   3e-06
Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C ...    51   3e-06
Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112...    51   3e-06
KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {...    51   3e-06
Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178...    51   3e-06
TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {...    51   3e-06
KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {O...    50   3e-06
AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON} S...    51   3e-06
Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON...    51   4e-06
Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {O...    51   4e-06
NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283     50   4e-06
NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {O...    50   4e-06
AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic ho...    50   5e-06
Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON} YOL...    51   5e-06
NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON} Anc_...    50   5e-06
AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}...    50   6e-06
KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {...    50   6e-06
ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic h...    50   6e-06
KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa...    50   6e-06
CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {...    50   6e-06
TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON...    50   8e-06
KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 3...    49   8e-06
SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {...    49   8e-06
AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON} S...    49   8e-06
TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {O...    49   9e-06
KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.2...    49   1e-05
Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR1...    50   1e-05
NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201     49   1e-05
TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa] ...    49   1e-05
KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa] ...    49   1e-05
YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON} ...    49   1e-05
ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} simila...    49   1e-05
Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar ...    49   1e-05
SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly...    49   1e-05
Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C ...    49   1e-05
KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa] ...    49   2e-05
NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325       49   2e-05
TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON} Anc_8...    49   2e-05
TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {O...    49   2e-05
Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}...    49   2e-05
Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}...    49   2e-05
KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.2...    48   2e-05
TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.5...    49   2e-05
Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W...    49   2e-05
KNAG0A03070 Chr1 complement(378279..379604) [1326 bp, 441 aa] {O...    48   2e-05
KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} simi...    48   2e-05
Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON...    49   2e-05
KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {O...    48   2e-05
KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON} sim...    49   2e-05
KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.3...    48   2e-05
TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa] ...    48   2e-05
KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {O...    48   3e-05
Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}...    48   3e-05
Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa] ...    48   3e-05
Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar t...    48   3e-05
ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {...    48   3e-05
Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W...    48   3e-05
Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}...    48   3e-05
NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON}               48   3e-05
TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {O...    48   3e-05
Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178...    48   3e-05
KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.3...    48   3e-05
Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C ...    46   4e-05
Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON...    47   4e-05
Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035...    47   4e-05
TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.43...    46   4e-05
ZYRO0F11110g Chr6 (908737..912342) [3606 bp, 1201 aa] {ON} highl...    48   4e-05
Suva_10.64 Chr10 (132461..133933) [1473 bp, 490 aa] {ON} YLL011W...    47   4e-05
Kpol_2001.63 s2001 complement(171777..175607) [3831 bp, 1276 aa]...    48   4e-05
NDAI0J00330 Chr10 (54580..55998) [1419 bp, 472 aa] {ON} Anc_7.534      47   5e-05
KLLA0E23453g Chr5 (2088516..2090996) [2481 bp, 826 aa] {ON} simi...    47   5e-05
Skud_16.482 Chr16 (834842..836239) [1398 bp, 465 aa] {ON} YPR178...    47   5e-05
YLL011W Chr12 (127523..128992) [1470 bp, 489 aa] {ON}  SOF1Essen...    47   5e-05
KLLA0C08976g Chr3 (784536..787271) [2736 bp, 911 aa] {ON} highly...    47   5e-05
Kwal_55.22067 s55 complement(1094600..1095955) [1356 bp, 451 aa]...    47   5e-05
Kpol_1038.20 s1038 complement(43719..47660) [3942 bp, 1313 aa] {...    47   5e-05
TBLA0I02280 Chr9 complement(523331..526114) [2784 bp, 927 aa] {O...    47   5e-05
AGL190W Chr7 (341382..342494) [1113 bp, 370 aa] {ON} Syntenic ho...    47   5e-05
TDEL0F04430 Chr6 complement(831678..832781) [1104 bp, 367 aa] {O...    47   5e-05
Skud_16.131 Chr16 complement(237797..239152) [1356 bp, 451 aa] {...    47   6e-05
NDAI0I02180 Chr9 complement(499955..501394) [1440 bp, 479 aa] {O...    47   6e-05
ABL044C Chr2 complement(312376..313932) [1557 bp, 518 aa] {ON} S...    47   6e-05
KNAG0M01750 Chr13 complement(323446..324903) [1458 bp, 485 aa] {...    47   6e-05
TPHA0E01790 Chr5 (359679..361004) [1326 bp, 441 aa] {ON} Anc_5.4...    47   6e-05
NDAI0E02400 Chr5 (499223..500527) [1305 bp, 434 aa] {ON} Anc_8.672     47   7e-05
TBLA0E00760 Chr5 (158338..159492) [1155 bp, 384 aa] {ON}               46   7e-05
TBLA0H02000 Chr8 complement(474850..476271) [1422 bp, 473 aa] {O...    47   8e-05
TPHA0A00380 Chr1 complement(55881..59813) [3933 bp, 1310 aa] {ON...    47   9e-05
NCAS0D04610 Chr4 (881005..882552) [1548 bp, 515 aa] {ON} Anc_6.340     46   9e-05
SAKL0H22396g Chr8 complement(1949474..1951141) [1668 bp, 555 aa]...    46   9e-05
TDEL0D01310 Chr4 complement(251119..253248) [2130 bp, 709 aa] {O...    47   9e-05
KLTH0E08162g Chr5 complement(749584..751254) [1671 bp, 556 aa] {...    46   9e-05
NDAI0J01180 Chr10 complement(273472..276876) [3405 bp, 1134 aa] ...    47   9e-05
KAFR0E01230 Chr5 complement(247314..248423) [1110 bp, 369 aa] {O...    46   1e-04
TBLA0F02140 Chr6 complement(526982..530884) [3903 bp, 1300 aa] {...    47   1e-04
KLTH0D05346g Chr4 complement(475917..477440) [1524 bp, 507 aa] {...    46   1e-04
KLLA0D12760g Chr4 complement(1090428..1091909) [1482 bp, 493 aa]...    46   1e-04
SAKL0H16390g Chr8 complement(1437966..1441388) [3423 bp, 1140 aa...    47   1e-04
KNAG0B02800 Chr2 (537056..540979) [3924 bp, 1307 aa] {ON} Anc_7....    47   1e-04
KAFR0E03900 Chr5 complement(771649..772968) [1320 bp, 439 aa] {O...    46   1e-04
Suva_3.93 Chr3 complement(133524..136286) [2763 bp, 920 aa] {ON}...    46   1e-04
Kpol_1062.32 s1062 (69674..71074) [1401 bp, 466 aa] {ON} (69674....    46   1e-04
CAGL0D02090g Chr4 (214357..214893,215564..215860) [834 bp, 277 a...    45   1e-04
Skud_7.284 Chr7 complement(495549..497249) [1701 bp, 566 aa] {ON...    46   1e-04
Suva_3.109 Chr3 complement(158211..159758) [1548 bp, 515 aa] {ON...    46   1e-04
NDAI0I00350 Chr9 (71116..72663) [1548 bp, 515 aa] {ON} Anc_6.340       46   1e-04
ZYRO0A01804g Chr1 complement(150103..151233) [1131 bp, 376 aa] {...    45   1e-04
CAGL0J03476g Chr10 (334536..336089) [1554 bp, 517 aa] {ON} highl...    45   2e-04
YMR093W Chr13 (454015..455556) [1542 bp, 513 aa] {ON}  UTP15Nucl...    45   2e-04
TDEL0A05970 Chr1 (1047306..1048733) [1428 bp, 475 aa] {ON} Anc_8...    45   2e-04
Smik_13.277 Chr13 (437902..439443) [1542 bp, 513 aa] {ON} YMR093...    45   2e-04
TPHA0L01690 Chr12 (355859..358357) [2499 bp, 832 aa] {ON} Anc_8....    46   2e-04
NDAI0E01320 Chr5 complement(262712..263995) [1284 bp, 427 aa] {O...    45   2e-04
Kwal_26.8776 s26 (938508..939809) [1302 bp, 433 aa] {ON} YPL151C...    45   2e-04
ACR137W Chr3 (590077..591354) [1278 bp, 425 aa] {ON} Syntenic ho...    45   2e-04
TPHA0A03100 Chr1 (679875..683672) [3798 bp, 1265 aa] {ON} Anc_7....    45   2e-04
YCR072C Chr3 complement(240805..242352) [1548 bp, 515 aa] {ON}  ...    45   2e-04
SAKL0A01738g Chr1 (157360..160089) [2730 bp, 909 aa] {ON} highly...    45   2e-04
Ecym_2026 Chr2 (42179..43534) [1356 bp, 451 aa] {ON} similar to ...    45   2e-04
TDEL0E01960 Chr5 (369744..371102) [1359 bp, 452 aa] {ON} Anc_5.4...    45   2e-04
Smik_3.172 Chr3 complement(240515..242062) [1548 bp, 515 aa] {ON...    45   2e-04
SAKL0G02398g Chr7 complement(200123..201538) [1416 bp, 471 aa] {...    45   2e-04
KLTH0E15576g Chr5 complement(1384027..1386198) [2172 bp, 723 aa]...    45   2e-04
TPHA0C00860 Chr3 (180116..181252) [1137 bp, 378 aa] {ON} Anc_8.3...    45   2e-04
KLLA0E20967g Chr5 (1872227..1876192) [3966 bp, 1321 aa] {ON} sim...    45   2e-04
AFL014C Chr6 complement(409496..411169) [1674 bp, 557 aa] {ON} S...    45   2e-04
Smik_3.157 Chr3 complement(218522..221296) [2775 bp, 924 aa] {ON...    45   2e-04
Smik_7.287 Chr7 complement(484376..486076) [1701 bp, 566 aa] {ON...    45   2e-04
Ecym_2024 Chr2 complement(35886..39839) [3954 bp, 1317 aa] {ON} ...    45   2e-04
KLTH0H02134g Chr8 (191540..195439) [3900 bp, 1299 aa] {ON} simil...    45   3e-04
TDEL0A05770 Chr1 (1018340..1019641) [1302 bp, 433 aa] {ON} Anc_8...    45   3e-04
Kpol_1072.17 s1072 complement(40550..41851) [1302 bp, 433 aa] {O...    45   3e-04
Skud_3.133 Chr3 complement(204741..207488) [2748 bp, 916 aa] {ON...    45   3e-04
KLLA0F11231g Chr6 complement(1034708..1036012) [1305 bp, 434 aa]...    45   3e-04
KAFR0B05580 Chr2 (1142731..1146093) [3363 bp, 1120 aa] {ON} Anc_...    45   3e-04
NCAS0B02200 Chr2 complement(359080..361548) [2469 bp, 822 aa] {O...    45   3e-04
ZYRO0D03828g Chr4 (310049..312229) [2181 bp, 726 aa] {ON} simila...    45   3e-04
CAGL0G09845g Chr7 (940598..942100) [1503 bp, 500 aa] {ON} simila...    45   3e-04
KLLA0A08822g Chr1 (772565..774313) [1749 bp, 582 aa] {ON} simila...    45   3e-04
NDAI0J01040 Chr10 (238940..240136) [1197 bp, 398 aa] {ON} Anc_8....    44   3e-04
SAKL0C13332g Chr3 (1177358..1181419) [4062 bp, 1353 aa] {ON} sim...    45   3e-04
YPR178W Chr16 (892332..893729) [1398 bp, 465 aa] {ON}  PRP4Splic...    44   4e-04
Ecym_7105 Chr7 complement(205465..206919) [1455 bp, 484 aa] {ON}...    44   4e-04
Kwal_33.15475 s33 complement(1123396..1125747) [2352 bp, 783 aa]...    45   4e-04
Kwal_23.6240 s23 complement(1503990..1506731) [2742 bp, 913 aa] ...    45   4e-04
Skud_15.16 Chr15 complement(26552..30550) [3999 bp, 1332 aa] {ON...    45   4e-04
KLLA0F21406g Chr6 complement(1996260..1998377) [2118 bp, 705 aa]...    44   4e-04
ZYRO0C03190g Chr3 (245542..249363) [3822 bp, 1273 aa] {ON} simil...    45   4e-04
NDAI0B05630 Chr2 complement(1376242..1377549) [1308 bp, 435 aa] ...    44   4e-04
TPHA0B01120 Chr2 (254017..256176) [2160 bp, 719 aa] {ON} Anc_1.2...    44   5e-04
TPHA0D03830 Chr4 complement(802754..805492) [2739 bp, 912 aa] {O...    44   5e-04
SAKL0H15708g Chr8 (1370148..1371254) [1107 bp, 368 aa] {ON} high...    44   5e-04
NCAS0C01680 Chr3 (309670..310965) [1296 bp, 431 aa] {ON} Anc_8.672     44   5e-04
CAGL0J01265g Chr10 complement(118375..119928) [1554 bp, 517 aa] ...    44   5e-04
ADR077C Chr4 complement(843169..846783) [3615 bp, 1204 aa] {ON} ...    44   6e-04
SAKL0D04796g Chr4 (372598..374907) [2310 bp, 769 aa] {ON} simila...    44   6e-04
CAGL0M05335g Chr13 complement(569132..571552) [2421 bp, 806 aa] ...    44   6e-04
KLTH0G12430g Chr7 (1057236..1058339) [1104 bp, 367 aa] {ON} simi...    44   6e-04
Suva_2.291 Chr2 (504722..508177) [3456 bp, 1151 aa] {ON} YDR128W...    44   7e-04
YCR057C Chr3 complement(220457..223228) [2772 bp, 923 aa] {ON}  ...    44   7e-04
KLLA0E21187g Chr5 (1892524..1893813) [1290 bp, 429 aa] {ON} simi...    43   8e-04
Ecym_4255 Chr4 (529455..532268) [2814 bp, 937 aa] {ON} similar t...    44   8e-04
KLTH0A06380g Chr1 complement(532367..535114) [2748 bp, 915 aa] {...    44   8e-04
SAKL0E03080g Chr5 (253338..254885) [1548 bp, 515 aa] {ON} highly...    43   8e-04
Ecym_5528 Chr5 complement(1070598..1072013) [1416 bp, 471 aa] {O...    43   8e-04
Kwal_14.884 s14 complement(95068..96255) [1188 bp, 395 aa] {ON} ...    43   8e-04
Kwal_23.6429 s23 complement(1577398..1579650) [2253 bp, 750 aa] ...    44   8e-04
TPHA0D04480 Chr4 complement(970967..974989) [4023 bp, 1340 aa] {...    44   0.001
SAKL0A00660g Chr1 (71855..73837) [1983 bp, 660 aa] {ON} some sim...    43   0.001
Ecym_6169 Chr6 complement(314473..316128) [1656 bp, 551 aa] {ON}...    43   0.001
KLTH0A07282g Chr1 complement(604949..607126) [2178 bp, 725 aa] {...    43   0.001
KLTH0H02772g Chr8 complement(248747..250009) [1263 bp, 420 aa] {...    43   0.001
Suva_13.270 Chr13 (435573..437114) [1542 bp, 513 aa] {ON} YMR093...    43   0.001
Kpol_1011.6 s1011 complement(17489..19777) [2289 bp, 762 aa] {ON...    43   0.001
TBLA0A02310 Chr1 (557822..559417) [1596 bp, 531 aa] {ON} Anc_6.2...    43   0.001
SAKL0B02244g Chr2 (212226..214547) [2322 bp, 773 aa] {ON} simila...    43   0.001
TDEL0F04150 Chr6 (765748..769152) [3405 bp, 1134 aa] {ON} Anc_8....    43   0.001
TBLA0C00990 Chr3 (195791..196972) [1182 bp, 393 aa] {ON} Anc_2.6...    43   0.001
Suva_5.178 Chr5 (266333..267301) [969 bp, 322 aa] {ON} YFL009W (...    42   0.001
Kpol_1016.11 s1016 (27192..29201) [2010 bp, 669 aa] {ON} (27192....    43   0.001
KNAG0B05550 Chr2 (1080707..1082560) [1854 bp, 617 aa] {ON} Anc_4...    43   0.001
KNAG0I00920 Chr9 (173033..174178) [1146 bp, 381 aa] {ON} Anc_8.3...    42   0.001
AFL007C Chr6 complement(424004..425659) [1656 bp, 551 aa] {ON} S...    43   0.001
ZYRO0C11242g Chr3 complement(871160..872170) [1011 bp, 336 aa] {...    42   0.001
Kpol_1028.23 s1028 (63032..65266) [2235 bp, 744 aa] {ON} (63032....    43   0.001
Skud_13.249 Chr13 (427918..429459) [1542 bp, 513 aa] {ON} YMR093...    42   0.001
TBLA0A03890 Chr1 complement(973249..974337) [1089 bp, 362 aa] {O...    42   0.002
YGR225W Chr7 (945145..946327,946421..947019) [1782 bp, 593 aa] {...    42   0.002
KNAG0C03850 Chr3 (753590..755101) [1512 bp, 503 aa] {ON} Anc_7.3...    42   0.002
NDAI0A01990 Chr1 (442919..444508) [1590 bp, 529 aa] {ON} Anc_7.3...    42   0.002
Skud_4.389 Chr4 (681326..684781) [3456 bp, 1151 aa] {ON} YDR128W...    42   0.002
KNAG0A03220 Chr1 complement(399879..401150) [1272 bp, 423 aa] {O...    42   0.002
CAGL0M02563g Chr13 complement(295156..296529) [1374 bp, 457 aa] ...    42   0.002
Ecym_8044 Chr8 (97649..98584) [936 bp, 311 aa] {ON} similar to A...    42   0.002
Ecym_4280 Chr4 complement(600066..603464) [3399 bp, 1132 aa] {ON...    42   0.002
ACR097W Chr3 (529784..531187) [1404 bp, 467 aa] {ON} Syntenic ho...    42   0.002
YDR128W Chr4 (709549..712995) [3447 bp, 1148 aa] {ON}  MTC5Subun...    42   0.002
YLR429W Chr12 (990777..992732) [1956 bp, 651 aa] {ON}  CRN1Coron...    42   0.002
KAFR0B05700 Chr2 complement(1176020..1177138) [1119 bp, 372 aa] ...    42   0.002
TDEL0A00410 Chr1 complement(70940..74728) [3789 bp, 1262 aa] {ON...    42   0.002
KLLA0F13772g Chr6 (1276532..1278094) [1563 bp, 520 aa] {ON} high...    42   0.002
AFL118W Chr6 (216252..216269,216423..218903) [2499 bp, 832 aa] {...    42   0.002
KLTH0D11132g Chr4 (910259..911572) [1314 bp, 437 aa] {ON} simila...    42   0.002
NDAI0B05190 Chr2 complement(1269217..1271223) [2007 bp, 668 aa] ...    42   0.002
Kwal_27.12667 s27 complement(1325822..1327987) [2166 bp, 721 aa]...    42   0.002
NDAI0A02880 Chr1 (644069..647938) [3870 bp, 1289 aa] {ON} Anc_7....    42   0.002
NCAS0B03550 Chr2 complement(627953..629080) [1128 bp, 375 aa] {O...    42   0.002
Smik_4.374 Chr4 (670748..674206) [3459 bp, 1152 aa] {ON} YDR128W...    42   0.002
TPHA0G01840 Chr7 complement(379782..381077) [1296 bp, 431 aa] {O...    42   0.003
CAGL0C03608g Chr3 (360681..362612) [1932 bp, 643 aa] {ON} simila...    42   0.003
NDAI0C05490 Chr3 (1275046..1277625) [2580 bp, 859 aa] {ON}             42   0.003
SAKL0A03872g Chr1 (361507..361524,361720..364338) [2637 bp, 878 ...    42   0.003
KAFR0C03830 Chr3 complement(776653..777798) [1146 bp, 381 aa] {O...    41   0.003
TBLA0D02630 Chr4 (645439..648027) [2589 bp, 862 aa] {ON} Anc_8.6...    42   0.003
TDEL0H00370 Chr8 complement(57487..58884) [1398 bp, 465 aa] {ON}...    42   0.003
CAGL0J03960g Chr10 complement(375780..377087) [1308 bp, 435 aa] ...    41   0.003
TBLA0A03750 Chr1 complement(937167..938510) [1344 bp, 447 aa] {O...    41   0.003
KAFR0I02860 Chr9 (573406..577503) [4098 bp, 1365 aa] {ON} Anc_3....    42   0.003
Smik_15.16 Chr15 complement(29410..33390) [3981 bp, 1326 aa] {ON...    42   0.003
TPHA0I03240 Chr9 (714446..715879) [1434 bp, 477 aa] {ON} Anc_7.5...    41   0.003
KLTH0C07634g Chr3 (654087..655364) [1278 bp, 425 aa] {ON} weakly...    41   0.003
TPHA0D01130 Chr4 (236199..237554) [1356 bp, 451 aa] {ON} Anc_8.6...    41   0.003
Skud_12.521 Chr12 (924571..926508) [1938 bp, 645 aa] {ON} YLR429...    41   0.004
Suva_13.280 Chr13 complement(451520..454051) [2532 bp, 843 aa] {...    41   0.004
NCAS0A04400 Chr1 (888188..890743) [2556 bp, 851 aa] {ON} Anc_2.4...    41   0.004
NCAS0C03990 Chr3 complement(804313..806505) [2193 bp, 730 aa] {O...    41   0.004
NCAS0B00480 Chr2 (69598..70968) [1371 bp, 456 aa] {ON} Anc_8.721       41   0.004
Ecym_2282 Chr2 complement(552170..553879) [1710 bp, 569 aa] {ON}...    41   0.004
NCAS0A07860 Chr1 (1563830..1565362) [1533 bp, 510 aa] {ON} Anc_2...    41   0.005
KNAG0F02420 Chr6 complement(453743..455668) [1926 bp, 641 aa] {O...    41   0.005
TPHA0E03760 Chr5 complement(791726..794116) [2391 bp, 796 aa] {O...    41   0.005
Kpol_1072.41 s1072 complement(90370..91632) [1263 bp, 420 aa] {O...    41   0.005
Smik_11.233 Chr11 complement(384291..385538) [1248 bp, 415 aa] {...    41   0.005
Kwal_56.24332 s56 (959476..960732) [1257 bp, 418 aa] {ON} YPL247...    41   0.005
NDAI0G03310 Chr7 complement(777538..780195) [2658 bp, 885 aa] {O...    41   0.005
YDR364C Chr4 complement(1202843..1204210) [1368 bp, 455 aa] {ON}...    41   0.005
KAFR0G01970 Chr7 complement(414143..415420) [1278 bp, 425 aa] {O...    41   0.005
TBLA0D04130 Chr4 (1027726..1029450) [1725 bp, 574 aa] {ON} Anc_7...    41   0.005
ZYRO0D06556g Chr4 complement(564778..568221) [3444 bp, 1147 aa] ...    41   0.005
Smik_15.414 Chr15 (720454..721767) [1314 bp, 437 aa] {ON} YOR230...    40   0.005
KLLA0F10791g Chr6 complement(991642..993279) [1638 bp, 545 aa] {...    41   0.005
CAGL0J08998g Chr10 (884779..888624) [3846 bp, 1281 aa] {ON} high...    41   0.006
KAFR0A03380 Chr1 (690272..692272) [2001 bp, 666 aa] {ON} Anc_1.2...    41   0.006
KAFR0H02260 Chr8 complement(430272..433088) [2817 bp, 938 aa] {O...    41   0.006
YFL009W Chr6 (116145..118484) [2340 bp, 779 aa] {ON}  CDC4F-box ...    41   0.006
KAFR0C04740 Chr3 complement(941929..943926) [1998 bp, 665 aa] {O...    40   0.006
Ecym_7373 Chr7 complement(776909..779269) [2361 bp, 786 aa] {ON}...    40   0.006
NCAS0B01430 Chr2 (233965..235317) [1353 bp, 450 aa] {ON}               40   0.006
NCAS0D04780 Chr4 (916321..918186) [1866 bp, 621 aa] {ON} Anc_6.363     40   0.006
Kpol_1058.31 s1058 (85899..87926) [2028 bp, 675 aa] {ON} (85899....    40   0.007
TDEL0A07780 Chr1 complement(1352017..1353990) [1974 bp, 657 aa] ...    40   0.007
TPHA0P00330 Chr16 (63488..65419) [1932 bp, 643 aa] {ON} Anc_8.67...    40   0.007
KNAG0B01610 Chr2 (294433..296457) [2025 bp, 674 aa] {ON} Anc_1.2...    40   0.007
KNAG0C04950 Chr3 (955701..957023) [1323 bp, 440 aa] {ON} Anc_5.4...    40   0.007
KLLA0E07965g Chr5 (717476..718648) [1173 bp, 390 aa] {ON} simila...    40   0.007
Smik_13.289 Chr13 complement(454351..456864) [2514 bp, 837 aa] {...    40   0.008
KNAG0G00130 Chr7 complement(8702..10888) [2187 bp, 728 aa] {ON} ...    40   0.008
KAFR0A00690 Chr1 complement(124349..125875) [1527 bp, 508 aa] {O...    40   0.008
YOR272W Chr15 (832813..834195) [1383 bp, 460 aa] {ON}  YTM1Const...    40   0.009
KLLA0E04093g Chr5 (371642..372760) [1119 bp, 372 aa] {ON} simila...    40   0.009
KLLA0F10263g Chr6 (949926..951974) [2049 bp, 682 aa] {ON} unipro...    40   0.009
YOR230W Chr15 (770800..772113) [1314 bp, 437 aa] {ON}  WTM1Trans...    40   0.010
Kwal_47.17567 s47 complement(459443..461215) [1773 bp, 590 aa] {...    40   0.010
ADL218C Chr4 complement(319674..320885) [1212 bp, 403 aa] {ON} S...    40   0.011
ZYRO0D08558g Chr4 (736975..739713) [2739 bp, 912 aa] {ON} highly...    40   0.011
KLTH0H02508g Chr8 complement(225069..225998) [930 bp, 309 aa] {O...    39   0.011
Ecym_3481 Chr3 complement(897444..898958) [1515 bp, 504 aa] {ON}...    40   0.011
Skud_13.261 Chr13 complement(445193..447697) [2505 bp, 834 aa] {...    40   0.011
YMR102C Chr13 complement(469848..472352) [2505 bp, 834 aa] {ON} ...    40   0.012
NCAS0H00700 Chr8 (125259..126152) [894 bp, 297 aa] {ON} Anc_7.33...    39   0.012
CAGL0E01485g Chr5 complement(139067..143077) [4011 bp, 1336 aa] ...    40   0.013
NCAS0G04300 Chr7 (799388..801565) [2178 bp, 725 aa] {ON} Anc_1.5...    40   0.013
TBLA0H03060 Chr8 complement(748221..750413) [2193 bp, 730 aa] {O...    40   0.013
KLTH0A00880g Chr1 complement(90125..91540) [1416 bp, 471 aa] {ON...    39   0.013
AGR067W Chr7 (842176..845553) [3378 bp, 1125 aa] {ON} Syntenic h...    40   0.013
NDAI0D02250 Chr4 complement(526907..529294) [2388 bp, 795 aa] {O...    40   0.013
SAKL0A10406g Chr1 (910452..912587) [2136 bp, 711 aa] {ON} simila...    40   0.014
YLR129W Chr12 (399657..402488) [2832 bp, 943 aa] {ON}  DIP2Nucle...    40   0.014
Smik_5.200 Chr5 (297829..299004) [1176 bp, 391 aa] {ON} YFL009W ...    39   0.015
NCAS0A14030 Chr1 complement(2760841..2762415) [1575 bp, 524 aa] ...    39   0.015
Smik_16.79 Chr16 complement(149712..150310,150409..151591) [1782...    39   0.015
TPHA0D00580 Chr4 (100671..102869) [2199 bp, 732 aa] {ON} Anc_8.6...    39   0.015
Kwal_56.23895 s56 complement(763257..764360) [1104 bp, 367 aa] {...    39   0.015
TDEL0C00940 Chr3 (150797..152719) [1923 bp, 640 aa] {ON} Anc_8.6...    39   0.016
ZYRO0F10406g Chr6 (843429..846245) [2817 bp, 938 aa] {ON} simila...    39   0.016
YOL138C Chr15 complement(61325..65350) [4026 bp, 1341 aa] {ON}  ...    39   0.016
Kpol_467.20 s467 complement(43262..43506,43751..45251) [1746 bp,...    39   0.016
Ecym_4249 Chr4 complement(516064..517188) [1125 bp, 374 aa] {ON}...    39   0.017
Smik_6.70 Chr6 (129582..131933) [2352 bp, 783 aa] {ON} YFL009W (...    39   0.017
TDEL0B07580 Chr2 (1329080..1330252) [1173 bp, 390 aa] {ON} Anc_2...    39   0.018
KNAG0C01410 Chr3 (277054..279015) [1962 bp, 653 aa] {ON} Anc_1.2...    39   0.018
TDEL0F04500 Chr6 (843307..846123) [2817 bp, 938 aa] {ON} Anc_8.3...    39   0.018
Smik_12.525 Chr12 (919777..921735) [1959 bp, 652 aa] {ON} YLR429...    39   0.019
TPHA0D04530 Chr4 complement(988612..989496) [885 bp, 294 aa] {ON...    39   0.019
CAGL0M08646g Chr13 (861488..862501) [1014 bp, 337 aa] {ON} simil...    39   0.020
TPHA0G01740 Chr7 complement(357600..358946) [1347 bp, 448 aa] {O...    39   0.020
KAFR0A06990 Chr1 complement(1405904..1408543,1408655..1408672) [...    39   0.021
Suva_10.545 Chr10 (945641..947569) [1929 bp, 642 aa] {ON} YLR429...    39   0.022
KNAG0F01840 Chr6 (348492..351227) [2736 bp, 911 aa] {ON} Anc_6.2...    39   0.022
Suva_15.22 Chr15 complement(39171..43181) [4011 bp, 1336 aa] {ON...    39   0.023
KLTH0A02750g Chr1 complement(239284..241545) [2262 bp, 753 aa] {...    39   0.023
Suva_8.321 Chr8 (572329..573711) [1383 bp, 460 aa] {ON} YOR272W ...    39   0.024
KAFR0G01890 Chr7 (400922..402274) [1353 bp, 450 aa] {ON}               39   0.024
Suva_8.281 Chr8 (509873..511183) [1311 bp, 436 aa] {ON} YOR230W ...    39   0.024
Kwal_14.1710 s14 (433526..435250) [1725 bp, 574 aa] {ON} YGL116W...    39   0.024
Kpol_1031.36 s1031 complement(87105..89225) [2121 bp, 706 aa] {O...    39   0.025
Skud_2.324 Chr2 complement(583774..586182) [2409 bp, 802 aa] {ON...    39   0.026
Skud_15.437 Chr15 (771566..772951) [1386 bp, 461 aa] {ON} YOR272...    39   0.028
Smik_7.135 Chr7 (244035..244445,244446..246698) [2664 bp, 887 aa...    39   0.028
NDAI0E01330 Chr5 complement(266071..267363) [1293 bp, 430 aa] {O...    39   0.028
TBLA0D04020 Chr4 complement(997081..1000617) [3537 bp, 1178 aa] ...    39   0.028
Kwal_23.5035 s23 (975572..977806) [2235 bp, 744 aa] {ON} YFL009W...    39   0.030
ZYRO0G03146g Chr7 complement(238354..239886) [1533 bp, 510 aa] {...    38   0.031
YBR198C Chr2 complement(616127..618523) [2397 bp, 798 aa] {ON}  ...    39   0.031
NCAS0C04430 Chr3 complement(905927..909862) [3936 bp, 1311 aa] {...    39   0.032
Suva_4.452 Chr4 complement(786121..788523) [2403 bp, 800 aa] {ON...    39   0.033
Suva_7.127 Chr7 (246249..246659,246660..248924) [2676 bp, 891 aa...    39   0.033
Kwal_23.5351 s23 (1122565..1123989) [1425 bp, 474 aa] {ON} YPR17...    38   0.033
AEL314W Chr5 (52978..55125) [2148 bp, 715 aa] {ON} Syntenic homo...    38   0.034
NDAI0I00880 Chr9 complement(203097..205763) [2667 bp, 888 aa] {O...    38   0.034
Skud_6.63 Chr6 (118478..120823) [2346 bp, 781 aa] {ON} YFL009W (...    38   0.035
KAFR0C03190 Chr3 complement(639680..641698) [2019 bp, 672 aa] {O...    38   0.035
TBLA0B04070 Chr2 complement(930877..932130) [1254 bp, 417 aa] {O...    38   0.035
KNAG0G02450 Chr7 (557570..560398) [2829 bp, 942 aa] {ON} Anc_8.3...    38   0.036
TPHA0F03650 Chr6 (793481..795703) [2223 bp, 740 aa] {ON} Anc_1.5...    38   0.037
Suva_8.265 Chr8 (481783..483054) [1272 bp, 423 aa] {ON} YOR212W ...    38   0.038
Smik_12.192 Chr12 (380993..383824) [2832 bp, 943 aa] {ON} YLR129...    38   0.038
SAKL0F08404g Chr6 complement(640436..642367) [1932 bp, 643 aa] {...    38   0.039
SAKL0H15532g Chr8 complement(1351712..1354537) [2826 bp, 941 aa]...    38   0.039
NDAI0E00910 Chr5 complement(182574..183968) [1395 bp, 464 aa] {O...    38   0.040
Kpol_1013.37 s1013 complement(88637..88936,88986..88994,89037..9...    38   0.040
Kpol_1002.101 s1002 complement(252330..254240) [1911 bp, 636 aa]...    38   0.042
CAGL0B01529g Chr2 (137174..138283) [1110 bp, 369 aa] {ON} highly...    38   0.043
Kpol_1033.19 s1033 (40266..43685) [3420 bp, 1139 aa] {ON} (40266...    38   0.045
KNAG0E02470 Chr5 (490378..491907) [1530 bp, 509 aa] {ON} Anc_2.4...    38   0.047
SAKL0H07656g Chr8 complement(659189..660469) [1281 bp, 426 aa] {...    38   0.047
TDEL0E05480 Chr5 complement(1002913..1005540,1005640..1005657) [...    38   0.047
ZYRO0D05852g Chr4 (498219..499334) [1116 bp, 371 aa] {ON} simila...    37   0.048
Suva_10.222 Chr10 (408217..411048) [2832 bp, 943 aa] {ON} YLR129...    38   0.048
Kwal_55.21450 s55 (842483..843994) [1512 bp, 503 aa] {ON} YDR364...    38   0.048
TBLA0I01220 Chr9 (261925..263460) [1536 bp, 511 aa] {ON} Anc_2.4...    38   0.049
CAGL0M04279g Chr13 (469040..471862) [2823 bp, 940 aa] {ON} highl...    38   0.050
SAKL0H05456g Chr8 complement(490546..491886) [1341 bp, 446 aa] {...    37   0.050
KAFR0E03180 Chr5 (637055..639499) [2445 bp, 814 aa] {ON} Anc_8.5...    38   0.051
KAFR0D03060 Chr4 (604145..606625) [2481 bp, 826 aa] {ON} Anc_2.4...    38   0.051
Suva_7.518 Chr7 (899625..900807,900908..901506) [1782 bp, 593 aa...    38   0.054
KLLA0D02530g Chr4 complement(212703..214826) [2124 bp, 707 aa] {...    38   0.055
ZYRO0D16742g Chr4 complement(1385330..1387156) [1827 bp, 608 aa]...    37   0.055
Kpol_1064.35 s1064 (64223..65584) [1362 bp, 453 aa] {ON} (64223....    37   0.055
TBLA0A03950 Chr1 (986923..989733) [2811 bp, 936 aa] {ON} Anc_8.3...    38   0.057
SAKL0G19668g Chr7 (1695030..1696214) [1185 bp, 394 aa] {ON} simi...    37   0.057
CAGL0F06853g Chr6 (671942..673108) [1167 bp, 388 aa] {ON} highly...    37   0.057
SAKL0H07150g Chr8 complement(626019..627341,627428..627430) [132...    37   0.060
Suva_6.51 Chr6 (88465..90756) [2292 bp, 763 aa] {ON} YFL009W (REAL)    37   0.061
YOR212W Chr15 (742910..744181) [1272 bp, 423 aa] {ON}  STE4G pro...    37   0.062
ZYRO0F06776g Chr6 (555965..557263) [1299 bp, 432 aa] {ON} simila...    37   0.063
Skud_11.7 Chr11 complement(15413..17566) [2154 bp, 717 aa] {ON} ...    37   0.065
TBLA0B03570 Chr2 complement(828308..829684) [1377 bp, 458 aa] {O...    37   0.067
Skud_15.396 Chr15 (709746..711059) [1314 bp, 437 aa] {ON} YOR230...    37   0.068
Skud_7.135 Chr7 (254246..254263,254479..257154) [2694 bp, 897 aa...    37   0.071
CAGL0K11836g Chr11 complement(1143042..1144610) [1569 bp, 522 aa...    37   0.071
KLTH0H06160g Chr8 complement(538741..540465) [1725 bp, 574 aa] {...    37   0.072
TPHA0B00590 Chr2 complement(134906..136672) [1767 bp, 588 aa] {O...    37   0.073
TPHA0C01050 Chr3 complement(235500..238874) [3375 bp, 1124 aa] {...    37   0.074
KLLA0B12804g Chr2 (1117475..1120033) [2559 bp, 852 aa] {ON} simi...    37   0.075
CAGL0G04345g Chr7 (408842..410977) [2136 bp, 711 aa] {ON} simila...    37   0.080
ACR166W Chr3 (647933..649102) [1170 bp, 389 aa] {ON} Syntenic ho...    37   0.080
CAGL0L02761g Chr12 complement(322823..324082) [1260 bp, 419 aa] ...    37   0.083
CAGL0E00561g Chr5 (49987..52497) [2511 bp, 836 aa] {ON} some sim...    37   0.085
NDAI0H02330 Chr8 complement(564240..567221) [2982 bp, 993 aa] {O...    37   0.085
Kwal_33.15591 s33 (1174119..1176263) [2145 bp, 714 aa] {ON} YKL2...    37   0.085
NDAI0H02240 Chr8 complement(545073..546617) [1545 bp, 514 aa] {O...    37   0.086
Ecym_8090 Chr8 (194643..196793) [2151 bp, 716 aa] {ON} similar t...    37   0.087
ZYRO0E07392g Chr5 complement(564166..566841,567011..567028) [269...    37   0.090
KNAG0B06450 Chr2 complement(1274888..1276792) [1905 bp, 634 aa] ...    37   0.095
TPHA0O00710 Chr15 (135136..136050) [915 bp, 304 aa] {ON} Anc_1.3...    36   0.097
KAFR0E00180 Chr5 complement(35535..37721) [2187 bp, 728 aa] {ON}...    37   0.099
AGL196C Chr7 complement(328838..331645) [2808 bp, 935 aa] {ON} S...    37   0.10 
KLLA0D07546g Chr4 complement(647984..649927) [1944 bp, 647 aa] {...    37   0.11 
KAFR0A04110 Chr1 (826618..828000) [1383 bp, 460 aa] {ON} Anc_8.7...    37   0.11 
KNAG0D02720 Chr4 complement(489642..494267) [4626 bp, 1541 aa] {...    37   0.11 
SAKL0G16962g Chr7 (1463359..1463363,1463442..1465290) [1854 bp, ...    37   0.11 
AAR078W Chr1 (483989..485677) [1689 bp, 562 aa] {ON} Syntenic ho...    37   0.11 
TDEL0A06650 Chr1 (1160677..1162032) [1356 bp, 451 aa] {ON} Anc_8...    37   0.11 
ZYRO0A12980g Chr1 (1025863..1028337) [2475 bp, 824 aa] {ON} simi...    37   0.12 
KLTH0E12606g Chr5 (1120419..1122686) [2268 bp, 755 aa] {ON} simi...    37   0.12 
Kpol_487.7 s487 complement(37021..37932) [912 bp, 303 aa] {ON} c...    36   0.12 
TPHA0J02540 Chr10 complement(561110..563710) [2601 bp, 866 aa] {...    37   0.12 
TBLA0A06060 Chr1 (1493832..1493849,1494107..1496755) [2667 bp, 8...    37   0.12 
Smik_15.398 Chr15 (692606..693883) [1278 bp, 425 aa] {ON} YOR212...    36   0.13 
TBLA0D03580 Chr4 complement(885182..887353) [2172 bp, 723 aa] {O...    37   0.13 
KLTH0D10648g Chr4 (875331..875337,875409..876751) [1350 bp, 449 ...    36   0.13 
Smik_2.338 Chr2 complement(602610..605012) [2403 bp, 800 aa] {ON...    36   0.13 
KAFR0G01900 Chr7 (403294..404574) [1281 bp, 426 aa] {ON}               36   0.13 
TDEL0H02130 Chr8 (362711..364465) [1755 bp, 584 aa] {ON} Anc_7.2...    36   0.14 
TBLA0B07430 Chr2 complement(1767976..1768574,1768681..1770475) [...    36   0.14 
TBLA0G02090 Chr7 (545989..547911) [1923 bp, 640 aa] {ON} Anc_4.3...    36   0.15 
NCAS0F01450 Chr6 complement(287070..289796) [2727 bp, 908 aa] {O...    36   0.15 
NCAS0D04050 Chr4 (760598..762865) [2268 bp, 755 aa] {ON}               36   0.15 
KLLA0A04928g Chr1 (439349..441934) [2586 bp, 861 aa] {ON} simila...    36   0.15 
Skud_12.198 Chr12 (382439..385270) [2832 bp, 943 aa] {ON} YLR129...    36   0.15 
ZYRO0F09372g Chr6 (761606..762952) [1347 bp, 448 aa] {ON} highly...    36   0.15 
NDAI0J02490 Chr10 complement(613859..615748) [1890 bp, 629 aa] {...    36   0.15 
KNAG0H01290 Chr8 (227947..229341) [1395 bp, 464 aa] {ON} Anc_3.2...    36   0.15 
NDAI0C05770 Chr3 complement(1328677..1329684) [1008 bp, 335 aa] ...    36   0.16 
KNAG0G01080 Chr7 (235280..237520) [2241 bp, 746 aa] {ON}  YER066W      36   0.16 
NDAI0D04730 Chr4 (1109256..1111241) [1986 bp, 661 aa] {ON} Anc_4...    36   0.16 
KNAG0J02460 Chr10 complement(465585..466361) [777 bp, 258 aa] {O...    35   0.16 
KAFR0B00940 Chr2 (172801..174357) [1557 bp, 518 aa] {ON} Anc_7.3...    36   0.17 
KNAG0H01690 Chr8 (301564..302475) [912 bp, 303 aa] {ON} Anc_1.39...    35   0.17 
TPHA0N01850 Chr14 (393690..394910) [1221 bp, 406 aa] {ON} Anc_2....    36   0.18 
Ecym_2401 Chr2 complement(781043..782323) [1281 bp, 426 aa] {ON}...    36   0.18 
AER448W Chr5 (1497416..1499560) [2145 bp, 714 aa] {ON} Syntenic ...    36   0.18 
Suva_13.269 Chr13 complement(433166..435016) [1851 bp, 616 aa] {...    36   0.18 
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    36   0.18 
KAFR0F02590 Chr6 complement(504740..506842) [2103 bp, 700 aa] {O...    36   0.19 
TBLA0C04110 Chr3 complement(994729..997278) [2550 bp, 849 aa] {O...    36   0.19 
YKL021C Chr11 complement(397344..398750) [1407 bp, 468 aa] {ON} ...    36   0.19 
KLLA0E04819g Chr5 (428278..429657) [1380 bp, 459 aa] {ON} simila...    36   0.19 
Kwal_26.8700 s26 (902915..904060) [1146 bp, 381 aa] {ON} YOR229W...    35   0.20 
TDEL0B03020 Chr2 complement(534847..537342) [2496 bp, 831 aa] {O...    36   0.20 
Smik_15.454 Chr15 (782403..783788) [1386 bp, 461 aa] {ON} YOR272...    36   0.20 
KAFR0A00700 Chr1 (126326..128149) [1824 bp, 607 aa] {ON} Anc_2.4...    36   0.21 
TDEL0C02130 Chr3 (366855..368435) [1581 bp, 526 aa] {ON} Anc_7.3...    35   0.21 
NCAS0I01270 Chr9 (229975..230754) [780 bp, 259 aa] {ON} Anc_3.33...    35   0.21 
SAKL0D03740g Chr4 (303240..304676) [1437 bp, 478 aa] {ON} simila...    35   0.22 
KNAG0F03870 Chr6 complement(731884..733281) [1398 bp, 465 aa] {O...    35   0.22 
Skud_4.401 Chr4 complement(712131..713261) [1131 bp, 376 aa] {ON...    35   0.23 
CAGL0A02772g Chr1 complement(293966..295291) [1326 bp, 441 aa] {...    35   0.24 
Kwal_56.23035 s56 complement(373146..374420) [1275 bp, 424 aa] {...    35   0.24 
CAGL0L10890g Chr12 (1165380..1166753) [1374 bp, 457 aa] {ON} hig...    35   0.26 
Skud_15.379 Chr15 (681934..683211) [1278 bp, 425 aa] {ON} YOR212...    35   0.27 
NCAS0I02490 Chr9 complement(465916..467796) [1881 bp, 626 aa] {O...    35   0.28 
TPHA0F00550 Chr6 complement(127250..129736) [2487 bp, 828 aa] {O...    35   0.28 
CAGL0H08932g Chr8 (871668..871685,872089..874779) [2709 bp, 902 ...    35   0.28 
CAGL0K00275g Chr11 complement(26129..28276) [2148 bp, 715 aa] {O...    35   0.28 
Kpol_1012.5 s1012 (8531..8920,8923..9909) [1377 bp, 458 aa] {ON}...    35   0.29 
KNAG0H00180 Chr8 complement(26550..27719) [1170 bp, 389 aa] {ON}...    35   0.29 
CAGL0J01287g Chr10 (120215..122047) [1833 bp, 610 aa] {ON} simil...    35   0.30 
Suva_11.7 Chr11 complement(15456..17615) [2160 bp, 719 aa] {ON} ...    35   0.31 
Kpol_1002.36 s1002 (110010..112229) [2220 bp, 739 aa] {ON} (1100...    35   0.32 
NCAS0J01860 Chr10 (350125..352011) [1887 bp, 628 aa] {ON} Anc_4....    35   0.32 
Kpol_1001.23 s1001 complement(63130..64962) [1833 bp, 610 aa] {O...    35   0.32 
ADL082C Chr4 complement(538945..540654) [1710 bp, 569 aa] {ON} S...    35   0.32 
KAFR0A05610 Chr1 complement(1126349..1128211) [1863 bp, 620 aa] ...    35   0.33 
TBLA0B04390 Chr2 (1014987..1015997) [1011 bp, 336 aa] {ON} Anc_8...    35   0.33 
Ecym_5635 Chr5 (1285780..1286937) [1158 bp, 385 aa] {ON} similar...    35   0.34 
ACR194C Chr3 complement(690186..691727) [1542 bp, 513 aa] {ON} S...    35   0.34 
KNAG0H00450 Chr8 (70320..72755) [2436 bp, 811 aa] {ON} Anc_2.613...    35   0.36 
KNAG0G02820 Chr7 (623677..625050) [1374 bp, 457 aa] {ON} Anc_8.7...    35   0.36 
NCAS0H03530 Chr8 (671246..672400) [1155 bp, 384 aa] {ON} Anc_2.663     35   0.37 
NDAI0C00170 Chr3 complement(24683..25888) [1206 bp, 401 aa] {ON}...    35   0.37 
TPHA0G01610 Chr7 complement(332529..333773) [1245 bp, 414 aa] {O...    35   0.37 
NDAI0A00340 Chr1 (50320..53166) [2847 bp, 948 aa] {ON} Anc_1.34 ...    35   0.38 
YKL213C Chr11 complement(31960..34107) [2148 bp, 715 aa] {ON}  D...    35   0.39 
KNAG0A03700 Chr1 complement(477870..480323) [2454 bp, 817 aa] {O...    35   0.39 
TPHA0B04250 Chr2 complement(995664..997187) [1524 bp, 507 aa] {O...    35   0.39 
Kpol_2000.39 s2000 complement(76168..77499) [1332 bp, 443 aa] {O...    35   0.40 
SAKL0G15994g Chr7 complement(1374780..1377614) [2835 bp, 944 aa]...    35   0.40 
NCAS0A13430 Chr1 complement(2641588..2643414) [1827 bp, 608 aa] ...    35   0.41 
TPHA0I00460 Chr9 (89882..91564) [1683 bp, 560 aa] {ON} Anc_8.817...    35   0.46 
KLLA0C07425g Chr3 complement(647673..649007) [1335 bp, 444 aa] {...    35   0.46 
CAGL0L02629g Chr12 complement(309320..311707) [2388 bp, 795 aa] ...    35   0.47 
NDAI0E01500 Chr5 complement(295871..297157) [1287 bp, 428 aa] {O...    34   0.47 
KLLA0E18899g Chr5 (1680775..1683747) [2973 bp, 990 aa] {ON} simi...    35   0.48 
SAKL0E03520g Chr5 complement(283754..286654) [2901 bp, 966 aa] {...    35   0.50 
KAFR0A00600 Chr1 (108157..110841) [2685 bp, 894 aa] {ON} Anc_2.4...    35   0.52 
ADL322C Chr4 complement(128828..130333) [1506 bp, 501 aa] {ON} S...    34   0.52 
NDAI0A02610 Chr1 (585697..588000) [2304 bp, 767 aa] {ON} Anc_7.231     35   0.52 
TPHA0M02000 Chr13 complement(414262..416361) [2100 bp, 699 aa] {...    34   0.52 
TPHA0C00810 Chr3 complement(158582..161395) [2814 bp, 937 aa] {O...    35   0.52 
KNAG0E02400 Chr5 (477698..480430) [2733 bp, 910 aa] {ON} Anc_2.4...    35   0.54 
YMR049C Chr13 complement(368094..370517) [2424 bp, 807 aa] {ON} ...    34   0.55 
TPHA0G02500 Chr7 (515975..518812) [2838 bp, 945 aa] {ON} Anc_2.4...    34   0.58 
TBLA0F00520 Chr6 complement(134791..136782) [1992 bp, 663 aa] {O...    34   0.58 
Ecym_8317 Chr8 (648256..649527) [1272 bp, 423 aa] {ON} similar t...    34   0.58 
KAFR0G01610 Chr7 complement(355067..355843) [777 bp, 258 aa] {ON...    34   0.59 
Suva_10.316 Chr10 complement(551612..554068) [2457 bp, 818 aa] {...    34   0.59 
NDAI0G00150 Chr7 complement(18719..20887) [2169 bp, 722 aa] {ON}...    34   0.60 
TDEL0A02460 Chr1 (439489..441321) [1833 bp, 610 aa] {ON} Anc_2.4...    34   0.66 
ZYRO0C14564g Chr3 (1135755..1137491) [1737 bp, 578 aa] {ON} simi...    34   0.66 
SAKL0F15972g Chr6 (1291625..1293037) [1413 bp, 470 aa] {ON} simi...    34   0.67 
KLTH0C09636g Chr3 (800421..802229) [1809 bp, 602 aa] {ON} weakly...    34   0.68 
ZYRO0F11484g Chr6 complement(943018..943902) [885 bp, 294 aa] {O...    33   0.69 
Kwal_26.7738 s26 (493416..495251) [1836 bp, 611 aa] {ON} YMR092C...    34   0.69 
Skud_12.285 Chr12 complement(525831..528284) [2454 bp, 817 aa] {...    34   0.69 
Smik_13.276 Chr13 complement(435512..437359) [1848 bp, 615 aa] {...    34   0.74 
TBLA0I02570 Chr9 (597481..600027) [2547 bp, 848 aa] {ON} Anc_8.7...    34   0.76 
KLLA0E19515g Chr5 complement(1733708..1735426) [1719 bp, 572 aa]...    34   0.78 
ZYRO0B13838g Chr2 (1121025..1123079) [2055 bp, 684 aa] {ON} some...    34   0.79 
CAGL0K03377g Chr11 complement(307358..310294) [2937 bp, 978 aa] ...    34   0.80 
KLTH0A04114g Chr1 complement(344618..346594) [1977 bp, 658 aa] {...    34   0.80 
KLLA0E18877g Chr5 complement(1676876..1680310) [3435 bp, 1144 aa...    34   0.83 
Kpol_2002.33 s2002 (67641..69998) [2358 bp, 785 aa] {ON} (67641....    34   0.83 
TDEL0G01280 Chr7 complement(258957..259555,259626..260934) [1908...    34   0.83 
Ecym_7028 Chr7 (52132..52136,52211..54083) [1878 bp, 625 aa] {ON...    34   0.84 
NCAS0A03470 Chr1 (684361..686811) [2451 bp, 816 aa] {ON} Anc_4.106     34   0.84 
Kpol_1070.11 s1070 (30012..32012) [2001 bp, 666 aa] {ON} (30012....    34   0.85 
ZYRO0B15268g Chr2 complement(1243795..1244396,1244475..1245684) ...    34   0.87 
ABR101C Chr2 complement(567358..569841) [2484 bp, 827 aa] {ON} S...    34   0.87 
KLLA0E24487g Chr5 complement(2175775..2176758) [984 bp, 327 aa] ...    33   0.88 
CAGL0I03454g Chr9 (292823..293734) [912 bp, 303 aa] {ON} similar...    33   0.90 
YIL046W Chr9 (268651..270573) [1923 bp, 640 aa] {ON}  MET30F-box...    33   0.90 
NDAI0F04030 Chr6 complement(958364..959839) [1476 bp, 491 aa] {O...    33   0.93 
KLTH0F02948g Chr6 (254134..255333) [1200 bp, 399 aa] {ON} weakly...    33   0.95 
Skud_14.321 Chr14 (586864..587775) [912 bp, 303 aa] {ON} YNL006W...    33   0.95 
KLLA0D16390g Chr4 (1378884..1381694) [2811 bp, 936 aa] {ON} simi...    33   0.97 
NCAS0A09610 Chr1 complement(1920171..1922258) [2088 bp, 695 aa] ...    33   0.98 
NDAI0J02410 Chr10 complement(586395..589244) [2850 bp, 949 aa] {...    33   1.0  
CAGL0E02805g Chr5 complement(265374..267896) [2523 bp, 840 aa] {...    33   1.0  
Kwal_26.8975 s26 (1026741..1028078) [1338 bp, 445 aa] {ON} YOR27...    33   1.0  
TBLA0E00790 Chr5 (173409..174362) [954 bp, 317 aa] {ON} Anc_7.53...    33   1.0  
SAKL0E03058g Chr5 complement(251271..253112) [1842 bp, 613 aa] {...    33   1.0  
Ecym_8336 Chr8 (677880..679250) [1371 bp, 456 aa] {ON} similar t...    33   1.0  
YGL137W Chr7 (249869..249886,250087..252738) [2670 bp, 889 aa] {...    33   1.1  
KAFR0I01050 Chr9 complement(205792..208320) [2529 bp, 842 aa] {O...    33   1.1  
Smik_9.144 Chr9 (242718..244610) [1893 bp, 630 aa] {ON} YIL046W ...    33   1.1  
TDEL0A02260 Chr1 (409508..412027) [2520 bp, 839 aa] {ON} Anc_2.4...    33   1.1  
TBLA0G03080 Chr7 complement(817595..818923) [1329 bp, 442 aa] {O...    33   1.1  
KNAG0C02890 Chr3 (571926..574418) [2493 bp, 830 aa] {ON} Anc_4.1...    33   1.2  
KLLA0F26653g Chr6 (2461876..2464251) [2376 bp, 791 aa] {ON} simi...    33   1.2  
Smik_4.631 Chr4 complement(1128746..1130113) [1368 bp, 455 aa] {...    33   1.2  
NDAI0E03440 Chr5 complement(735469..738042) [2574 bp, 857 aa] {O...    33   1.2  
Kwal_56.24163 s56 complement(879667..881856) [2190 bp, 729 aa] {...    33   1.2  
Ecym_2287 Chr2 (558921..561386) [2466 bp, 821 aa] {ON} similar t...    33   1.3  
TPHA0G00680 Chr7 complement(127929..129302) [1374 bp, 457 aa] {O...    33   1.4  
AGR168W Chr7 (1061516..1063993) [2478 bp, 825 aa] {ON} Syntenic ...    33   1.4  
TPHA0F02890 Chr6 complement(640553..641440) [888 bp, 295 aa] {ON...    33   1.4  
TBLA0D05560 Chr4 complement(1366222..1367991) [1770 bp, 589 aa] ...    33   1.4  
AER114W Chr5 (850726..850730,850789..852685) [1902 bp, 633 aa] {...    33   1.4  
CAGL0A04037g Chr1 complement(404063..405814) [1752 bp, 583 aa] {...    33   1.5  
Skud_4.634 Chr4 complement(1131614..1132978) [1365 bp, 454 aa] {...    33   1.5  
TBLA0E04570 Chr5 (1163562..1165349) [1788 bp, 595 aa] {ON} Anc_4...    33   1.5  
KLTH0E07700g Chr5 (705358..707778) [2421 bp, 806 aa] {ON} simila...    33   1.5  
Smik_12.279 Chr12 complement(526367..528820) [2454 bp, 817 aa] {...    33   1.6  
Ecym_2093 Chr2 (165578..168349) [2772 bp, 923 aa] {ON} similar t...    33   1.6  
Smik_15.413 Chr15 (718053..719462) [1410 bp, 469 aa] {ON} YOR229...    33   1.6  
TBLA0A01870 Chr1 (455007..458021) [3015 bp, 1004 aa] {ON} Anc_6....    33   1.6  
KAFR0I00500 Chr9 complement(104685..106268) [1584 bp, 527 aa] {O...    33   1.6  
Kpol_262.1 s262 (224..2131) [1908 bp, 635 aa] {ON} (224..2131) [...    33   1.6  
CAGL0L00781g Chr12 (97503..99524) [2022 bp, 673 aa] {ON} similar...    33   1.7  
TPHA0F03030 Chr6 complement(661801..663549) [1749 bp, 582 aa] {O...    33   1.7  
Kwal_27.11585 s27 (859952..862423) [2472 bp, 823 aa] {ON} YLR222...    33   1.7  
TDEL0F02410 Chr6 complement(447058..449568) [2511 bp, 836 aa] {O...    33   1.8  
KAFR0B00370 Chr2 complement(83264..84649) [1386 bp, 461 aa] {ON}...    33   1.8  
Suva_2.537 Chr2 complement(959258..960625) [1368 bp, 455 aa] {ON...    33   1.8  
NDAI0K01410 Chr11 (321553..324486) [2934 bp, 977 aa] {ON} Anc_2....    33   1.9  
KLLA0C01177g Chr3 (89978..92131) [2154 bp, 717 aa] {ON} similar ...    33   1.9  
TDEL0B02010 Chr2 complement(355418..357835) [2418 bp, 805 aa] {O...    33   2.0  
Kpol_1061.6 s1061 complement(19407..20762) [1356 bp, 451 aa] {ON...    32   2.0  
KLTH0D05368g Chr4 (479606..481438) [1833 bp, 610 aa] {ON} simila...    32   2.0  
NCAS0B07840 Chr2 complement(1486900..1488669) [1770 bp, 589 aa] ...    32   2.0  
TDEL0D01090 Chr4 complement(204076..206004) [1929 bp, 642 aa] {O...    32   2.1  
Skud_9.123 Chr9 (237466..239385) [1920 bp, 639 aa] {ON} YIL046W ...    32   2.1  
Kwal_56.22681 s56 complement(232799..234571) [1773 bp, 590 aa] {...    32   2.1  
Suva_9.154 Chr9 (257284..259200) [1917 bp, 638 aa] {ON} YIL046W ...    32   2.1  
Kwal_26.7736 s26 complement(491687..493210) [1524 bp, 507 aa] {O...    32   2.1  
Ecym_4134 Chr4 complement(280146..282578) [2433 bp, 810 aa] {ON}...    32   2.2  
Kpol_1036.65 s1036 complement(180839..181954) [1116 bp, 371 aa] ...    32   2.2  
KLTH0H01122g Chr8 (113798..115537) [1740 bp, 579 aa] {ON} simila...    32   2.2  
CAGL0J03806g Chr10 (363777..365039) [1263 bp, 420 aa] {ON} simil...    32   2.3  
Skud_13.248 Chr13 complement(425542..427389) [1848 bp, 615 aa] {...    32   2.3  
Ecym_7229 Chr7 (475040..477529) [2490 bp, 829 aa] {ON} similar t...    32   2.3  
CAGL0L06578g Chr12 complement(741735..742333,742449..743709) [18...    32   2.4  
SAKL0B11836g Chr2 complement(1020766..1023195) [2430 bp, 809 aa]...    32   2.4  
Suva_11.205 Chr11 complement(381101..382348) [1248 bp, 415 aa] {...    32   2.4  
Kpol_1057.12 s1057 (22322..23515) [1194 bp, 397 aa] {ON} (22322....    32   2.4  
CAGL0C00737g Chr3 complement(75028..77478) [2451 bp, 816 aa] {ON...    32   2.4  
TBLA0A05690 Chr1 (1412275..1413546) [1272 bp, 423 aa] {ON} Anc_1...    32   2.5  
Kpol_1036.69 s1036 (189457..192267) [2811 bp, 936 aa] {ON} (1894...    32   2.5  
Kwal_47.17206 s47 complement(299680..300366) [687 bp, 228 aa] {O...    32   2.6  
KAFR0D01700 Chr4 complement(339178..340785) [1608 bp, 535 aa] {O...    32   2.6  
KNAG0L00330 Chr12 (45380..47014) [1635 bp, 544 aa] {ON} Anc_8.43...    32   2.7  
Suva_14.89 Chr14 (164766..166034) [1269 bp, 422 aa] {ON} YNL253W...    32   2.8  
Skud_15.395 Chr15 (707395..708789) [1395 bp, 464 aa] {ON} YOR229...    32   2.9  
KLTH0E08096g Chr5 complement(743809..745041) [1233 bp, 410 aa] {...    32   2.9  
NDAI0C02600 Chr3 complement(605643..606554) [912 bp, 303 aa] {ON}      32   2.9  
NCAS0A05520 Chr1 complement(1085200..1087215) [2016 bp, 671 aa] ...    32   3.0  
Suva_3.173 Chr3 (262525..262587,262614..264791) [2241 bp, 746 aa...    32   3.0  
KNAG0J01680 Chr10 (307280..308476) [1197 bp, 398 aa] {ON} Anc_8....    32   3.0  
NDAI0G03810 Chr7 complement(911595..915776) [4182 bp, 1393 aa] {...    32   3.0  
Skud_13.39 Chr13 (67722..69146) [1425 bp, 474 aa] {ON} YML102W (...    32   3.0  
NDAI0G05340 Chr7 (1301733..1303889) [2157 bp, 718 aa] {ON} Anc_1...    32   3.2  
KLLA0D07282g Chr4 (621115..622467) [1353 bp, 450 aa] {ON} simila...    32   3.2  
Smik_3.37 Chr3 (53956..56256) [2301 bp, 766 aa] {ON} YCL039W (REAL)    32   3.3  
Kpol_1018.164 s1018 (420666..423203) [2538 bp, 845 aa] {ON} (420...    32   3.4  
Kwal_33.13148 s33 (94593..96614) [2022 bp, 673 aa] {ON} YCL039W ...    32   3.4  
Ecym_7339 Chr7 (710796..711818) [1023 bp, 340 aa] {ON} similar t...    32   3.5  
KLLA0F26114g Chr6 (2420635..2421810) [1176 bp, 391 aa] {ON} high...    32   3.6  
Suva_2.181 Chr2 complement(312873..314396) [1524 bp, 507 aa] {ON...    32   3.6  
NDAI0C00390 Chr3 complement(63036..65537) [2502 bp, 833 aa] {ON}...    32   3.7  
KLTH0D15840g Chr4 (1305121..1305125,1305195..1307283) [2094 bp, ...    32   3.7  
TBLA0B04000 Chr2 complement(913726..915084) [1359 bp, 452 aa] {O...    32   3.7  
Suva_7.74 Chr7 complement(141302..142891) [1590 bp, 529 aa] {ON}...    32   3.8  
Suva_13.218 Chr13 complement(352704..355115) [2412 bp, 803 aa] {...    32   3.8  
Kwal_56.23920 s56 (776647..779460) [2814 bp, 937 aa] {ON} YLR129...    32   3.8  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...    32   3.9  
Skud_11.207 Chr11 complement(378222..379469) [1248 bp, 415 aa] {...    32   4.0  
TPHA0A03680 Chr1 complement(804355..806004) [1650 bp, 549 aa] {O...    32   4.0  
TPHA0C01150 Chr3 (263944..266007) [2064 bp, 687 aa] {ON} Anc_7.2...    32   4.0  
Ecym_3619 Chr3 (1183531..1185666) [2136 bp, 711 aa] {ON} similar...    32   4.2  
NCAS0B01660 Chr2 complement(270046..271320) [1275 bp, 424 aa] {O...    31   4.3  
YMR092C Chr13 complement(451632..453479) [1848 bp, 615 aa] {ON} ...    32   4.3  
NCAS0B04470 Chr2 complement(811894..813396) [1503 bp, 500 aa] {O...    31   4.5  
Suva_8.280 Chr8 (507390..508796) [1407 bp, 468 aa] {ON} YOR229W ...    31   4.5  
CAGL0M02277g Chr13 complement(271836..273119) [1284 bp, 427 aa] ...    31   4.5  
Smik_11.10 Chr11 complement(16139..18292) [2154 bp, 717 aa] {ON}...    32   4.6  
KNAG0F00620 Chr6 (105380..106768) [1389 bp, 462 aa] {ON} Anc_1.1...    31   4.6  
NCAS0E02840 Chr5 (558336..560159) [1824 bp, 607 aa] {ON} Anc_7.3...    32   4.6  
KLTH0G12276g Chr7 complement(1042617..1045430) [2814 bp, 937 aa]...    32   4.6  
KLTH0D12276g Chr4 (998921..1000258) [1338 bp, 445 aa] {ON} highl...    31   4.6  
Skud_16.96 Chr16 complement(172716..175757) [3042 bp, 1013 aa] {...    32   4.8  
TPHA0N01540 Chr14 complement(335055..337412) [2358 bp, 785 aa] {...    31   5.0  
YML102W Chr13 (68294..69700) [1407 bp, 468 aa] {ON}  CAC2Subunit...    31   5.1  
CAGL0J04818g Chr10 (458449..460413) [1965 bp, 654 aa] {ON} highl...    31   5.2  
KAFR0L01070 Chr12 complement(198694..201339) [2646 bp, 881 aa] {...    31   5.2  
NCAS0H03270 Chr8 (628484..630904) [2421 bp, 806 aa] {ON} Anc_2.6...    31   5.3  
YGL190C Chr7 complement(145809..147389) [1581 bp, 526 aa] {ON}  ...    31   5.4  
TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5....    31   5.5  
AAR102C Chr1 complement(526057..527832) [1776 bp, 591 aa] {ON} S...    31   5.7  
Smik_13.219 Chr13 complement(356393..358813) [2421 bp, 806 aa] {...    31   5.7  
KLLA0B01958g Chr2 (170646..170663,170896..173550) [2673 bp, 890 ...    31   5.7  
Ecym_4343 Chr4 (733111..734862) [1752 bp, 583 aa] {ON} similar t...    31   5.9  
NDAI0H02250 Chr8 (546983..548821) [1839 bp, 612 aa] {ON} Anc_2.4...    31   5.9  
NDAI0E04440 Chr5 (1002113..1003858) [1746 bp, 581 aa] {ON} Anc_7...    31   5.9  
Smik_12.495 Chr12 complement(873068..875887) [2820 bp, 939 aa] {...    31   6.3  
NCAS0A02800 Chr1 (533712..535517) [1806 bp, 601 aa] {ON} Anc_4.3...    31   6.3  
TDEL0B05970 Chr2 (1055359..1056270) [912 bp, 303 aa] {ON} Anc_1....    31   6.4  
TDEL0C01920 Chr3 (337685..339376) [1692 bp, 563 aa] {ON} Anc_7.3...    31   6.5  
Skud_7.83 Chr7 complement(151496..153076) [1581 bp, 526 aa] {ON}...    31   6.5  
KLTH0D04950g Chr4 complement(449060..451402) [2343 bp, 780 aa] {...    31   6.5  
ADR176W Chr4 (1012411..1013796) [1386 bp, 461 aa] {ON} Syntenic ...    31   6.6  
Ecym_4717 Chr4 (1407391..1409202) [1812 bp, 603 aa] {ON} similar...    31   6.9  
NDAI0A07070 Chr1 complement(1610054..1612360) [2307 bp, 768 aa] ...    31   7.0  
YLR196W Chr12 (543968..545698) [1731 bp, 576 aa] {ON}  PWP1Prote...    31   7.1  
YCL039W Chr3 (52645..54882) [2238 bp, 745 aa] {ON}  GID7Protein ...    31   7.4  
KLLA0E12629g Chr5 (1124393..1124965) [573 bp, 190 aa] {ON} weakl...    30   7.4  
ZYRO0F06314g Chr6 (526555..527850) [1296 bp, 431 aa] {ON} simila...    30   7.5  
ZYRO0F00616g Chr6 (54556..56964) [2409 bp, 802 aa] {ON} similar ...    31   7.5  
Smik_7.83 Chr7 complement(140174..141754) [1581 bp, 526 aa] {ON}...    31   7.6  
KLTH0G18348g Chr7 (1581039..1582844) [1806 bp, 601 aa] {ON} simi...    31   7.7  
Kwal_26.7655 s26 complement(460957..463188) [2232 bp, 743 aa] {O...    31   7.9  
KNAG0A01610 Chr1 complement(84663..85270,85389..86376) [1596 bp,...    30   7.9  
ZYRO0F03784g Chr6 (314914..317247) [2334 bp, 777 aa] {ON} simila...    31   7.9  
TDEL0A02450 Chr1 complement(437732..439264) [1533 bp, 510 aa] {O...    30   8.0  
KAFR0C04130 Chr3 (825105..827501) [2397 bp, 798 aa] {ON} Anc_2.6...    31   8.0  
SAKL0F10010g Chr6 (767640..768644) [1005 bp, 334 aa] {ON} simila...    30   8.1  
TPHA0G02940 Chr7 (631081..633837) [2757 bp, 918 aa] {ON} Anc_2.4...    31   8.4  
CAGL0L09647g Chr12 (1034737..1036026) [1290 bp, 429 aa] {ON} hig...    30   9.0  
Ecym_1367 Chr1 complement(754263..758252) [3990 bp, 1329 aa] {ON...    30   9.0  
Kwal_56.24661 s56 complement(1093040..1094725) [1686 bp, 561 aa]...    30   9.1  
KLLA0E11331g Chr5 complement(994770..996308) [1539 bp, 512 aa] {...    30   9.3  
YOR229W Chr15 (768409..769812) [1404 bp, 467 aa] {ON}  WTM2Trans...    30   9.4  
YDR142C Chr4 complement(740473..741600) [1128 bp, 375 aa] {ON}  ...    30   9.7  

>ZYRO0F00462g Chr6 complement(46021..47202) [1182 bp, 393 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 393

 Score =  813 bits (2101), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/393 (100%), Positives = 393/393 (100%)

Query: 1   MSISNPPEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILG 60
           MSISNPPEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILG
Sbjct: 1   MSISNPPEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILG 60

Query: 61  THTSDEEQNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQD 120
           THTSDEEQNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQD
Sbjct: 61  THTSDEEQNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQD 120

Query: 121 DNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIV 180
           DNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIV
Sbjct: 121 DNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIV 180

Query: 181 LWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKV 240
           LWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKV
Sbjct: 181 LWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKV 240

Query: 241 QAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQED 300
           QAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQED
Sbjct: 241 QAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQED 300

Query: 301 GVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLT 360
           GVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLT
Sbjct: 301 GVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLT 360

Query: 361 ATAEEENIVQVWKPSSKLPRIGGTPSVDTQLLE 393
           ATAEEENIVQVWKPSSKLPRIGGTPSVDTQLLE
Sbjct: 361 ATAEEENIVQVWKPSSKLPRIGGTPSVDTQLLE 393

>TDEL0G04620 Chr7 (842202..843380) [1179 bp, 392 aa] {ON} Anc_6.9
           YEL056W
          Length = 392

 Score =  586 bits (1511), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/386 (70%), Positives = 321/386 (83%)

Query: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILGTHTSDEE 67
           +KPLSIDEEY+LW+SNVPLMYDFVSETNLTWP+LTLEWLPG+  SNRQE+ILGTHTS+EE
Sbjct: 7   DKPLSIDEEYELWRSNVPLMYDFVSETNLTWPTLTLEWLPGNSHSNRQELILGTHTSEEE 66

Query: 68  QNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQDDNLIATI 127
            NYLKIAAI LPDE+VP  E +E +   KSN+KIIKKF+HE EVTRARYMPQD NLIATI
Sbjct: 67  PNYLKIAAIDLPDEIVPGKEDRERDGFTKSNIKIIKKFKHEQEVTRARYMPQDSNLIATI 126

Query: 128 SGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGK 187
           +G GT++LY+R+ + + GLLS+  FH +NGYGLSFNP +KGKLLSGSDDS I LWD+T  
Sbjct: 127 NGSGTVFLYDRSKDGDEGLLSSLGFHEDNGYGLSFNPVDKGKLLSGSDDSKIALWDITTN 186

Query: 188 SQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYN 247
           S +P+ T+   H D VNDCKWH  + N FGSVSED TLQLHDQR++D+  +K++    +N
Sbjct: 187 STKPVSTWESCHQDGVNDCKWHELNGNTFGSVSEDCTLQLHDQRVKDSVTDKIKTVTAFN 246

Query: 248 TLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAG 307
           T+AFS HSTNLFAAAGTDS++YLYD RR    LH M GHE  VT+LEF+  +DG+++S+G
Sbjct: 247 TIAFSKHSTNLFAAAGTDSLIYLYDSRRTGNVLHTMSGHESNVTNLEFYAAKDGIVMSSG 306

Query: 308 SDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEEN 367
            DRR I+WDL EIGAEQVPDDADDGSPEV+MIHAGHRS +NDFSMNPNIPWL A+AEEEN
Sbjct: 307 EDRRVIMWDLMEIGAEQVPDDADDGSPEVVMIHAGHRSPVNDFSMNPNIPWLMASAEEEN 366

Query: 368 IVQVWKPSSKLPRIGGTPSVDTQLLE 393
           IVQVWK SSKLPR+GG P VD  +LE
Sbjct: 367 IVQVWKCSSKLPRVGGLPKVDDSVLE 392

>NCAS0F00190 Chr6 complement(29012..30247) [1236 bp, 411 aa] {ON}
           Anc_6.9 YEL056W
          Length = 411

 Score =  558 bits (1438), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 258/394 (65%), Positives = 317/394 (80%), Gaps = 7/394 (1%)

Query: 7   PEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSS---NRQEMILGTHT 63
           P K LSIDEEY+LW+SNVPLMYDFVSET LTWPSL+LEWLP  +S+   NRQE+I+GTHT
Sbjct: 18  PNKELSIDEEYELWRSNVPLMYDFVSETRLTWPSLSLEWLPQEKSAQAPNRQELIIGTHT 77

Query: 64  SDEEQNYLKIAAIYLPDEVVPDAEPKEE----EEVLKSNVKIIKKFEHENEVTRARYMPQ 119
           S EE NYLKIAAI LP++++P  E  E+    E   KSN+KIIKKF+HE E+TRARYMPQ
Sbjct: 78  SGEEDNYLKIAAIDLPNDIIPSTEKLEDQQKGETTTKSNIKIIKKFKHEEEITRARYMPQ 137

Query: 120 DDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNI 179
           + NL+ATI+G G ++LY+R+ +  SGL+STF++H ENGYGLSFN N+ GKLLSGSDD  I
Sbjct: 138 NSNLVATINGSGKVFLYDRSKDKHSGLVSTFEYHKENGYGLSFNCNDAGKLLSGSDDGTI 197

Query: 180 VLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEK 239
            LW+V   +  PI  ++  HSDIVNDCKW NFD N+FGSVSEDSTLQLHDQR +D    +
Sbjct: 198 ALWNVNNSNSSPIYVWSSVHSDIVNDCKWSNFDLNVFGSVSEDSTLQLHDQREKDTFTSQ 257

Query: 240 VQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQE 299
            +   P+NTLAFS HS  LFAAAGTDS VYL+DRR  S+PLH M GH+ AVT++EF P +
Sbjct: 258 FKVDAPFNTLAFSKHSQYLFAAAGTDSHVYLFDRRDISRPLHSMAGHDGAVTNMEFSPDQ 317

Query: 300 DGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWL 359
           DG+L+++G DRR I+WD+ +IG EQ+PDDA+DG+PEV+MIHAGHRS+INDFSMNPNIPWL
Sbjct: 318 DGILMTSGEDRRAIIWDICDIGVEQIPDDAEDGAPEVLMIHAGHRSAINDFSMNPNIPWL 377

Query: 360 TATAEEENIVQVWKPSSKLPRIGGTPSVDTQLLE 393
            A++EEENI+QVWK S KLPR+GGTP+V    LE
Sbjct: 378 MASSEEENIIQVWKCSHKLPRVGGTPTVSVSQLE 411

>Kpol_1045.78 s1045 (183044..184222) [1179 bp, 392 aa] {ON}
           (183046..184224) [1179 nt, 393 aa]
          Length = 392

 Score =  546 bits (1407), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 245/393 (62%), Positives = 312/393 (79%), Gaps = 1/393 (0%)

Query: 1   MSISNPPEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILG 60
           M      E+PL++D+EY+LWK+NVPLMYDFVSET LTWPSLT +WLPGS    RQ MILG
Sbjct: 1   MEAQREQEEPLTVDQEYELWKTNVPLMYDFVSETRLTWPSLTAQWLPGSEEDTRQYMILG 60

Query: 61  THTSDEEQNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQD 120
           THTS EE +YLK+AA+ LPDEVV   E  ++    KSN+KI+KKFEH+ E+ RARYMP+D
Sbjct: 61  THTSGEEVDYLKVAALDLPDEVVT-GEANDDNRRTKSNIKIVKKFEHDGEINRARYMPKD 119

Query: 121 DNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIV 180
            N+IATI+G G + +Y+R+     GL +T ++H ENGYGLSFNPN   +L+SGSDD  I 
Sbjct: 120 SNIIATINGEGNVSIYDRSKSRSDGLRTTLKYHKENGYGLSFNPNVSNELISGSDDFTIA 179

Query: 181 LWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKV 240
           LWD+   S+ P   + + HSDIVNDC WH+FD+N+FGSVSEDSTL+LHD+R     +  +
Sbjct: 180 LWDIDSGSKSPKSVWDNIHSDIVNDCSWHHFDENLFGSVSEDSTLKLHDKRSTSKVINTI 239

Query: 241 QAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQED 300
           QAK  +NTLAFS HS NLFAAAG D+ +YLYDRR+ +KPLH+M GHEDA+T L+FHP+ED
Sbjct: 240 QAKAAFNTLAFSKHSANLFAAAGLDTNIYLYDRRQTTKPLHVMAGHEDAITCLQFHPKED 299

Query: 301 GVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLT 360
           G+L+S G+DRR ILWDLAEIGAEQ PD+ADDGSPE++MIHAGHRS+INDF+++P IPWL+
Sbjct: 300 GILVSGGADRRVILWDLAEIGAEQQPDEADDGSPEILMIHAGHRSAINDFTLHPTIPWLS 359

Query: 361 ATAEEENIVQVWKPSSKLPRIGGTPSVDTQLLE 393
           A+ EE+N+VQVWK S  L R+GGTP +DT++L+
Sbjct: 360 ASVEEDNVVQVWKCSKNLSRVGGTPEIDTKMLQ 392

>NDAI0K02900 Chr11 (657436..658752) [1317 bp, 438 aa] {ON} Anc_6.9
          Length = 438

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 254/404 (62%), Positives = 320/404 (79%), Gaps = 19/404 (4%)

Query: 9   KPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSS----NRQEMILGTHTS 64
           K L+IDEEYDLWKSNVPLMYDFVSET LTWP+LT+EWLP S SS    NRQE+ILGTHTS
Sbjct: 35  KELTIDEEYDLWKSNVPLMYDFVSETKLTWPTLTVEWLPSSHSSTPVSNRQELILGTHTS 94

Query: 65  DEEQNYLKIAAIYLPDEVVPDA------------EPKEEEEVLKSNVKIIKKFEHENEVT 112
            EE NYLKIAAI LPDEVV  +            +  ++++  +SN+KI+KKF+HE E+T
Sbjct: 95  GEEDNYLKIAAIDLPDEVVQPSTNSLKAQREDDEDEDDQKQKPRSNIKIVKKFKHEEEIT 154

Query: 113 RARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLS 172
           RAR+MPQ+ ++IATI+G GT+++YN++N+ +S L+ST +FH ENGYGLSFNPN+KGKLLS
Sbjct: 155 RARFMPQNTDIIATINGSGTVFIYNQSNDKQSALISTLRFHKENGYGLSFNPNDKGKLLS 214

Query: 173 GSDDSNIVLWDVTGKS---QEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           GSDD  I LWD+   S   ++P+  +   H+DIVNDCKW+ F+ N+F SVSEDSTLQLHD
Sbjct: 215 GSDDGTIALWDIQENSTLAKKPLKIWDSVHNDIVNDCKWNEFNSNVFASVSEDSTLQLHD 274

Query: 230 QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDA 289
           QR ++  +  ++   P+NTLAFS HS  L AAAGTDS+VYLYD R  S PL+ M GHED+
Sbjct: 275 QREQNTIINSIKTTDPFNTLAFSKHSQYLMAAAGTDSLVYLYDSRNLSVPLYSMNGHEDS 334

Query: 290 VTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSIND 349
           +T+LEF P  DGVLIS+G+DRR I+WD+ +IGAEQ+PDDA+DG+PEV+MIHAGHRS++ND
Sbjct: 335 ITNLEFSPHTDGVLISSGNDRRVIMWDINDIGAEQIPDDAEDGAPEVIMIHAGHRSAVND 394

Query: 350 FSMNPNIPWLTATAEEENIVQVWKPSSKLPRIGGTPSVDTQLLE 393
           FS+NPNIPWL A+AEEENI+QVWK S KLP +GGTP V   +LE
Sbjct: 395 FSINPNIPWLMASAEEENIIQVWKCSHKLPIVGGTPEVSVSILE 438

>KNAG0E00980 Chr5 complement(186207..187451) [1245 bp, 414 aa] {ON}
           Anc_6.9 YEL056W
          Length = 414

 Score =  508 bits (1307), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 238/388 (61%), Positives = 305/388 (78%), Gaps = 5/388 (1%)

Query: 9   KPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSS--NRQEMILGTHTSDE 66
           +PL   EEYDLWKSNVP+MYDFVSET L WPSLT++WLP S  +   RQE+ILGTHTSDE
Sbjct: 29  RPLDPSEEYDLWKSNVPMMYDFVSETRLVWPSLTVQWLPHSAPNPVTRQELILGTHTSDE 88

Query: 67  EQNYLKIAAIYLPDEVVPDAEPKE-EEEVLKSNVKIIKKFEHENEVTRARYMPQDDNLIA 125
           EQNYLKIA + LP EV   +   E +EE ++SN+++ +KF+H++EVTRARYMPQD N++A
Sbjct: 89  EQNYLKIAVVDLPTEVTDTSNLTESDEEQVRSNIRVTRKFKHDSEVTRARYMPQDPNILA 148

Query: 126 TISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVT 185
           TISG GT+Y+Y+R+NE ++  + T Q+H +NGYGL+FNP  KG LLSGSDDSN+ LWDVT
Sbjct: 149 TISGTGTVYIYDRSNERDTASI-TLQYHTDNGYGLAFNPLIKGHLLSGSDDSNVALWDVT 207

Query: 186 GKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKP 245
               EP+  + + HSDIVNDC+WHNF +++FG+VSEDS+LQ+HD R     V  +   KP
Sbjct: 208 SDRNEPVQKWENIHSDIVNDCQWHNFQKSLFGTVSEDSSLQIHDTR-ESKPVATINGTKP 266

Query: 246 YNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLIS 305
           +NTL+FS HS NL A  G +S VYLYDRR   +PLH+M GH DAVTSL+F  Q+DG+++S
Sbjct: 267 FNTLSFSHHSENLLATGGVNSEVYLYDRRYVEEPLHLMSGHTDAVTSLDFSSQDDGIILS 326

Query: 306 AGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEE 365
           AG+D+R I+WD+ +IGAEQV +DA+D + EVMMIHAGHRS INDF++NP+IPWL A+AEE
Sbjct: 327 AGADKRVIIWDINDIGAEQVLEDAEDATSEVMMIHAGHRSPINDFAINPSIPWLVASAEE 386

Query: 366 ENIVQVWKPSSKLPRIGGTPSVDTQLLE 393
           ENIVQ+WK S KLPRI GTP V   +L+
Sbjct: 387 ENIVQLWKCSHKLPRISGTPPVRVDMLQ 414

>TPHA0M00190 Chr13 complement(38571..39746) [1176 bp, 391 aa] {ON}
           Anc_6.9 YEL056W
          Length = 391

 Score =  504 bits (1298), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 240/387 (62%), Positives = 302/387 (78%), Gaps = 4/387 (1%)

Query: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILGTHTSDEE 67
           E+PL++D+EYDLWKSNVPL+YDFVSET LTWPSLTL+WLPG ++S RQ +ILGT TS  E
Sbjct: 8   EEPLTVDQEYDLWKSNVPLLYDFVSETRLTWPSLTLQWLPGDKTSTRQHLILGTLTSGAE 67

Query: 68  QNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQDDNLIATI 127
            +YLKIAA+ LPDE++     K+ ++V+KSN+K++KKF H+ E+ RARYMPQ+ N+IAT+
Sbjct: 68  TDYLKIAALDLPDEIIIG---KKSDKVVKSNLKVVKKFAHDGEINRARYMPQNTNIIATV 124

Query: 128 SGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTG- 186
           +G GTI++Y+ + + +S LLST ++H +N YGL+FNPN +G+L+SGSDDS I LWD T  
Sbjct: 125 NGEGTIFIYDCSRDKQSALLSTLKYHKDNAYGLAFNPNAEGELISGSDDSTIALWDATND 184

Query: 187 KSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPY 246
           K ++PI  +T  HSDIVNDC+WH F+ N+FGSVSEDSTLQL D+R    +  K+ +K  Y
Sbjct: 185 KLKQPIQEWTTSHSDIVNDCQWHCFNTNMFGSVSEDSTLQLFDKRNGGKSDVKISSKGQY 244

Query: 247 NTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISA 306
           N++AFS  S NLFAAAGT + +YLYD R   K LH M GHE+ VTSLEF   +DG+LIS 
Sbjct: 245 NSIAFSGFSENLFAAAGTTNNIYLYDIRNTGKILHSMTGHEEPVTSLEFSNDKDGILISG 304

Query: 307 GSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEE 366
            SDRR I+WDL EIGAEQ PD+ADDG PEVMMIHAG RS+IND S +P+IPWL A+ EE 
Sbjct: 305 SSDRRVIMWDLFEIGAEQQPDEADDGLPEVMMIHAGSRSAINDISTHPSIPWLNASVEEN 364

Query: 367 NIVQVWKPSSKLPRIGGTPSVDTQLLE 393
           NIVQVWK SSKLPRI GTP V    LE
Sbjct: 365 NIVQVWKCSSKLPRISGTPEVSISDLE 391

>CAGL0B03575g Chr2 complement(357525..358784) [1260 bp, 419 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056w HAT2
          Length = 419

 Score =  503 bits (1295), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 240/395 (60%), Positives = 308/395 (77%), Gaps = 11/395 (2%)

Query: 9   KPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSR---SSNRQEMILGTHTSD 65
           +P+++DEEY+LWKSNVP++YDFVSET LTWP+LT+EWLP      +  RQ++ILGTHTS 
Sbjct: 26  EPMTVDEEYELWKSNVPMLYDFVSETRLTWPTLTVEWLPQKNLVAARTRQQLILGTHTSG 85

Query: 66  EEQNYLKIAAIYLPDEVVPDAEPKEEEE-----VLKSNVKIIKKFEHENEVTRARYMPQD 120
           EEQNYLKI A+ LP EV  +++   E +     ++ SNVKI+KKF H+ E+TRARYMPQD
Sbjct: 86  EEQNYLKIGAVDLPVEVTENSKKDREIDEEDEDMVLSNVKIVKKFPHDGEITRARYMPQD 145

Query: 121 DNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIV 180
           DN+IATI+G G I++Y+R+      LLST ++H ENGYGL+FN NEK  LLSGSDDSNI 
Sbjct: 146 DNIIATINGEGKIFIYDRSKNGVEALLSTLEYHTENGYGLAFNANEKYSLLSGSDDSNIA 205

Query: 181 LWDVTG--KSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVE 238
           LWD++   K+ +P +TF D H+DI+ND KWH+ + +IFGSVSEDST++L D+R     + 
Sbjct: 206 LWDISNFEKNIKPTITFEDAHTDIINDVKWHSSEAHIFGSVSEDSTMKLFDKR-SSQIIH 264

Query: 239 KVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQ 298
            +  KKPYNTLAFS  S+NLFAAAGTD++VYLYD R  S PL+ M GHEDAVT++EF P 
Sbjct: 265 NINTKKPYNTLAFSPFSSNLFAAAGTDNLVYLYDIRDVSNPLYAMTGHEDAVTAIEFDPN 324

Query: 299 EDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPW 358
            DG+L S+GSDRRTI+WDL EIGAEQ  D+ +DG PEV+MIHAGH++SIND ++NPNI W
Sbjct: 325 NDGILYSSGSDRRTIVWDLQEIGAEQTQDEIEDGPPEVLMIHAGHKTSINDIAVNPNINW 384

Query: 359 LTATAEEENIVQVWKPSSKLPRIGGTPSVDTQLLE 393
           L A+AEE+NIVQ+WK SS +PRIGG P VD  +L+
Sbjct: 385 LVASAEEDNIVQIWKCSSNIPRIGGEPEVDLSILD 419

>Skud_5.33 Chr5 (46184..47389) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  488 bits (1256), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 232/400 (58%), Positives = 302/400 (75%), Gaps = 19/400 (4%)

Query: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNR-----QEMILGTH 62
           EKPLS+DEEYDLWKSNVPLMYDFVSET LTWPSLT++WLP      +     QE+I+GTH
Sbjct: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQQPKGGFIKQELIIGTH 64

Query: 63  TSDEEQNYLKIAAIYLPDEVVPDAEPKEEEEVL--------KSNVKIIKKFEHENEVTRA 114
           TS EE+NYLK A I LP EV+ +  P+E+ E+         +SN++I  K+EHE E+TRA
Sbjct: 65  TSGEEENYLKFAEINLPKEVLNNENPQEQAEMGDEASLPPPRSNIRITAKYEHEEEITRA 124

Query: 115 RYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGS 174
           RYMPQD N++ATI+G GT++LY+R++    GL ST +FH +NGY LSF+P  KG LLSGS
Sbjct: 125 RYMPQDPNMVATINGQGTVFLYSRSD----GLQSTLKFHKDNGYALSFSPLIKGHLLSGS 180

Query: 175 DDSNIVLWDVTGKSQE--PILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRI 232
           DD ++ LWDV+G S    PI T+ D HSDIVND KWHNF++++FG+VSEDS L+++D R 
Sbjct: 181 DDHSVALWDVSGGSDSTTPIRTWDDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDIRA 240

Query: 233 RDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTS 292
            +  ++  +  +P+NTLAFS HS+N+ AAAG DS VYLYD R   +PLH M GHEDAVT+
Sbjct: 241 ENTTIDTAKCPQPFNTLAFSHHSSNILAAAGMDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300

Query: 293 LEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSM 352
           LEF P  DGV++S+GSD R I+WDL +IGAEQ PDDA+DG PE++M+HAGHRS++NDF +
Sbjct: 301 LEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSAVNDFDL 360

Query: 353 NPNIPWLTATAEEENIVQVWKPSSKLPRIGGTPSVDTQLL 392
           N  +PWL A+ EEENI+QVWK S  LP +GG P ++  ++
Sbjct: 361 NAQVPWLIASTEEENILQVWKCSHSLPIVGGLPKINKDIV 400

>Suva_5.12 Chr5 (23273..24478) [1206 bp, 401 aa] {ON} YEL056W (REAL)
          Length = 401

 Score =  483 bits (1242), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 233/400 (58%), Positives = 299/400 (74%), Gaps = 19/400 (4%)

Query: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSN-----RQEMILGTH 62
           EKPLS+DEEYDLWKSNVPLMYDFVSET LTWPSLT++WLP           +QE+I+GTH
Sbjct: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQEPEGGFIKQELIIGTH 64

Query: 63  TSDEEQNYLKIAAIYLPDEVVPDAEPKEE----EEVL----KSNVKIIKKFEHENEVTRA 114
           TS EE+NYLK A I LP E++ + +P+EE    +EV     +SN+KI  K++HE E+TRA
Sbjct: 65  TSGEEENYLKFAEINLPKEILNNEDPQEEAGEDDEVSAPAPRSNIKITAKYKHEEEITRA 124

Query: 115 RYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGS 174
           RYMPQ+   +ATI+G GT+++Y+R+     GL ST +FH ENGY LSF+P  +G LLSGS
Sbjct: 125 RYMPQNPGTVATINGQGTVFIYSRS----EGLQSTLKFHEENGYALSFSPLVEGLLLSGS 180

Query: 175 DDSNIVLWDVTGKSQ--EPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRI 232
           DD  + LWDV G S    PI T++D HSDIVND KWHNF++++FG+VSEDS L+++D R+
Sbjct: 181 DDHTVALWDVNGNSDSTRPIRTWSDLHSDIVNDSKWHNFNKDLFGTVSEDSLLKINDLRV 240

Query: 233 RDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTS 292
            +      +  +P+NTLAFS HS+NL AAAGTDS VYLYD R   +PLH M GHEDAVT+
Sbjct: 241 ENTTTGTAKCPEPFNTLAFSHHSSNLLAAAGTDSHVYLYDLRNMKEPLHHMSGHEDAVTN 300

Query: 293 LEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSM 352
           LEF P  DGV++S+GSD R I+WDL +IGAEQ PDDA+DG PE++M+HAGH+S++NDF +
Sbjct: 301 LEFSPHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHKSAVNDFDL 360

Query: 353 NPNIPWLTATAEEENIVQVWKPSSKLPRIGGTPSVDTQLL 392
           N  IPWL A+ EEENI+QVWK S  LP +GG P V   ++
Sbjct: 361 NAQIPWLVASTEEENILQVWKCSHSLPVVGGPPKVSMDMI 400

>YEL056W Chr5 (47168..48373) [1206 bp, 401 aa] {ON}  HAT2Subunit of
           the Hat1p-Hat2p histone acetyltransferase complex;
           required for high affinity binding of the complex to
           free histone H4, thereby enhancing Hat1p activity;
           similar to human RbAp46 and 48; has a role in telomeric
           silencing
          Length = 401

 Score =  483 bits (1242), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 232/400 (58%), Positives = 301/400 (75%), Gaps = 19/400 (4%)

Query: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSS-----NRQEMILGTH 62
           EKPLS+DEEYDLWKSNVPLMYDFVSET LTWPSLT++WLP           +QE+I+GTH
Sbjct: 5   EKPLSVDEEYDLWKSNVPLMYDFVSETRLTWPSLTVQWLPTPVQELDGGFIKQELIIGTH 64

Query: 63  TSDEEQNYLKIAAIYLPDEVVPDAEPKEE--EEVL------KSNVKIIKKFEHENEVTRA 114
           TS EE+NYLK A I LP E++ + +P+EE  EE        +SN++I  K+EHE E+TRA
Sbjct: 65  TSGEEENYLKFAEINLPKEILSNEDPQEEAGEEYQSSLPAPRSNIRITAKYEHEEEITRA 124

Query: 115 RYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGS 174
           RYMPQD N++ATI+G GT++LY+R+     GL ST +FH +NGY LSF+   KG+LLSGS
Sbjct: 125 RYMPQDPNIVATINGQGTVFLYSRS----EGLQSTLKFHKDNGYALSFSTLVKGRLLSGS 180

Query: 175 DDSNIVLWDVT--GKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRI 232
           DD  + LW+V   G   +P+ T+ D HSDI+ND KWHNF++++FG+VSEDS L+++D R 
Sbjct: 181 DDHTVALWEVGSGGDPTKPVRTWNDLHSDIINDNKWHNFNKDLFGTVSEDSLLKINDVRA 240

Query: 233 RDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTS 292
            +  ++ V+  +P+NTLAFS HS+NL AAAG DS VYLYD R   +PLH M GHEDAV +
Sbjct: 241 NNTTIDTVKCPQPFNTLAFSHHSSNLLAAAGMDSYVYLYDLRNMKEPLHHMSGHEDAVNN 300

Query: 293 LEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSM 352
           LEF    DGV++S+GSD R ++WDL +IGAEQ PDDA+DG PE++M+HAGHRSS+NDF +
Sbjct: 301 LEFSTHVDGVVVSSGSDNRLMMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 360

Query: 353 NPNIPWLTATAEEENIVQVWKPSSKLPRIGGTPSVDTQLL 392
           NP IPWL A+AEEENI+QVWK S  LP +GG P V+  ++
Sbjct: 361 NPQIPWLVASAEEENILQVWKCSHSLPIVGGPPKVNKDII 400

>SAKL0E00814g Chr5 complement(59724..60920) [1197 bp, 398 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 398

 Score =  478 bits (1230), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/393 (58%), Positives = 291/393 (74%), Gaps = 10/393 (2%)

Query: 9   KPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILGTHTSDEEQ 68
           K LSI+EEY+LWK+NVPLMYDFVSET LTWPSLT++WLPG+ SS +QEMILGTHTS E+ 
Sbjct: 8   KLLSIEEEYELWKTNVPLMYDFVSETKLTWPSLTIQWLPGNSSSTKQEMILGTHTSGEDD 67

Query: 69  NYLKIAAIYLPDEVV--------PDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQD 120
           NYLKIA+I LP++++           E  E++  ++S +KI KK +HE E+TRAR+MPQD
Sbjct: 68  NYLKIASIELPEDILGAEFSETPESTEETEQQRNVQSRIKITKKIKHEEEITRARFMPQD 127

Query: 121 DNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIV 180
            N IATI+GVG ++L++R+ +    L+S   FH +NGYGLSFNP  KG+LLS SDD  I 
Sbjct: 128 PNFIATINGVGKVFLFDRSKDKNEALVSEHAFHKDNGYGLSFNPRTKGELLSCSDDGTIA 187

Query: 181 LWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKV 240
           LW+V G +  P    T  H DIVNDC WH F++N+FGSVSED TLQ+HD+R  ++ V ++
Sbjct: 188 LWNVMGTNTSPSKAVT-THEDIVNDCTWHEFNENLFGSVSEDKTLQIHDKRT-NSTVHRL 245

Query: 241 QAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQED 300
               P+NTL FS HS NLFAAAGTDS+VYLYD R  +  LH M GHED+VTSLEF P +D
Sbjct: 246 TLSSPFNTLDFSKHSQNLFAAAGTDSLVYLYDLRNTADALHTMSGHEDSVTSLEFSPHKD 305

Query: 301 GVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLT 360
           G+L S+GSDRR +LWDL +IG+EQ  +DA DG PE+MM+HAGH+S++NDFS N NIPWL 
Sbjct: 306 GILCSSGSDRRVLLWDLMQIGSEQAQEDAADGVPELMMMHAGHKSAVNDFSFNWNIPWLM 365

Query: 361 ATAEEENIVQVWKPSSKLPRIGGTPSVDTQLLE 393
           A+ EE+NIV VWK S KL   G     D + LE
Sbjct: 366 ASVEEDNIVHVWKVSKKLTSPGLIQDYDIRSLE 398

>Ecym_3012 Chr3 complement(24573..25766) [1194 bp, 397 aa] {ON}
           similar to Ashbya gossypii ACR017W
          Length = 397

 Score =  474 bits (1221), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 223/374 (59%), Positives = 284/374 (75%), Gaps = 5/374 (1%)

Query: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSS---NRQEMILGTHTS 64
           E PL++D+EY+LWKSNV LMYDFVSET LTWPSL+++WLP   ++    +QEMILGTHTS
Sbjct: 11  ESPLTVDQEYELWKSNVSLMYDFVSETKLTWPSLSIQWLPSVDANVPLKQQEMILGTHTS 70

Query: 65  DEEQNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQDDNLI 124
            +E NYLKIAAI LP EVV   +     E +KS +K+ KKFEHE+EV RARYMP++D +I
Sbjct: 71  GDENNYLKIAAIDLPYEVVGLPDEDNSSEPVKSMIKVTKKFEHEDEVIRARYMPKNDKII 130

Query: 125 ATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDV 184
           ATI+G G I++Y+R+     GL  T  +H +NGYGL+FNP  +G+LLS SDD+ + LWD+
Sbjct: 131 ATINGKGKIFIYDRSKSKSEGLCKTLSYHKDNGYGLAFNPQIEGELLSASDDTTVALWDI 190

Query: 185 TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKK 244
              +  P+ +    H+DIVND KWH FD+NIFG+VSED TLQ+HD+R    + + +  +K
Sbjct: 191 NS-TDRPV-SIVMNHTDIVNDSKWHEFDENIFGTVSEDKTLQVHDKRSLSNSAQVLPVEK 248

Query: 245 PYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLI 304
           P N LAFS HS NL AAAGTD+ VYLYD RR S+PLH M GH+DAVTS+EF   +DG+L 
Sbjct: 249 PLNALAFSKHSKNLIAAAGTDTRVYLYDLRRLSEPLHTMAGHQDAVTSIEFSSHKDGILC 308

Query: 305 SAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAE 364
           S+GSDRR  +WDL +IGAEQ  +DADDG PE+MM+HAGHRS+INDFS NP +PWL A+AE
Sbjct: 309 SSGSDRRLFIWDLTQIGAEQAQEDADDGVPELMMMHAGHRSAINDFSFNPQVPWLIASAE 368

Query: 365 EENIVQVWKPSSKL 378
           E+N+VQVWK S KL
Sbjct: 369 EDNVVQVWKISKKL 382

>Smik_5.31 Chr5 (49406..50689) [1284 bp, 427 aa] {ON} YEL056W (REAL)
          Length = 427

 Score =  475 bits (1223), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/400 (56%), Positives = 295/400 (73%), Gaps = 19/400 (4%)

Query: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLP-----GSRSSNRQEMILGTH 62
           EK LS+DEEYDLWKSNVPLMYDFVSET LTWPSL+++WLP           RQE+I+GTH
Sbjct: 31  EKALSVDEEYDLWKSNVPLMYDFVSETRLTWPSLSVQWLPTPIQEAEGGFIRQELIIGTH 90

Query: 63  TSDEEQNYLKIAAIYLPDEVVPDAEPKEEEE--------VLKSNVKIIKKFEHENEVTRA 114
           TS EE+NYLK A I +P E++ + +P+EE E          KSN++I  K+ HE E+TRA
Sbjct: 91  TSGEEENYLKFAEINIPKEILNNQDPQEEAEEDDKATLNAPKSNIRITAKYVHEEEITRA 150

Query: 115 RYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGS 174
           RYMPQ+ + +AT++G GT++LY+R+     GL ST +FH +NGY LSFN   +G+LLSGS
Sbjct: 151 RYMPQNPDFVATLNGQGTVFLYSRS----GGLQSTLKFHKDNGYALSFNALVEGQLLSGS 206

Query: 175 DDSNIVLWDVTGKSQE--PILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRI 232
           DD  + LW+V   S    P+ T+ D HSDIVND KWHNF++ +FG+VSEDS L+++D R 
Sbjct: 207 DDHTVALWEVGSNSTSISPVRTWNDLHSDIVNDIKWHNFNEKLFGTVSEDSLLKINDVRA 266

Query: 233 RDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTS 292
            +  ++ V+  +P+NTLAFS HS+NL AAAG DS VYLYD R   +PLH M GHEDAVT+
Sbjct: 267 HNITIDAVKCPQPFNTLAFSHHSSNLLAAAGMDSHVYLYDLRNMREPLHHMSGHEDAVTN 326

Query: 293 LEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSM 352
           +EF    DGV++S+GSD R I+WDL +IGAEQ PDDA+DG PE++M+HAGHRSS+NDF +
Sbjct: 327 IEFSTHVDGVVVSSGSDNRLIMWDLKQIGAEQTPDDAEDGVPELIMVHAGHRSSVNDFDL 386

Query: 353 NPNIPWLTATAEEENIVQVWKPSSKLPRIGGTPSVDTQLL 392
           N  IPWL A++EEENI+QVWK S  LP +GG P V+  ++
Sbjct: 387 NAQIPWLVASSEEENILQVWKCSHNLPIVGGPPKVNKDII 426

>KLTH0C11550g Chr3 (949063..950259) [1197 bp, 398 aa] {ON} similar
           to uniprot|P39984 Saccharomyces cerevisiae YEL056W
          Length = 398

 Score =  470 bits (1209), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 226/380 (59%), Positives = 283/380 (74%), Gaps = 10/380 (2%)

Query: 7   PEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILGTHTSDE 66
           PE  +S+DEEYDLWKSNVPLMYDFVSET L WPSLT++WLP +  SN QE+ILGTHTS  
Sbjct: 6   PENEVSVDEEYDLWKSNVPLMYDFVSETKLLWPSLTIQWLPSNDRSNEQELILGTHTSGT 65

Query: 67  EQNYLKIAAIYLPDEVVPDA--------EPKEEEEVLKSNVKIIKKFEHENEVTRARYMP 118
           EQNYLKIA+++LPDEVV D         + KE     +S +KI++KFEH +EVTRARY P
Sbjct: 66  EQNYLKIASVHLPDEVVSDVKCSAPSTDDSKESGHQPQSKIKIVRKFEHRDEVTRARYAP 125

Query: 119 QDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSN 178
            + NLIATISG G ++LY+R+ + +S L + F FH ENGYGL+F+    G+LLS SDD +
Sbjct: 126 FNPNLIATISGSGKVFLYDRSKDSDSALTAEFSFHKENGYGLNFSVISPGELLSCSDDGS 185

Query: 179 IVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVE 238
           I +WDV      P+   T  H++IVN+CKWH     +FGSVS+DSTL +HD+RI D  V 
Sbjct: 186 IAIWDVCSGKNTPVKVDT-SHNNIVNECKWHEKSPFLFGSVSDDSTLIIHDKRI-DKPVV 243

Query: 239 KVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQ 298
           K+   +PYNTLAFS HS+NLFAAAGTDS V LYD R+   P+H M GH D+VTSLEF P 
Sbjct: 244 KILQSEPYNTLAFSKHSSNLFAAAGTDSQVQLYDLRKPEAPIHSMSGHHDSVTSLEFAPH 303

Query: 299 EDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPW 358
           +DG+L S  SDRR ++WDL +IGAEQ  +DADDG PE++M+HAGH+S +NDFS +PNIPW
Sbjct: 304 KDGILCSGSSDRRVLIWDLFQIGAEQQQEDADDGVPELLMMHAGHKSPVNDFSCSPNIPW 363

Query: 359 LTATAEEENIVQVWKPSSKL 378
           L A+ EEEN+VQ+WK S KL
Sbjct: 364 LMASVEEENVVQIWKASKKL 383

>Kwal_56.22345 s56 complement(58523..59713) [1191 bp, 396 aa] {ON}
           YEL056W (HAT2) - subunit of a cytoplasmic histone
           acetyltransferase [contig 186] FULL
          Length = 396

 Score =  458 bits (1178), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 225/381 (59%), Positives = 288/381 (75%), Gaps = 8/381 (2%)

Query: 4   SNPPEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILGTHT 63
           S  PE+ LSID+EYDLWKSNVPLMYDFVSET L WPSLT++WLP +  S  QE+++GTHT
Sbjct: 3   STEPERELSIDDEYDLWKSNVPLMYDFVSETRLLWPSLTIQWLPRAEDSTEQELLVGTHT 62

Query: 64  SDEEQNYLKIAAIYLPDEVVPDAEP------KEEEEVLKSNVKIIKKFEHENEVTRARYM 117
           SD EQNYLKIA I LP E++ +  P         +E + S +KIIKKF+HENEVTRARY 
Sbjct: 63  SDSEQNYLKIAEINLPQEILSNEGPVLQNDNNGSDEQVPSKIKIIKKFKHENEVTRARYA 122

Query: 118 PQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDS 177
           P D NLIATISG GT++LY+R  + E+ L   + +H ENGYGL+F+    G+L+S SDD 
Sbjct: 123 PFDSNLIATISGTGTVFLYDRTKDDENALRGKYAYHKENGYGLNFSVASPGELISCSDDG 182

Query: 178 NIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAV 237
           +I +WD+      P  +    HSDIVN+CKWH  D NI+GSVSEDS L +HD+R  +  +
Sbjct: 183 SIAIWDIKSGKTVPT-SVNSLHSDIVNECKWHESDPNIYGSVSEDSFLMIHDKR-SEKPL 240

Query: 238 EKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHP 297
           +K+  K+P+NT+AFS HS+NLFAAAGTD+MVYL+D R+ ++ LH M GH++AVTSLEF  
Sbjct: 241 QKLLQKEPFNTIAFSKHSSNLFAAAGTDAMVYLFDSRKPTEALHSMSGHQEAVTSLEFAH 300

Query: 298 QEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIP 357
            +DG+L S GSDRR +LWDL +IG EQ  +DADDG PE++M+HAGH+S+INDFS +PN+P
Sbjct: 301 HKDGILCSGGSDRRVLLWDLFQIGTEQQEEDADDGGPELLMMHAGHKSAINDFSFSPNVP 360

Query: 358 WLTATAEEENIVQVWKPSSKL 378
           WL A+ EEENIVQ+WKPS KL
Sbjct: 361 WLMASVEEENIVQIWKPSRKL 381

>KLLA0D00814g Chr4 complement(76687..77913) [1227 bp, 408 aa] {ON}
           similar to uniprot|P39984 Saccharomyces cerevisiae
           YEL056W
          Length = 408

 Score =  456 bits (1173), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 221/390 (56%), Positives = 282/390 (72%), Gaps = 18/390 (4%)

Query: 7   PEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSN--------RQEMI 58
           PE+P +I+EEYDLW SNVP+MYDFVSET LTWPSLT++WLP              RQE++
Sbjct: 7   PEQPTTINEEYDLWVSNVPMMYDFVSETRLTWPSLTVQWLPTEMQPREVDGQQLLRQELL 66

Query: 59  LGTHTSDEEQNYLKIAAIYLPDEV------VPDAEPKEEEEVLKSNVKIIKKFEHENEVT 112
           +GT T+D E NYLKIAAI LP+ V      V D   + E    +S +KI++KF+HE EVT
Sbjct: 67  IGTLTTDNEPNYLKIAAIDLPENVTSSKPSVSDDAKENELSHRQSKIKIVRKFKHEQEVT 126

Query: 113 RARYMPQDDNLIATISGVGTIYLYNR-ANEVESGLLSTFQFHNENGYGLSFNPNEKGKLL 171
           RARYMPQ  N+IAT++G G +Y+++R   E + G +++F +H ENGYGL+FNP   G+LL
Sbjct: 127 RARYMPQSPNIIATLNGAGIVYIFDRNIKEKDHGAIASFSYHKENGYGLAFNPTVSGQLL 186

Query: 172 SGSDDSNIVLWDVTGKS-QEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQ 230
           S SDD  + LWDVT  + + P  TF D H+DIVNDCKWH F  ++FG+VSED+TL +HD 
Sbjct: 187 SASDDGTVALWDVTSTANKSPSQTF-DVHTDIVNDCKWHEFQSSLFGTVSEDNTLIIHDT 245

Query: 231 RIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAV 290
              D A++K+     +NTLAFS  S NL AAAGTDS VYLYD RR  KPLH M GHED+V
Sbjct: 246 N-SDRAIQKLSVSSAFNTLAFSKRSENLLAAAGTDSNVYLYDLRRLQKPLHSMAGHEDSV 304

Query: 291 TSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDF 350
           TSLEF P +DG+L S+GSDRR I+WDL  IGAEQ PDDA DG PE+ M+H GHRS +N+F
Sbjct: 305 TSLEFSPHQDGLLTSSGSDRRIIMWDLFNIGAEQQPDDAYDGVPELFMMHGGHRSPVNEF 364

Query: 351 SMNPNIPWLTATAEEENIVQVWKPSSKLPR 380
           S N N+PWL  + EEEN++Q+WKP++K+ R
Sbjct: 365 SHNSNVPWLMCSVEEENVLQIWKPANKIVR 394

>ACR017W Chr3 (387122..388393) [1272 bp, 423 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL056W (HAT2)
          Length = 423

 Score =  448 bits (1152), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 211/372 (56%), Positives = 271/372 (72%), Gaps = 5/372 (1%)

Query: 9   KPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILGTHTSDEEQ 68
           + L+++EEY+LW SNVP+MY+FVSET LTWPSLT++WLP    S  Q +I GTHT+ EE 
Sbjct: 40  QSLTVEEEYELWNSNVPVMYEFVSETKLTWPSLTIQWLPSDGQSPEQSLIFGTHTAGEEV 99

Query: 69  NYLKIAAIYLPDEVVPDAEPKEEEEVL-KSNVKIIKKFEHENEVTRARYMPQDDNLIATI 127
           NYLK+A I LP  +    +  EE+E    S+  I  KF H  EV RARYMP + N+IATI
Sbjct: 100 NYLKVATINLPAGIAGLDQGDEEDEANDHSSFAIANKFPHIEEVIRARYMPANSNIIATI 159

Query: 128 SGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDV-TG 186
           +G GTI +++R  E     +ST  FH ENGYGL+FNP+  G+LLSGSDD+ + LWD+   
Sbjct: 160 NGKGTISIFDRTLEESKAQVSTLAFHKENGYGLAFNPHISGELLSGSDDTTVALWDIEAA 219

Query: 187 KSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPY 246
           K  + ILT    H DIVND KWH F+ N+FG+VSED TLQ+HD+R+R   V+K+    P+
Sbjct: 220 KKPKSILT---SHDDIVNDVKWHEFESNVFGTVSEDKTLQVHDKRVRLEPVKKLPTASPF 276

Query: 247 NTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISA 306
           NTL+FS HS NL AAAG DS +YLYD R  S PLH+M GH+D+VT++EF P  DG++ S+
Sbjct: 277 NTLSFSKHSRNLLAAAGVDSQIYLYDMRDMSSPLHVMSGHQDSVTTVEFSPHTDGIICSS 336

Query: 307 GSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEE 366
           GSDRR I+WDL +IGAEQ  DDADDG+PE+MM+HAGHRS +N+FS NP IPWL A+ EE+
Sbjct: 337 GSDRRAIIWDLTQIGAEQSQDDADDGAPELMMMHAGHRSPVNEFSFNPQIPWLLASTEED 396

Query: 367 NIVQVWKPSSKL 378
           N++Q WK S KL
Sbjct: 397 NVIQAWKVSMKL 408

>KAFR0L00320 Chr12 (56449..57624) [1176 bp, 391 aa] {ON} Anc_6.9
           YEL056W
          Length = 391

 Score =  444 bits (1143), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 220/390 (56%), Positives = 294/390 (75%), Gaps = 11/390 (2%)

Query: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSS--NRQEMILGTHTSD 65
           E+ LSIDEEY LWKSNVPLMYDFVSET LTWPSLT+EWLP    +   +QEMI+GTHTSD
Sbjct: 7   ERELSIDEEYKLWKSNVPLMYDFVSETKLTWPSLTVEWLPHDPQAPLTQQEMIIGTHTSD 66

Query: 66  EEQNYLKIAAIYLPDEVVPDAEPKEEEEV-LKSNVKIIKKFEHENEVTRARYMPQDDNLI 124
           +E NY+KIA+I LP+EV+   +P    +  +KSNV+I KKF+ E E+TR+RYM QD N+I
Sbjct: 67  QEPNYVKIASIELPNEVI---DPHNVSDAPVKSNVRITKKFKLEKEITRSRYMVQDPNII 123

Query: 125 ATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDV 184
           +TI G GT+ +++R N  +S +  T+ +H +NGYGLSFNP  KG+LLS +DD  I ++D+
Sbjct: 124 STIDGNGTVSIFDR-NSSDSPV-KTYSYHKDNGYGLSFNPISKGQLLSAADDGYIAMYDI 181

Query: 185 TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSED-STLQLHDQRIRDAAVEKVQAK 243
             +S++P+ T+    + I+ND KWH+FD  +FG+VSE+ +TL ++D R +D  V  ++ +
Sbjct: 182 NAESEDPVETWQSTDNCIINDIKWHHFDATLFGTVSEEKNTLSIYDLRTKDK-VTSIEME 240

Query: 244 KPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVL 303
           +P+N+LAFS HS NLF+AAGTD  VYLYD R   K LH M GHE  VT+LEFH   DG+L
Sbjct: 241 QPFNSLAFSKHSKNLFSAAGTDQNVYLYDLRNTRKTLHSMSGHEGPVTNLEFHDSVDGIL 300

Query: 304 ISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATA 363
           +S+  DRR I+WDL EIG+EQV +DA D +PE+MMIHAGHRSS+NDFS+N +IPWL A+ 
Sbjct: 301 VSSSEDRRIIIWDLMEIGSEQVNEDAQDATPELMMIHAGHRSSVNDFSLNSSIPWLIAST 360

Query: 364 EEENIVQVWKPSSKLPRIGGT-PSVDTQLL 392
           EEENI+QVWK SS+LPRI  + P ++  L+
Sbjct: 361 EEENIIQVWKSSSRLPRISNSKPFINYDLI 390

>TBLA0A07120 Chr1 complement(1765718..1766941) [1224 bp, 407 aa]
           {ON} Anc_6.9 YEL056W
          Length = 407

 Score =  415 bits (1067), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 202/383 (52%), Positives = 277/383 (72%), Gaps = 16/383 (4%)

Query: 8   EKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRS----SNRQEMILGTHT 63
           E+PL+ D+EY+LWKSNVPL+YDFVSET L WPSLT+EWLP + +    SN Q ++LGTHT
Sbjct: 17  EEPLTTDQEYELWKSNVPLLYDFVSETKLVWPSLTVEWLPSNETTNLPSNEQRLLLGTHT 76

Query: 64  SDEEQNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQDDNL 123
           S EEQNYLKIA I LPD+++ +      ++ +KSN++IIKKF+HE EVTRA YMPQD  +
Sbjct: 77  SGEEQNYLKIAEITLPDQIINEKTEDNSDKHVKSNIRIIKKFKHELEVTRAHYMPQDSTI 136

Query: 124 IATISGVGTIYLYNRA-NEVESG-LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVL 181
           IATI+G GT+++Y+ + +E +S  ++S    H ENGYGL+FNP +KGKLLS SDD ++  
Sbjct: 137 IATINGDGTVFIYDTSIDENQSNPIISKLSHHKENGYGLAFNPLDKGKLLSSSDDGSVAY 196

Query: 182 WDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQR-----IRDAA 236
           W++    Q+ I   T + + I+ND +W+ F+QN+FG V+E S L L D R     ++  +
Sbjct: 197 WNI----QKSIPLLTLQETSIINDVRWNQFNQNLFGYVTESSCLNLKDVRNNNNDLKIVS 252

Query: 237 VEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFH 296
              ++    +N +AFS HS  L AA+G DS++YLYD R  ++PLH M GHED+VTSL+FH
Sbjct: 253 NHDIKTPSAFNAMAFSFHSEYLMAASGEDSLIYLYDTRNLNQPLHYMRGHEDSVTSLDFH 312

Query: 297 PQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGS-PEVMMIHAGHRSSINDFSMNPN 355
              DG++IS GSD+R  +WDL +IG EQ  D+ +DG  PE++MIHAGHRS INDFSM+ N
Sbjct: 313 ALNDGIVISGGSDKRVAVWDLKQIGQEQTSDEIEDGDVPELLMIHAGHRSPINDFSMSNN 372

Query: 356 IPWLTATAEEENIVQVWKPSSKL 378
           + WL A+ EE+NIVQVWK ++ L
Sbjct: 373 LNWLCASIEEDNIVQVWKMNNSL 395

>TBLA0H03650 Chr8 (888840..890099) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  142 bits (358), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 112/431 (25%), Positives = 201/431 (46%), Gaps = 70/431 (16%)

Query: 1   MSISNPPEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPG-SRSSNRQEMIL 59
           M I N       + + Y  WK N  L+YD+++  +  WPSLT ++ P   +S++   ++L
Sbjct: 1   MEIENSTSISNDLQQRYSHWKKNTKLLYDYLNTNSNKWPSLTCQFFPDIDKSNDTHRLLL 60

Query: 60  GTHTS----DEEQNYLK-IAAIYLPD------------EVVPDAEPKEEEEVLKSNVKII 102
            T TS    D+E  Y+  I+ +   D            E  PD   K   + L +++ I 
Sbjct: 61  STFTSSQIPDDESIYISHISTLNHLDWSSLNNFDMDEMEFKPDNRIKFPSKNLITDISIT 120

Query: 103 KKFEHENEVTRARYMPQDDNLIATISGVGTIYLYNR------------------ANEVES 144
                E +  +ARYMPQ+ ++I   S  G IY+++R                  +   E+
Sbjct: 121 FP---EGDCNKARYMPQNPDIIGCASSNGCIYIFDRTKRGSKLSTTTSARFSSGSKAYEA 177

Query: 145 GLLSTFQFHNENG--------YGLSFNPNEKGKLLSGSDDSNIVLWDV----TGKSQEPI 192
            L    +F  E+G          +++NP ++G+LLS   + NI LWD     + K++E  
Sbjct: 178 KLAKQRKFVIEDGTKNDEFECLSIAWNPQQEGQLLSCESNGNIHLWDFQKEFSSKNREIN 237

Query: 193 LTFTDRHSDIV--NDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDA--AVEKVQAKKPYNT 248
            T  D + D +  N+  W N   +IF +  E++ + + D R      ++E+       N+
Sbjct: 238 NTIWDTNFDDLGCNEVTWMNGHNSIFATCGENNKMAVFDTRKEGIVNSIEQGNHNGGINS 297

Query: 249 LAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGS 308
             F+  +  L A+  ++ ++ L+D R+ +KP+  +  H  +++++E+ P  + ++ S G 
Sbjct: 298 CKFNYENAMLLASGDSNGIINLWDIRKLNKPIRNLY-HGSSISTIEWSPLMNEMIASGGQ 356

Query: 309 -DRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEEN 367
            D    LWD++    E+ P          + IH GH   IND S + + PWL  +   +N
Sbjct: 357 EDGLVKLWDISN---EEEP----------IFIHGGHMLGINDLSWDLHDPWLLCSVGSDN 403

Query: 368 IVQVWKPSSKL 378
            +Q+WKP+  L
Sbjct: 404 SIQIWKPAKHL 414

>Kpol_1024.39 s1024 complement(104336..105589) [1254 bp, 417 aa]
           {ON} complement(104336..105589) [1254 nt, 418 aa]
          Length = 417

 Score =  135 bits (340), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 106/412 (25%), Positives = 196/412 (47%), Gaps = 59/412 (14%)

Query: 10  PLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSN-RQEMILGTHTS---- 64
           P    + Y  WK N  L+Y++++  +  WPSLT ++ P   + N    ++L + TS    
Sbjct: 18  PKERQDRYTTWKKNTKLLYEYLNTNSNKWPSLTCQFFPDVNTKNDSHRILLSSFTSSLVP 77

Query: 65  -DEEQNYLKIAAI-YLPDEVVPDAEPKEEE-EVLKSNVKI---------IKKFEHENEVT 112
            DE     +I+ + +L    + + +  E E +   SN+K+         + +F +  +  
Sbjct: 78  EDESLYITRISTLKHLSWASLNNFDLDEMEFKPDNSNIKLPPKNLTTELVIRFPN-GDCN 136

Query: 113 RARYMPQDDNLIATISGVGTIYLYNRA------NEVESGLLSTFQFH---NENGYGLS-- 161
           RARY+PQ+ +LIA  S  G++Y+++R       +  +SG   ++Q     N N   L+  
Sbjct: 137 RARYLPQNPDLIAAASSDGSVYIFDRTKHGTAMHSRQSGFTQSYQAKLAVNNNSQSLNGE 196

Query: 162 -------FNPNEKGKLLSGSDDSNIVLWDVTG-KSQEPILTFTDRHSDI----VNDCKWH 209
                  +N  ++G L+    D ++  WD+T  K  +P++   + +  +     ND  W 
Sbjct: 197 NEALTIDWNHQKEGHLVVAYSDGHVKAWDITKYKRSDPVIKAPEYNYKLDESGCNDAVWM 256

Query: 210 NFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQA--KKPYNTLAFSAHSTNLFAAAGTDSM 267
               ++F + SED+ L L D R     ++   +  K   N   F+  ++ L A+  +   
Sbjct: 257 PEHNSLFAACSEDNRLSLFDTRDESNIIDISTSVHKGGINACRFNPRNSLLLASGDSIGN 316

Query: 268 VYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI-LWDLAEIGAEQVP 326
           + L+D R+   P++++  H  +++++E++P    VL SAG D   + LWD          
Sbjct: 317 ICLWDIRKKETPINIL-DHGSSISTIEWNPNLSTVLASAGQDDGLVKLWDA--------- 366

Query: 327 DDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
                GS + + IH GH   +ND S N + PWL  +  ++N +Q+WKP+  L
Sbjct: 367 -----GSDKPVFIHGGHMLGVNDISWNMHDPWLMCSVSKDNSIQIWKPAHNL 413

>KAFR0I00840 Chr9 complement(162878..164119) [1242 bp, 413 aa] {ON}
           Anc_8.548 YBR195C
          Length = 413

 Score =  134 bits (338), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 110/424 (25%), Positives = 193/424 (45%), Gaps = 69/424 (16%)

Query: 6   PPEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPG-SRSSNRQEMILGTHTS 64
           P   P  + E Y  WK N  L+Y +++     WPSLT ++ P    +++   ++L T TS
Sbjct: 9   PSSIPDDLQERYSRWKKNTKLLYSYLNTNTSKWPSLTCQFFPDLDTTTDTHRILLSTFTS 68

Query: 65  DE--EQNYLKIAAIYLPD---------------EVVPDAEPKEEEEVLKSNVKIIKKFEH 107
            +  E   L IA +   +               E  PD   K   + L  NV I   F +
Sbjct: 69  SQLPEDESLYIANLSTSNHLNWSSLNNFDMDEMEFKPDNSTKFPSKNL--NVDISIPFPN 126

Query: 108 ENEVTRARYMPQDDNLIATISGVGTIYLYNRANE-----------VESGLLSTFQ----F 152
             +  RARY+PQ+ +L+A  S  G+IY++NR               E+ L ST +    F
Sbjct: 127 -GDCNRARYLPQNPDLLAAASSNGSIYIFNRTKHGSRRLNSNQRSFEARLYSTDKMDENF 185

Query: 153 HNEN-GYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKS-QEPILTFTDRHSDI-------- 202
            N N    +++N  + G L S     +I +WD+T  S  +P L    R +++        
Sbjct: 186 TNSNEAVSIAWNLQKNGTLASSYSQGSIKIWDITKYSCSDPTL----RENELTIPFDPEG 241

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPY----NTLAFSAHSTNL 258
            N+  W     +IF + SE + L L D R ++  ++  +    +    N+  F+ ++  L
Sbjct: 242 CNEVTWMVNHDSIFAACSESNKLSLFDVRTKEEMLKMTENIGTHSGGINSCKFNYYNDML 301

Query: 259 FAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI-LWDL 317
            A+A +   + ++D R+  K       H  ++++LE++P  + +L++AG D   + +WD 
Sbjct: 302 LASADSTGKINMWDIRKLDKEPIKSFNHNSSISTLEWNPNLETILVTAGQDDGLVKIWDT 361

Query: 318 AEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSK 377
           A              + + + +H GH   +ND S + + PWL ++   +N + VWKP++ 
Sbjct: 362 A--------------NGQNIFVHGGHMLGVNDVSWDLHDPWLLSSVSNDNSIHVWKPATN 407

Query: 378 LPRI 381
           L  I
Sbjct: 408 LVDI 411

>Ecym_7042 Chr7 (86859..88103) [1245 bp, 414 aa] {ON} similar to
           Ashbya gossypii AEL250C
          Length = 414

 Score =  130 bits (326), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 103/404 (25%), Positives = 194/404 (48%), Gaps = 48/404 (11%)

Query: 10  PLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSR-SSNRQEMILGTHTS---- 64
           P  + + Y  WK N  L+Y++++  +  WPSLT +++P    +S++  ++L + TS    
Sbjct: 18  PEPLQQRYTNWKKNTRLLYEYLNTNSTKWPSLTCQFMPDMDIASDKHRILLSSFTSAQLP 77

Query: 65  DEEQNYLK-------IAAIYLPDEVVPDAEPKEEEEV-LKSNVKIIKKFEH-ENEVTRAR 115
           ++E  Y+        IA   L +  + + E K + +V L  N+    K +  E +  RAR
Sbjct: 78  EDEAIYISEISTMKHIAWSSLNNFHMEEMEFKVDNQVKLSKNLTETIKIQFPEGDCNRAR 137

Query: 116 YMPQDDNLIATISGVGTIYLYNRANEVESG---LLSTFQF----------HNENGYGLSF 162
           YMPQ+ ++IA+ S +G++Y+++R     +    L +TF++           N     L++
Sbjct: 138 YMPQNPDVIASASSLGSVYIFDRTKHGSNRPKILGNTFKYDMELKEVESGCNYEASSLAW 197

Query: 163 NPNEKGKLLSGSDDSNIVLWDVTGKSQ-EPILTFTDRHSDI----VNDCKWHNFDQNIFG 217
           N    G L +   D ++ +WD+T  ++ +P LT  D    +     N+  W     +I  
Sbjct: 198 NYQRSGILAASYSDGDVKIWDITKYNKAQPQLTVPDLRWQVDKEGANEVSWMVHHSSILA 257

Query: 218 SVSEDSTLQLHDQRIRDAAVEKVQAKKP--YNTLAFSAHSTNLFAAAGTDSMVYLYDRRR 275
              E + L + D R       K  +      N + F+  +  L  +A ++  + + D R+
Sbjct: 258 VCGEGNGLTILDTRTPTTFSTKRHSCHTGGINAVQFNYDNDFLLCSADSEGTLNICDIRQ 317

Query: 276 ASKPLHMMPGHEDAVTSLEFHPQEDGVLISAG-SDRRTILWDLAEIGAEQVPDDADDGSP 334
              P+     H DAV++++++P+   V+ SAG +D    +WDLA+       DD      
Sbjct: 318 LEHPVKTW-SHLDAVSTIQWNPKFPTVIASAGQNDGLVKIWDLAQ------EDDP----- 365

Query: 335 EVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
            ++ IH GH   +ND + N + PW+  +   +N V +WKP++ +
Sbjct: 366 -LVFIHGGHMLGVNDIAWNHHDPWVMCSVSNDNSVHIWKPAANI 408

>YBR195C Chr2 complement(610614..611882) [1269 bp, 422 aa] {ON}
           MSI1Subunit of chromatin assembly factor I (CAF-1);
           chromatin assembly by CAF-1 is important for multiple
           processes including silencing at telomeres, mating type
           loci, and rDNA; maintenance of kinetochore structure;
           deactivation of the DNA damage checkpoint after DNA
           repair; and chromatin dynamics during transcription;
           Msi1p localizes to both nucleus and cytoplasm and has an
           independent role as a negative regulator of the RAS/cAMP
           pathway via sequestration of Npr1p kinase
          Length = 422

 Score =  129 bits (325), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 112/421 (26%), Positives = 188/421 (44%), Gaps = 70/421 (16%)

Query: 10  PLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPG-SRSSNRQEMILGTHTSDE-- 66
           P+ + E Y  WK N  L+YD+++  +  WPSLT ++ P    +S+   ++L + TS +  
Sbjct: 16  PIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTSDEHRILLSSFTSSQKP 75

Query: 67  EQNYLKIAAIYLPDEV---------VPDAEPKEEEEVL---KSNVKIIKKFEHENEVTRA 114
           E   + I+ I     +         + + E K E       K  V  I  F    E  RA
Sbjct: 76  EDETIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRFPSKHLVNDISIFFPNGECNRA 135

Query: 115 RYMPQDDNLIATISGVGTIYLYNRANE-----VESGLLSTFQFHNENGYG---------- 159
           RY+PQ+ ++IA  S  G IY+++R         +S +   F+      +G          
Sbjct: 136 RYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFETKLFGSHGVIQDVEAMDT 195

Query: 160 ----------LSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE-PI--LTFTDRHSD--IVN 204
                     L++N  ++  LLS   +  + +WD+   S E PI  L     +SD   VN
Sbjct: 196 SSADINEATSLAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGTAVN 255

Query: 205 DCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKP-----YNTLAFSAHSTNLF 259
           D  W     ++F + +E + + L D R +    EK+Q+ +       N+  F+  ++ + 
Sbjct: 256 DVTWMPTHDSLFAACTEGNAVSLLDLRTKK---EKLQSNREKHDGGVNSCRFNYKNSLIL 312

Query: 260 AAAGTDSMVYLYDRRRASK-PLHMMPGHEDAVTSLEFHPQEDGVLISAGS-DRRTILWDL 317
           A+A ++  + L+D R  +K P+  M  H  +V++LE+ P  D VL +AG  D    LWD 
Sbjct: 313 ASADSNGRLNLWDIRNMNKSPIATME-HGTSVSTLEWSPNFDTVLATAGQEDGLVKLWDT 371

Query: 318 AEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSK 377
           +                E +  H GH   +ND S + + PWL  +   +N V +WKP+  
Sbjct: 372 S--------------CEETIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAGN 417

Query: 378 L 378
           L
Sbjct: 418 L 418

>CAGL0M05291g Chr13 complement(566250..567509) [1260 bp, 419 aa]
           {ON} similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195c MSI1
          Length = 419

 Score =  129 bits (323), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 112/416 (26%), Positives = 189/416 (45%), Gaps = 66/416 (15%)

Query: 10  PLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPG-SRSSNRQEMILGTHTS---- 64
           P  +   Y  WK N  L+YD+++  +  WPSLT ++ P    SS++  ++L + TS    
Sbjct: 18  PEDVQTRYIHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTSSDQHRLLLSSFTSSQLP 77

Query: 65  -DEEQNYLKIAAIYLPD------------EVVPDAEPKEEEEVLKSNVKIIKKFEHENEV 111
            DE     KI+ +   +            E  PD   K   + L + V I  +F +  + 
Sbjct: 78  EDESVYISKISTLKHLNWSSLNNFDMDEMEFKPDPSVKLPPKNLTTEVSI--RFPN-GDC 134

Query: 112 TRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLST----FQFHNENG---------- 157
            R+RY+PQ+ +LIA  S  G++Y++N+     S L S     FQ    +G          
Sbjct: 135 NRSRYLPQNPDLIAAASSDGSVYIFNKTKHGNSVLRSKSSDDFQARLFSGSHDAQNLDNF 194

Query: 158 ---YGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQ------EPILTFTDRHSDIVNDCKW 208
                LS+N +++G L          +WDV   S+      +P LT T   S+  ND  W
Sbjct: 195 NEAVSLSWNKHKEGILGVSYSQGQCNIWDVKKFSRSNILISQPELTVT-FDSNGCNDLDW 253

Query: 209 HNFDQNIFGSVSEDSTLQLHDQRIRDA----AVEKVQAKKPYNTLAFSAHSTNLFAAAGT 264
                ++F +  E + L L D R+       ++   + +   NT  F+  ++ L A+A T
Sbjct: 254 MPMHDSMFIACGESNKLGLFDMRLNGEKEVNSISNYKHEDGINTCKFNPGNSLLVASADT 313

Query: 265 DSMVYLYDRRRASK-PLHMMPGHEDAVTSLEFHPQEDGVLISAGS-DRRTILWDLAEIGA 322
              + L+D R+  + P+  M  H  +++++E++P    V  SAG  D    LWD A +G 
Sbjct: 314 CGRINLWDIRKLDQEPISTMQ-HGSSISTIEWNPNIGVVFASAGQEDGLVKLWD-ASVGK 371

Query: 323 EQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
           E             + +H GH   +ND S + + PWL A+   +N +Q+W+P+  +
Sbjct: 372 E-------------IFVHGGHMLGVNDISWDMHDPWLMASVSNDNTIQIWRPAKNI 414

>ZYRO0A13068g Chr1 (1032695..1033888) [1194 bp, 397 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 397

 Score =  127 bits (320), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 103/404 (25%), Positives = 178/404 (44%), Gaps = 58/404 (14%)

Query: 15  EEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPG-SRSSNRQEMILGTHTSDE--EQNYL 71
           + Y LWK N  L+YD+++  +  WPSL+ ++ P    SS+   ++  + TS +  +   +
Sbjct: 10  QRYTLWKKNTKLLYDYLNTNSFKWPSLSCQFFPDLDTSSDTHRLLFTSFTSSQLPQDENV 69

Query: 72  KIAAI----YLP-----------DEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARY 116
            IA+I    ++P            E  PD   K   + L+  +++   F H  +  RA Y
Sbjct: 70  TIASISTLRHVPWSSLNNFDMDEMEFKPDLSTKLPPKNLQ--IQLTINFPH-GDCNRATY 126

Query: 117 MPQDDNLIATISGVGTIYLYNRANEVES------GLLSTFQFHNENG------YGLSFNP 164
           +PQ+ +LI+T S  G++Y+++R    +S      G        N NG        L +N 
Sbjct: 127 LPQNPDLISTASSDGSVYIFDRTKRGKSPISHLRGPFEAQLLPNNNGSPIGETVALDWNR 186

Query: 165 NEKGKLLSGSDDSNIVLWDVTG-KSQEPILT-----FTDRHSDIVNDCKWHNFDQNIFGS 218
             +G L S   +  + +WD+   + + PI++     F D  S   ND  W      +   
Sbjct: 187 QIEGILASTYSNGQLCIWDIKKFEKRNPIMSQPSADFIDTESQGFNDVSWMPSHDCLLSI 246

Query: 219 VSEDSTLQLHDQRIRDAAVE---KVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRR 275
             ED+ + L D R      +           N   F+     L A A  D +V L+D R+
Sbjct: 247 AREDNIMTLFDTRTNGNIAQTGPSTNHASGINCTKFNPSQPLLVATASGDGLVQLWDIRK 306

Query: 276 ASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGS-DRRTILWDLAEIGAEQVPDDADDGSP 334
              P+  +   E  +++LE++PQ   VL + G  D    LW            +A +G  
Sbjct: 307 LHNPIKTI-NCESPLSALEWNPQLPTVLATGGQEDGLVKLW------------NASNG-- 351

Query: 335 EVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
           +++  H GH   +ND + +P+  WL  +   +N   +WKP+S+L
Sbjct: 352 QLLFTHGGHMLGVNDIAWSPHDKWLMCSVANDNSTHLWKPASRL 395

>Kwal_27.12070 s27 (1071472..1072728) [1257 bp, 418 aa] {ON} YBR195C
           (MSI1) - p50 subunit of the yeast Chromatin Assembly
           Factor-I (CAF-I) negative regulator of ras-mediated cAMP
           induction; homologous to beta subunit of GTP-binding
           proteins [contig 24] FULL
          Length = 418

 Score =  126 bits (316), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 94/405 (23%), Positives = 182/405 (44%), Gaps = 54/405 (13%)

Query: 15  EEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPG-SRSSNRQEMILGTHTSDE--EQNYL 71
           + Y  WK N  L+Y++++  N  WPSLT +  P    + +   ++L + TS +  E   +
Sbjct: 23  QRYTHWKKNCKLLYEYLNTNNTKWPSLTCQLFPDLDLAGDEHRILLSSFTSSQLPEDEAI 82

Query: 72  KIAAI----YLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHEN--------EVTRARYMPQ 119
            +A +    ++P   + + +  E E  + +++K+  K   E+        +  +ARY P 
Sbjct: 83  YVARLSSMKHIPWSSLNNFDTDEMEFKMDNSLKLPPKNIVEDLRIKFPAGDCNKARYCPS 142

Query: 120 DDNLIATISGVGTIYLYNRA----------------NEVESGLLSTFQFHNENGYGLSFN 163
           + +LI++ S  G++Y+++R                 +++   L ++ +        L++N
Sbjct: 143 NPDLISSASSNGSVYVFDRTKHGSARQKLISGGDPDHQIHCQLSTSLEERQNEALNLAWN 202

Query: 164 PNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIV------NDCKWHNFDQNIFG 217
             ++G L +      + +WD+  K  +   T  D HS ++      ND  W     ++  
Sbjct: 203 WQQQGLLATCYSGGEVCVWDL-AKYDKASPTLIDPHSSLLADPQGSNDISWMVNHDSLLA 261

Query: 218 SVSEDSTLQLHDQRIRDAAVEKV---QAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRR 274
              E + L + D RI     +           N   F+ +   L  +A +   + L+D R
Sbjct: 262 YCGEGNALGVLDTRITKQPPQSFSNPHHSNGVNACQFNYYKDLLLCSADSAGRINLWDIR 321

Query: 275 RASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI-LWDLAEIGAEQVPDDADDGS 333
             S P+  +  H  +V++L+++P    +L +AG D   + +WDL++      P D     
Sbjct: 322 DFSSPIRSL-DHHGSVSALQWNPHHPTILATAGQDDGLVKIWDLSQ------PVDQ---- 370

Query: 334 PEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
            E+   H GH   +ND S +PN PW+  +   +N +Q+WKPS  L
Sbjct: 371 -ELKFTHGGHMLGVNDISWDPNDPWMMCSVSNDNSIQLWKPSQNL 414

>KLTH0E12694g Chr5 (1126940..1128196) [1257 bp, 418 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 418

 Score =  125 bits (315), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 95/406 (23%), Positives = 188/406 (46%), Gaps = 56/406 (13%)

Query: 15  EEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPG-SRSSNRQEMILGTHTSDE--EQNYL 71
           + Y  WK N  L YD+++  +  WPSLT +  P    +++   ++L + TS +  E   L
Sbjct: 23  KRYTRWKKNSKLYYDYLNTNSTKWPSLTCQLFPDLDLATDEHRILLSSFTSSQVPEDESL 82

Query: 72  KIAAI----YLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHEN--------EVTRARYMPQ 119
            +A +    ++P   + + + +E+E  + +++K+  K   E+        +  +ARY P 
Sbjct: 83  YVARLSSMKHIPWSSLNNFDMEEKEFKVDNSLKLPSKSLVEDLRIKFPAGDCNKARYCPS 142

Query: 120 DDNLIATISGVGTIYLYNRA----------------NEVESGLLSTFQFHNENGYGLSFN 163
           + +LI + S  G+IY+++R                 +++   L ++ + H      L++N
Sbjct: 143 NPDLIGSASSNGSIYVFDRTKHGFARQKLISAGDTDHQIHCQLSTSLEEHKNEAVSLAWN 202

Query: 164 PNEKGKLLSGSDDSNIVLWDVTGKSQ-EPILTFTDRHSDI----VNDCKWHNFDQNIFGS 218
              +G L +      + +WD+    +  P L      S +     N+  W     ++   
Sbjct: 203 WQRQGLLATSYSHGQVCVWDLEKYDKNSPTLINPLAMSTVDPRGSNEVSWMVRHDSLLAY 262

Query: 219 VSEDSTLQLHDQRIRDAAVEKVQAKKPY-----NTLAFSAHSTNLFAAAGTDSMVYLYDR 273
            SED+ + + D  IR+    +     P+     NT  F+ H   L  +A +   + L+D 
Sbjct: 263 CSEDNLVGIMD--IRNPEKGQSSGSNPHHSNGINTCQFNYHRDMLLCSADSAGRINLWDI 320

Query: 274 RRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI-LWDLAEIGAEQVPDDADDG 332
           R  ++PL  +  H D+++ L+++P+E  VL + G D   + +WDL++   +         
Sbjct: 321 RNFTQPLKTLL-HNDSISVLQWNPREPTVLATGGQDGGLVKIWDLSQPEGQ--------- 370

Query: 333 SPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
             E++  H GH   +ND S +P+  W+  +   +N +QVW+PS+ L
Sbjct: 371 --ELIFTHGGHMLGVNDISWDPHDTWMMCSVANDNSIQVWRPSNSL 414

>TPHA0L01720 Chr12 (362572..363831) [1260 bp, 419 aa] {ON} Anc_8.548
           YBR195C
          Length = 419

 Score =  125 bits (313), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 103/408 (25%), Positives = 182/408 (44%), Gaps = 58/408 (14%)

Query: 13  IDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMIL------GTHTSDE 66
           + E Y  WK N  L+YD+++  +  WPSL+ ++     + N    IL      G     E
Sbjct: 23  LQERYTHWKKNTRLLYDYLNTNSTKWPSLSCQFFQDVNTKNDSHRILLSSFTSGLMPEQE 82

Query: 67  EQNYLKIAAI-YLPDEVVPDAEPKEEEEVLKSNVKIIKKFEH--------ENEVTRARYM 117
             N + I+ + ++P   + + +  E E    +N+K+  K  H          +  RARY+
Sbjct: 83  SINIMSISTLKHVPWASLNNFDMDEMEFKPDNNLKLPPKNLHTEQTITFPNGDCNRARYL 142

Query: 118 PQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHN--------ENGY-GLSFNPNE-- 166
           PQ+ ++IA  S  GT+Y++NR  +  S L  T  F +        EN    +  NPNE  
Sbjct: 143 PQNQDIIAGASSDGTVYIFNRT-KYGSTLRQTSSFQSYQARFAEPENTVQSVDSNPNEAL 201

Query: 167 --------KGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIV-----NDCKWHNFDQ 213
                   +G L +   D  I  WD+   S       T   S ++     ND  W     
Sbjct: 202 SIDWNVQREGLLAASYSDGEIKTWDLKKFSNANTTITTPTVSIMMDTNGANDVTWMPLHD 261

Query: 214 NIFGSVSEDSTLQLHDQR--IRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLY 271
           ++  +  E + L ++D R       +     +   N   F+  +  + A+A T   V+++
Sbjct: 262 SLLAACGESNKLIIYDIRGSREHTTISSGIHEDGINACRFNYANNLIVASADTVGNVHIW 321

Query: 272 DRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI-LWDLAEIGAEQVPDDAD 330
           D R++++ +  +P H  +++++E++P  D +L +AG D   + LWD+ +           
Sbjct: 322 DIRKSNEIVKTIP-HGSSISTIEWNPNMDTILATAGQDDGLVKLWDVTD----------- 369

Query: 331 DGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
               E++  H GH   +ND S N + PWL  +   +N VQ+W+P+  L
Sbjct: 370 ---SELIFTHGGHMLGVNDISWNRHDPWLMCSVARDNSVQIWRPAHNL 414

>SAKL0H09900g Chr8 complement(847975..849252) [1278 bp, 425 aa] {ON}
           similar to uniprot|P13712 Saccharomyces cerevisiae
           YBR195C MSI1 Subunit of chromatin assembly factor I
           (CAF- I) regulates the RAS/cAMP pathway via
           sequestration of Npr1p kinase localizes to the nucleus
           and cytoplasm homologous to human retinoblastoma binding
           proteins RbAp48 and RbAp46
          Length = 425

 Score =  125 bits (313), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 100/410 (24%), Positives = 186/410 (45%), Gaps = 50/410 (12%)

Query: 7   PEKPLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQ-EMILGTHTS- 64
           P  P  +   Y  WK N  L+YD+++  +  WPSLT ++ P   ++N Q  ++L + TS 
Sbjct: 24  PTIPEEVQTRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTNDQHRLLLSSFTSS 83

Query: 65  ----DEEQNYLKIAAI-YLPDEVVPDAEPKEEEEVLKSNVKI-----IKKFEHE---NEV 111
               DE     +++ + +LP   + + +  E E  L ++ K+     IK+        + 
Sbjct: 84  QLPEDESIYVSRVSTLKHLPWSSLNNFDMDEMEFKLDNSSKLPSKNLIKELNISFPMGDC 143

Query: 112 TRARYMPQDDNLIATISGVGTIYLYNRANEV-------ESGLLSTFQFH------NENGY 158
             ARY+PQ+ ++IA  S  G+IY+++R           + G +   +F       ++   
Sbjct: 144 NGARYLPQNPDVIAAASSNGSIYVFDRTKHGLTRQKLHDGGSMFELEFQSSSLEEHQEVV 203

Query: 159 GLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE-PILTFTDRHSDI----VNDCKWHNFDQ 213
            L++N   +G L +     ++ +WDV   S+  P++   D   +      ND  W     
Sbjct: 204 SLAWNWQREGLLAACYSGGDVKVWDVKKYSRNFPVIDKADYTHNADPRGCNDVSWMVNHA 263

Query: 214 NIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPY----NTLAFSAHSTNLFAAAGTDSMVY 269
           +I     E +++ + D R +   +   +  K +    N+  F+ H+  L  +  +   V 
Sbjct: 264 SILACCGESNSINVIDTRAQKGVLSSTKDTKHHSRGINSSQFNYHNDMLLCSGDSTGRVN 323

Query: 270 LYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAG-SDRRTILWDLAEIGAEQVPDD 328
           L+D R    PL  +  H  +++  +++P    +L +A  SD    LWD+A+   E     
Sbjct: 324 LWDIRDLETPLKSL-DHGSSISKTQWNPNLSTILATADQSDGLVKLWDIAQEPGE----- 377

Query: 329 ADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
                 E++ +H GH   +ND S N + PWL  +   +N VQ+W+P+  L
Sbjct: 378 ------ELLFVHGGHMLGVNDISWNYHDPWLMCSVANDNSVQLWRPARNL 421

>AEL250C Chr5 complement(168010..169263) [1254 bp, 417 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR195C
           (MSI1)
          Length = 417

 Score =  123 bits (309), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 103/408 (25%), Positives = 189/408 (46%), Gaps = 57/408 (13%)

Query: 13  IDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSR-SSNRQEMILGTHTSDE--EQN 69
           + + Y  WK N  L+YD+++  +  WPSLT +++P     +++  ++L + TS +  E  
Sbjct: 21  LQQRYTNWKKNTKLLYDYLNTNSTKWPSLTCQFMPDLEVPTDKHRLLLSSFTSSQLPEDE 80

Query: 70  YLKIAAI----YLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHE--------NEVTRARYM 117
            + I+ +    ++P   + + +  E E  + +  K+  K   E         +  RA YM
Sbjct: 81  AVYISELSTMRHVPWSSLNNFDMDEMEFKVDNQAKLPNKNLVETVRIQFPSGDCNRACYM 140

Query: 118 PQDDNLIATISGVGTIYLY-------NRANEVESGLLSTFQFHNENGYG---------LS 161
           PQ+ ++I  I+  G + ++       NR   + S      Q +     G         L+
Sbjct: 141 PQNPDIIGAIASTGAVNIFDRTKHGTNRPKLLGSAASYEIQLNEPESLGDADSAEALSLA 200

Query: 162 FNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIV------NDCKWHNFDQNI 215
           +N  + G + S   +  I +WD+T + Q+   T ++    I+      ND  W     +I
Sbjct: 201 WNWQKAGIIASSYSNGLIKVWDIT-RYQKSQPTISNPELRILQDKAGTNDVSWMVHHSSI 259

Query: 216 FGSVSEDSTLQLHDQRIRDAAVEKVQAKKPY----NTLAFSAHSTNLFAAAGTDSMVYLY 271
             +  E +T+ L D R  DA   K     P+    N L F+  +  L  AA ++  + L+
Sbjct: 260 LAACGESNTIGLLDTRAPDAF--KPTKASPHTGGINALQFNYANDMLLCAADSNGGIALW 317

Query: 272 DRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAG-SDRRTILWDLAEIGAEQVPDDAD 330
           D R  SKPL +   H D+V++L+++P    ++ +AG  D    +WD +     + P+D+ 
Sbjct: 318 DCRAFSKPLSVF-NHGDSVSALQWNPNLPTIVATAGQGDGLIKIWDTS-----REPEDS- 370

Query: 331 DGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
                ++ +H GH   +ND + N + PWL  +   +N V VWKP++ L
Sbjct: 371 -----LLFVHGGHMLGVNDIAWNYHDPWLMCSVANDNSVHVWKPAANL 413

>NDAI0C05510 Chr3 (1281190..1282449) [1260 bp, 419 aa] {ON}
           Anc_8.548
          Length = 419

 Score =  122 bits (306), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 102/415 (24%), Positives = 187/415 (45%), Gaps = 62/415 (14%)

Query: 10  PLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPG-SRSSNRQEMILGTHTS---- 64
           P  + + Y  WK N  L+YD+++     WPSLT ++ P    +S+   +++ + TS    
Sbjct: 14  PNDLQQRYSNWKKNTKLLYDYLNTNATKWPSLTCQFFPDLDTTSDTHRILISSFTSSQLP 73

Query: 65  -DEEQNYLKIAAIYLPD------------EVVPDAEPKEEEEVLKSNVKIIKKFEHENEV 111
            DE  +  KI+ +   +            E  PD   K   + L +++ I  KF +  + 
Sbjct: 74  EDEAIHISKISTLKHLNWASVNNFDMDEMEFKPDTNLKLPSKHLVNDLTI--KFPN-GDC 130

Query: 112 TRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLST--------FQFHN--------E 155
            RARY+PQ+ ++IA  S  G++Y+++R     S +  +          F+N        E
Sbjct: 131 NRARYLPQNPDVIAAASSNGSVYIFDRTKHGSSRIRQSKNLKPYDAVLFNNSETVEELHE 190

Query: 156 N---GYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQ------EPILTFTDRHSDIVNDC 206
           N      L++N  ++G L S      + +WD+           +P+L      +  VND 
Sbjct: 191 NTNEAISLAWNYQKEGTLASCYLQGQVQIWDIKQYFHSNPVLDKPVLNI-QFDALGVNDV 249

Query: 207 KWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKK--PYNTLAFSAHSTNLFAAAGT 264
            W     ++F +  E  TL L DQRI        Q +     N+  F+  +  L A+A +
Sbjct: 250 SWMPSHDSLFVACGESDTLALFDQRIGKEVSRIAQNRHNGGVNSCKFNYQNNMLLASADS 309

Query: 265 DSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAG-SDRRTILWDLAEIGAE 323
           + +V ++D R   +       H  +++++E++P  D ++ +AG +D    LWD++     
Sbjct: 310 EGLVNMWDIRNLDQYPIKSINHGSSISTIEWNPNLDTIIATAGQNDGLVKLWDVS----- 364

Query: 324 QVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
                  +   E++ +H GH   +ND S + +  WL  +   +N +Q+WKP+  L
Sbjct: 365 -------NTDNELLFVHGGHMLGVNDISWDLHDSWLMCSVSNDNSIQIWKPAHNL 412

>KLLA0E23541g Chr5 (2095246..2096499) [1254 bp, 417 aa] {ON} similar
           to uniprot|P13712 Saccharomyces cerevisiae YBR195C MSI1
           Subunit of chromatin assembly factor I (CAF- I)
           regulates the RAS/cAMP pathway via sequestration of
           Npr1p kinase localizes to the nucleus and cytoplasm
           homologous to human retinoblastoma binding proteins
           RbAp48 and RbAp46
          Length = 417

 Score =  122 bits (305), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 98/416 (23%), Positives = 193/416 (46%), Gaps = 48/416 (11%)

Query: 3   ISNPPEKPLSIDEE----YDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSN-RQEM 57
           I  PPE    I  E    Y  WK N  L+YD+++     WPSL+ ++ P    +N +Q +
Sbjct: 6   IEEPPELGSGISNEVQQRYTNWKKNTKLLYDYLNTNTSKWPSLSCQFFPDRTLTNDKQRI 65

Query: 58  ILGTHTSDE-------------EQNYLKIAAIYLPD----EVVPDAEPKEEEEVLKSNVK 100
           +L + TS +               N++K ++I   D    E   D   K  ++ L+  V+
Sbjct: 66  LLSSFTSQQLPQDESIYIGSISTMNHMKWSSINNFDMDEMEFKLDNSLKLNDKTLEEEVR 125

Query: 101 IIKKFEHENEVTRARYMPQDDNLIATISGVGTIYLYNR---ANEVESGLLSTFQFHN--- 154
           I      + +  R RYMPQ+ ++I T S  G++Y+++R    N++ +G     +  N   
Sbjct: 126 ITYP---DGDCNRCRYMPQNPDIIGTASSNGSVYIFDRTKHGNKISTGRKFEIECRNNGD 182

Query: 155 ---ENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTG--KSQEPILTFTDRHSDI----VND 205
              +    L++N   +G L +   +  + +WD+T   KS++  +   +R S +    VND
Sbjct: 183 DEQDESLSLAWNYQLEGTLATCQSNGKVKVWDLTKFDKSKQR-MEIPERESVMDANGVND 241

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHD--QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAG 263
             W     +I  S  E + + L D  Q  +   + +       N + F+  +  +     
Sbjct: 242 VSWMVNHTSILASCGESNVIGLIDIRQDTKMDTLHRTTHTDGINAIEFNYKNDMILCTGD 301

Query: 264 TDSMVYLYDRRRASKPLHMMP-GHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGA 322
           +   + ++D R   +P+     G +D +++++++PQ   +L +A  D+++ L  + +   
Sbjct: 302 SQGQLKIWDIRDFKEPIKEWEHGDQDPISAIQWNPQIPQILATA--DQQSGLVKIWDASG 359

Query: 323 EQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
           EQ   +A++    ++ +H GH   +ND S + + PW   +   +N + +WKP++ L
Sbjct: 360 EQEDSNAENNM--LLFVHGGHMLGVNDISWSQHDPWTMCSVSNDNSIHIWKPAANL 413

>Suva_4.449 Chr4 complement(780822..782096) [1275 bp, 424 aa] {ON}
           YBR195C (REAL)
          Length = 424

 Score =  120 bits (302), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 105/425 (24%), Positives = 194/425 (45%), Gaps = 78/425 (18%)

Query: 10  PLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSS-NRQEMILGTHTS---- 64
           P+ + E Y  WK N  L+YD+++  +  WPSLT ++ P   ++ +   ++L + TS    
Sbjct: 16  PIDLQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFTSSQKP 75

Query: 65  DEEQNYL-KIAAI----------YLPDEVVPDAEPKEEEEVLKSN-VKIIKKFEHENEVT 112
           ++E  Y+ KI+ +          +  DE+  + +P+    +  S+ V  I  F    +  
Sbjct: 76  EDETIYISKISTLGHIKWSSLNNFDMDEM--EFKPENTTRLPPSHLVNDISIFFPNGDCN 133

Query: 113 RARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFH------------------- 153
           RARY+PQ+ ++IA  S  G IY+++R     + +  +   H                   
Sbjct: 134 RARYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKNSHPFEAKLFGSHGVIQDVEAM 193

Query: 154 -------NENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE------PILTFTDRHS 200
                  NE    L++N  ++  LLS   +  + +WD+   S E      P+++     S
Sbjct: 194 DTSSADVNE-ATSLAWNLQQEALLLSSHSNGQVQIWDIKQYSHENPLIDSPLVSIESDAS 252

Query: 201 DIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKP-----YNTLAFSAHS 255
             VND  W     ++F + +E + + L D R +    EK+++ +       N+  F+  +
Sbjct: 253 G-VNDVTWMPTHDSLFAACTEGNVVSLLDLRTKK---EKLRSNRQNHTGGVNSCKFNYRN 308

Query: 256 TNLFAAAGTDSMVYLYDRRRASK-PLHMMPGHEDAVTSLEFHPQEDGVLISAGS-DRRTI 313
           + + A+A ++  + L+D R+ ++ P+  M  H  ++++LE++P    VL +AG  D    
Sbjct: 309 SLVLASADSNGRLNLWDIRKMNESPITTME-HGASISTLEWNPNFSTVLATAGQQDGLVK 367

Query: 314 LWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
           LWD A                E +  H GH   +ND S + + PWL  +   +N V +WK
Sbjct: 368 LWDTAR--------------EETIFTHGGHMLGVNDVSWDVHDPWLMCSVANDNSVHIWK 413

Query: 374 PSSKL 378
           P+  L
Sbjct: 414 PAENL 418

>Skud_2.321 Chr2 complement(577912..579180) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  120 bits (302), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 106/416 (25%), Positives = 182/416 (43%), Gaps = 66/416 (15%)

Query: 13  IDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSS-NRQEMILGTHTSDE--EQN 69
           + E Y  WK N  L+YD+++  +  WPSLT ++ P   ++ N   ++L + TS +  E  
Sbjct: 19  LQERYSHWKKNTKLLYDYLNTNSTKWPSLTCQFFPDLDTTLNEHRILLSSFTSSQKPEDE 78

Query: 70  YLKIAAIYLPDEV---------VPDAEPKEEEEVL---KSNVKIIKKFEHENEVTRARYM 117
            + I+ I     +         + + E K E       K  V  I+ F    E  RARY+
Sbjct: 79  TIYISRISTLGHIKWASLNNFDMDEMEFKPENTTTYPSKHLVDDIRIFFPNGECNRARYL 138

Query: 118 PQDDNLIATISGVGTIYLYNRANE-----VESGLLSTFQFHNENGYG------------- 159
           PQ+ ++IA  S  G IY+++R         +S +   F+      +G             
Sbjct: 139 PQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEIKLLGSHGVIQDVETMDTSLV 198

Query: 160 -------LSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE-PI----LTFTDRHSDIVNDCK 207
                  L++N  ++  LLS   +  I +WD+   S + PI    L   D     VND  
Sbjct: 199 DINEATSLAWNLQQEALLLSSHSNGQIQVWDIKQYSHDNPIIDVPLMSIDSDGSSVNDVT 258

Query: 208 WHNFDQNIFGSVSEDSTLQLHDQRIRDAAVE---KVQAKKPYNTLAFSAHSTNLFAAAGT 264
           W     ++F + +E + + L D R +   ++   K+      N+  F+  ++ + A+A +
Sbjct: 259 WMPTHDSLFAACTERNAVSLLDLRTKKEKLKSNCKIHGGG-VNSCKFNYKNSLILASADS 317

Query: 265 DSMVYLYDRRRASK-PLHMMPGHEDAVTSLEFHPQEDGVLISAGS-DRRTILWDLAEIGA 322
           +  + L+D R  ++ P+  M  H  +V++LE+ P  D VL +AG  D    LWD      
Sbjct: 318 NGRLNLWDIRNMNENPIATME-HGASVSTLEWSPNFDTVLATAGQEDGLVKLWDTTR--- 373

Query: 323 EQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
                       E +  H GH   +ND S + + PWL  +   +N V +WKP+  +
Sbjct: 374 -----------EESIFTHGGHMFGVNDISWDVHDPWLMCSVANDNSVHIWKPAENI 418

>NCAS0B02170 Chr2 complement(354274..355518) [1245 bp, 414 aa] {ON}
           Anc_8.548
          Length = 414

 Score =  119 bits (297), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 107/418 (25%), Positives = 184/418 (44%), Gaps = 71/418 (16%)

Query: 10  PLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPG-SRSSNRQEMILGTHTSDE-- 66
           P  + + Y  WK N  L+YD+++  +  WPSLT ++      +S+   ++L   TS +  
Sbjct: 15  PEDLQQRYSNWKKNTRLLYDYLNTNSKKWPSLTCQFFHDLDTTSDTHRILLSAFTSSQLP 74

Query: 67  EQNYLKIAAI----YLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTR--------A 114
           E   + IA +    +L    + + +  E E   ++N+K+  K    +   R        A
Sbjct: 75  EDEAIYIAKLSTLKHLEWASINNFDMDEMEFKPENNIKLPSKNLTNDISIRFPDGDCNIA 134

Query: 115 RYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGY---------------- 158
           RY+PQ+ ++IA  S  G+IY+++R    + G L   Q  N   Y                
Sbjct: 135 RYLPQNPDVIAGASSHGSIYIFDR---TKHGSLRMRQSKNLKPYEAALYCPPKGIENVEN 191

Query: 159 -----GLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPI-----LTFTDRHSDIVNDCKW 208
                 +S+N   +G L S      I LWD+   S   +     L   D  +  VND  W
Sbjct: 192 TNEATSISWNLQREGLLASCYSSGQIQLWDLKKYSNSKLEMDTPLLNVDFDALGVNDVNW 251

Query: 209 HNFDQNIFGSVSEDSTLQLHDQRIRDAAV---EKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
           H    +I  +  E + + L D R+    +   EK+      N+  F++H  +L  +  ++
Sbjct: 252 HPSHDSILAASGESNIIGLFDNRLGTEILRSNEKMH-NGGINSCKFNSHCDSLLISGDSE 310

Query: 266 SMVYLYDRRRAS----KPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI-LWDLAEI 320
             + L+D R+      K LH    H  ++++LE++P  + ++ SAG D   + LWD++  
Sbjct: 311 GRINLWDLRKLDGEPIKTLH----HGSSISTLEWNPNLETIVASAGQDDGLVKLWDVS-- 364

Query: 321 GAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
                       + E++  H GH   +ND S N +  WL  +   +N VQVWKP+  L
Sbjct: 365 ------------TDELVFTHGGHMLGVNDISWNLHDTWLMCSVSNDNSVQVWKPAHNL 410

>Smik_2.335 Chr2 complement(596903..598171) [1269 bp, 422 aa] {ON}
           YBR195C (REAL)
          Length = 422

 Score =  119 bits (297), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 108/422 (25%), Positives = 190/422 (45%), Gaps = 72/422 (17%)

Query: 10  PLSIDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSS-NRQEMILGTHTS---- 64
           P ++ E Y  WK N  L+Y++++  +  WPSLT ++ P   ++ +   ++L + TS    
Sbjct: 16  PPNLQERYSHWKKNTKLLYEYLNTNSTKWPSLTCQFFPDLDTTLDEHRILLSSFTSSQKP 75

Query: 65  DEEQNYL-KIAAI------YLPDEVVPDAEPKEEEEVL---KSNVKIIKKFEHENEVTRA 114
           ++E  Y+ KI+ +       L +  + + E K E       K  V  I  F    E  RA
Sbjct: 76  EDESIYISKISTLGHIKWSSLNNFDMDEMEFKPENSTRYPPKHLVNDISIFFPNGECNRA 135

Query: 115 RYMPQDDNLIATISGVGTIYLYNRANE-----VESGLLSTFQFHNENGYG---------- 159
           RY+PQ+ ++IA  S  G IY+++R         +S +   F+      +G          
Sbjct: 136 RYLPQNPDIIAGASSDGAIYIFDRTKHGSTRIRQSKISHPFEAKLFGSHGVIQDVETMDA 195

Query: 160 ----------LSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE------PILTFTDRHSDIV 203
                     +++N  ++  LLS   +  + +WD+   S E      P+++     S  V
Sbjct: 196 SSADINEATSIAWNLQQEALLLSSHSNGQVQVWDIKQYSHENPIIDLPLVSINSDGSG-V 254

Query: 204 NDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQA-----KKPYNTLAFSAHSTNL 258
           ND  W     ++F + +E +T+ L D R +    EK+++         N+  F+  ++ +
Sbjct: 255 NDVTWMPTHDSLFAACTEGNTVSLLDLRTKK---EKLKSNCRSHNGGVNSCKFNYRNSLI 311

Query: 259 FAAAGTDSMVYLYDRRRASK-PLHMMPGHEDAVTSLEFHPQEDGVLISAGS-DRRTILWD 316
            A+A ++  + L+D R  +  PL  M  H  +V++LE+ P  D VL +AG  D    LWD
Sbjct: 312 LASADSNGKLNLWDIRNMNDCPLTTME-HGGSVSTLEWSPNFDTVLATAGQEDGLVKLWD 370

Query: 317 LAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSS 376
            +                E +  H GH   +ND S + + PWL  +   +N V +WKP+ 
Sbjct: 371 TSR--------------EENIFTHGGHMLGVNDISWDAHDPWLMCSVANDNSVHIWKPAV 416

Query: 377 KL 378
            L
Sbjct: 417 NL 418

>TDEL0B02980 Chr2 complement(529584..530822) [1239 bp, 412 aa] {ON}
           Anc_8.548 YBR195C
          Length = 412

 Score =  117 bits (294), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 97/408 (23%), Positives = 179/408 (43%), Gaps = 62/408 (15%)

Query: 15  EEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPG-SRSSNRQEMILGTHTSDE--EQNYL 71
           + Y  WK N  L+YD+++  +  WPSLT E+ P    +++   ++L + TS +  E   +
Sbjct: 17  QRYSNWKKNTKLLYDYLNTNSAKWPSLTCEFFPDLDTTTDSHRLLLSSFTSSQLPEDESI 76

Query: 72  KIAAIYLPD---------------EVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARY 116
            I+ I                   E  P+   K     L  ++ I       N   RARY
Sbjct: 77  YISRISTLKHLHWSSLNNFDMDEMEFKPENSTKLPPRNLTDDISIRIPSGDSN---RARY 133

Query: 117 MPQDDNLIATISGVGTIYLYNRANEVESGLLST----FQFHNENG------------YGL 160
           +PQ+ ++I+  S  G+IY+++R     +   ST    ++   E                L
Sbjct: 134 LPQNPDVISAASSDGSIYIFDRTKHNSTISRSTTSRPYEIKLEVAPQVELMDSPNEVVSL 193

Query: 161 SFNPNEKGKLLSGSDDSNIVLWDVTG------KSQEPILTFTDRHSDIVNDCKWHNFDQN 214
            +N  ++G L S      +++WD++         Q PI +  D      ND  W     +
Sbjct: 194 DWNKRKEGILASCHSRGQLLVWDISQYLHSNPTIQTPICSIDDFDPQGANDITWMPSHDS 253

Query: 215 IFGSVSEDSTLQLHDQRIRDAAVEKVQA---KKPYNTLAFSAHSTNLFAAAGTDSMVYLY 271
           +  +  E +T+ ++D R + + V K+Q        N+  F+AH+  L A+A +   V+++
Sbjct: 254 LLAACGESNTVAIYDTRSK-SQVSKIQPGLHNGGINSCDFNAHNDYLLASADSIGTVHMW 312

Query: 272 DRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGS-DRRTILWDLAEIGAEQVPDDAD 330
           D R+  +       H  ++++++++P    ++  AG  D    LWD            A 
Sbjct: 313 DIRKLDQDPIQSVSHGSSISTVKWNPNVATIIAVAGQEDGLVKLWD------------AS 360

Query: 331 DGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
           +G  +++  H GH   +ND + N + PWL  +   +N + +W+PSS L
Sbjct: 361 NG--QLIFTHGGHMLGVNDIAWNAHDPWLMCSVSNDNSIHLWRPSSHL 406

>KNAG0A03670 Chr1 complement(472849..474129) [1281 bp, 426 aa] {ON}
           Anc_8.548 YBR195C
          Length = 426

 Score =  117 bits (292), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 105/427 (24%), Positives = 182/427 (42%), Gaps = 69/427 (16%)

Query: 13  IDEEYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPG-SRSSNRQEMILGTHTS-----DE 66
           +   Y  WK N  L+YD+++     WPSLT ++ P    +++   ++L ++TS     DE
Sbjct: 15  LQTRYAYWKKNTKLLYDYLNTNTAKWPSLTCQFFPDVDANTDTHRILLSSYTSCQLPEDE 74

Query: 67  EQNYLKIAAIYLPD------------EVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRA 114
                 I+ +   D            E  PD   K   + L +NV I        +  RA
Sbjct: 75  NVYVASISTLAHLDWASLNNFDMDEMEFKPDRTTKFPPKNLATNVSITFP---RGDCNRA 131

Query: 115 RYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYG--------------- 159
           RYMPQ+ ++IA  S  G +Y++NR       +        E  YG               
Sbjct: 132 RYMPQNPDVIAAASSNGAVYVFNRTKHGTRRIQKHAASDAEQDYGPYEARFYNEETDEAR 191

Query: 160 ----------LSFNPNEKGKLLSGSDDSNIVLWDV------TGKSQEPILTFTDRHSDIV 203
                     L++N + +G L        + +WD+           E     ++  S  V
Sbjct: 192 RTPVDNEAVSLAWNHHREGTLAVAYSHGAVKVWDLQRFNVDNTTISETEWECSNFDSRGV 251

Query: 204 NDCKWHNFDQNIFGSVSEDS-TLQLHDQRIRDAAVEKVQAK---KPYNTLAFSAHSTNLF 259
           ND  W +   +I  +  E S +L L D R ++A V K++ +   +  N   F+  +  L 
Sbjct: 252 NDVSWMSQHDSILAACGERSDSLALFDTRAQNA-VAKIRNQFKSEGINACKFNWENNLLL 310

Query: 260 AAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAG-SDRRTILWDLA 318
           A+  +     L+D R+ S    +   H  +V++LE++P +  VL +AG SD    +WD +
Sbjct: 311 ASTDSTGRTNLWDVRKLSAEPIVHFDHGGSVSTLEWNPHDHSVLATAGQSDGLIKIWDTS 370

Query: 319 EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
                ++ D       + + +H+GH   +ND + + + PWL  +   +N V VWKP++ L
Sbjct: 371 L----EIED-------KTIFVHSGHMLGVNDIAWDLHDPWLMCSVSNDNSVHVWKPAANL 419

Query: 379 PRIGGTP 385
            +   +P
Sbjct: 420 VQRCTSP 426

>Suva_13.311 Chr13 complement(511812..513344) [1533 bp, 510 aa] {ON}
           YMR131C (REAL)
          Length = 510

 Score = 78.6 bits (192), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 90/402 (22%), Positives = 175/402 (43%), Gaps = 62/402 (15%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNR----QEMIL--GTHTSDEEQNYLKIAAIYL 78
           P +Y+ +   N+ WP LTL+ +P +  + R    Q ++L   T +S +++N L + A+  
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGTERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 79  PDEVVPDAEPKEEEEVLKSNVKIIKKFEHEN-----EVTRARYMP----QDDNLIATISG 129
             + +   + +E++E  +    +    E+EN        R +  P      + L AT+S 
Sbjct: 174 LTKTLLKDDNEEDDEEGEDEEDVDPVIENENIPLRDTTNRLKVSPFAVSNQEVLTATMSE 233

Query: 130 VGTIYLYNRANEVESGLLSTFQF--------------HNENGYGLSFNPNEK-GKLLSGS 174
            G +Y+Y+ A + ++     +Q                N  GYGL ++P  K G LLSG 
Sbjct: 234 NGDVYIYDLAAQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGD 293

Query: 175 DDSNIVL-------WDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQL 227
               I L       W VT K      +FT  +++ + D +W   +  +F + + D  +++
Sbjct: 294 CSGQIYLTQRHTSRW-VTDKQ-----SFTVSNNESIEDIQWSRTESTVFATAACDGYIRI 347

Query: 228 HDQRIRD--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS-------K 278
            D R +    A+    +    N +++S     L A+   +    ++D R+ +       +
Sbjct: 348 WDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTVQ 407

Query: 279 PLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQVPDDA------DD 331
           P+     H+ A+TS+ F+P ++ ++     D    LWDL+ E   E++   A       D
Sbjct: 408 PVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQD 467

Query: 332 GSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
             P+++ +H   +  + D   +  IP    +   + +  VWK
Sbjct: 468 IPPQLLFVH--WQREVKDVKWHKQIPGCLVSTGTDGL-NVWK 506

>YMR131C Chr13 complement(533163..534698) [1536 bp, 511 aa] {ON}
           RRB1Essential nuclear protein involved in early steps of
           ribosome biogenesis; physically interacts with the
           ribosomal protein Rpl3p
          Length = 511

 Score = 77.8 bits (190), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 90/402 (22%), Positives = 169/402 (42%), Gaps = 62/402 (15%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNR----QEMIL--GTHTSDEEQNYLKIAAIYL 78
           P +Y+ +   N+ WP LTL+ +P +  S R    Q ++L   T +S +++N L + A+  
Sbjct: 115 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 174

Query: 79  PDEVVPDAEPKEEEEVLKSNVKIIKKFEHEN-----EVTRARYMP----QDDNLIATISG 129
             + +   + + E++       +    E+EN        R +  P      + L AT+S 
Sbjct: 175 LAKTLLKDDNEGEDDEEDDEDDVDPVIENENIPLRDTTNRLKVSPFAISNQEVLTATMSE 234

Query: 130 VGTIYLYNRANEVESGLLSTFQF--------------HNENGYGLSFNPNEK-GKLLSGS 174
            G +Y+YN A + ++     +Q                N  GYGL ++P  K G LLSG 
Sbjct: 235 NGDVYIYNLAPQSKAFSTPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGALLSGD 294

Query: 175 DDSNIVL-------WDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQL 227
               I         W VT K       FT  ++  + D +W   +  +F +   D  +++
Sbjct: 295 CSGQIYFTQRHTSRW-VTDKQ-----PFTVSNNKSIEDIQWSRTESTVFATAGCDGYIRI 348

Query: 228 HDQRIRD--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRR-------ASK 278
            D R +    A+    +    N +++S     L A+   +    ++D R+       A +
Sbjct: 349 WDTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADAVQ 408

Query: 279 PLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQVPDDADDGS---- 333
           P+     H+ A+TS+ F+P ++ ++     D    LWDL+ E   E++   A +      
Sbjct: 409 PVAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQE 468

Query: 334 --PEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
             P+++ +H   +  + D   +  IP    +   + +  VWK
Sbjct: 469 IPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 507

>Sklu_YGOB_Anc_2.401 Chr5 complement(385202..386764) [1563 bp, 520
           aa] {ON} ANNOTATED BY YGOB -
          Length = 520

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 89/401 (22%), Positives = 168/401 (41%), Gaps = 58/401 (14%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNRQE------MILGTHTSDEEQNYLKIAAIYL 78
           P +Y+ +   N+ WP +TL+ +P S  S R+       M   T  S ++ N L +  +  
Sbjct: 122 PTVYEMLHNVNMPWPCMTLDIIPDSLGSERRNYPQSILMTTATQASKKKDNELMVLKLSQ 181

Query: 79  PDEVVPDAEPKEEEEVLKSNVKIIKKFEHEN-----EVTRARYMP------QDDNLIATI 127
             + +   +  E+EE    +  +    E+EN        R +  P        + L AT+
Sbjct: 182 LTKTLAKEDNGEDEEEEDDDDTVDPIIENENIQLRDTTNRLKVSPFASSSNSQEILTATM 241

Query: 128 SGVGTIYLYNRANEVESGLLSTFQF--------------HNENGYGLSFNPNEK-GKLLS 172
           S  G +Y+++ A++V++     +Q                N  GY L ++P  K G LL+
Sbjct: 242 SENGEVYIFDLASQVKAFKTPGYQIPKAAKKPIHTIKSHGNVEGYALDWSPLIKTGALLT 301

Query: 173 GSDDSNIVLWDV-TGK---SQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLH 228
           G     + L    T K    +EP   FT  ++  V D +W   +  +F S   D  +++ 
Sbjct: 302 GDCSGQVYLTQRHTSKWISDKEP---FTVANNQSVEDIQWSRTESTVFASCGCDGYIRVW 358

Query: 229 DQRIRD--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS-------KP 279
           D R +    A+    +    N +++S     L A+   +    ++D R+ S        P
Sbjct: 359 DTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDNGTWGVWDLRQFSPSNSNNTSP 418

Query: 280 LHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQVPDDADDGS----- 333
           +     H+ A+TS+ F+P ++ ++  A  D    LWDL+ E   E++   A +       
Sbjct: 419 VAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQI 478

Query: 334 -PEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
            P+++ +H   +  + D   +  IP    +   + +  +WK
Sbjct: 479 PPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDGL-NIWK 516

>KLLA0F17237g Chr6 (1577197..1578768) [1572 bp, 523 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 essential nuclear protein involved in early
           steps of ribosome biogenesis
          Length = 523

 Score = 75.1 bits (183), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 90/414 (21%), Positives = 168/414 (40%), Gaps = 58/414 (14%)

Query: 9   KPLSIDE--EYDLWKSNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQE------MILG 60
           KPL  DE  E D      P +Y+ +   N+ WP +TL+ +P +  S R+       M   
Sbjct: 115 KPLGPDEVLEAD------PTVYEMLHTVNVPWPCMTLDVIPDTLGSGRRNYPQSLLMATA 168

Query: 61  THTSDEEQNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHEN-----EVTRAR 115
           T  S + QN L +  +    + +   +  E E   +         E+EN        R +
Sbjct: 169 TQASKKNQNELMVLKMSQLAKTLVKEDEDENEGEDEDEDGTDPVIENENISLKDTTNRLK 228

Query: 116 YMP----QDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNE--------------NG 157
             P      + L +T+S  G +Y+++ A++V++     +Q   +               G
Sbjct: 229 VSPFANAAQEVLCSTMSENGEVYIFDLASQVKAFETPGYQIPKQAKRPIHTVRNHGSVEG 288

Query: 158 YGLSFNPNEK-GKLLSGSDDSNIVLWDV-TGKSQEPILTFTDRHSDIVNDCKWHNFDQNI 215
           Y   ++P  K G +LSG     + L    T K       FT  ++  + D +W   +  +
Sbjct: 289 YANDWSPIIKTGAMLSGDCSGQVFLTQRHTSKWITDKQAFTVANNKSIEDLQWSRTESTV 348

Query: 216 FGSVSEDSTLQLHDQRIRD--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDR 273
           F S   D  +++ D R +    A+    +    N +++S     L A+   D    ++D 
Sbjct: 349 FASCGIDGYIRIWDTRSKKHKPAISVKASNTDVNVISWSEKIGYLLASGDDDGTWGVWDL 408

Query: 274 RR-------ASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQV 325
           R+        + P+     H+ A+TS+ F+P ++ ++  A  D    LWDL+ E   E++
Sbjct: 409 RQFTPQNASTASPVAQYQFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEI 468

Query: 326 PDDADDGS------PEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
              A +        P+++ +H   +  + D   +  IP    +   + +  VWK
Sbjct: 469 KQQAAETKELQQIPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 519

>KNAG0E02180 Chr5 (440039..441592) [1554 bp, 517 aa] {ON} Anc_2.401
           YMR131C
          Length = 517

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 88/400 (22%), Positives = 166/400 (41%), Gaps = 57/400 (14%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNRQE------MILGTHTSDEEQNYLKIAAI-Y 77
           P +Y+ +   NL WP +TL+ +P    S R+       M   T  S +++N L + ++  
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDVIPDKLGSERRNYPQSILMTTATQASKKKENELMVLSLSQ 179

Query: 78  LPDEVVPDAEPKEEEEVLKSNVKIIKKFEHEN-----EVTRARYMP----QDDNLIATIS 128
           L   +V   E ++E+E            E+EN        R +  P      + L AT+S
Sbjct: 180 LNKTLVKSEEDEDEDEDSDEEDDSDPIIENENIKLNDTTNRLKVSPFASTDKEVLTATMS 239

Query: 129 GVGTIYLYNRANEVESGLLSTFQF--------------HNENGYGLSFNPNEK-GKLLSG 173
             G +Y+++ A + ++     +Q                N  GY L ++P  K G LL+G
Sbjct: 240 ENGEVYIFDLAPQSKAFSTPGYQIPKTARRPIHTVRNHGNVEGYALDWSPMIKNGALLTG 299

Query: 174 SDDSNIVLWDVTGKSQEPILT----FTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
                I     T +     +T    FT  ++  V D +W   +  +F S   D  +++ D
Sbjct: 300 DCSGQIYF---TQRHTSKWITDKQPFTAENNKSVEDIQWSRTESTVFASAGCDGYIRIWD 356

Query: 230 QRIRD--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS-------KPL 280
            R +    A+    +    N +++S     L A+   + +  ++D R+ S       +P+
Sbjct: 357 TRSKKHKPALSVKASNTDVNVISWSEKIGYLLASGDDNGLWGVWDLRQFSPDNINDVQPV 416

Query: 281 HMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQVPDDADDGS------ 333
                H+ A+TS+ F+P +D ++  A  D    LWDL+ E   E++     +        
Sbjct: 417 AQYDFHKGAITSINFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQIAETKELEKIP 476

Query: 334 PEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
           P+++ +H   +  + D   +  IP    +   + +  +WK
Sbjct: 477 PQLLFVH--WQKDVKDVKWHKQIPGCLVSTGTDGL-NIWK 513

>KAFR0A00380 Chr1 (70400..71950) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 75.1 bits (183), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 87/400 (21%), Positives = 167/400 (41%), Gaps = 57/400 (14%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNRQE------MILGTHTSDEEQNYLKIAAI-Y 77
           P +YD +    + WP LTL+ +P +  S R+       M   T  S +++N L + ++  
Sbjct: 119 PTVYDMLHNVTMPWPCLTLDIIPDNLGSQRRNYPQSLLMTTATQASRKKENELMVLSLSQ 178

Query: 78  LPDEVVPDAEPKEEEEVLKSNVKIIKKFEHEN-----EVTRARYMP----QDDNLIATIS 128
           L   +V D +    +E  +   +     E+EN        R R  P      + L AT+S
Sbjct: 179 LAKTLVKDDDEVNSDEEDEDRDETDPIIENENISLRDTTNRLRVSPFAQSNKEVLTATMS 238

Query: 129 GVGTIYLYNRANEVESGLLSTFQF--------------HNENGYGLSFNPNEK-GKLLSG 173
             G +Y+++   + ++     +Q                N  GY L ++P  K G LL+G
Sbjct: 239 ENGEVYIFDLGPQSKAFSSPGYQVPKSSKRPVHTIKNHGNVEGYALDWSPLIKTGALLTG 298

Query: 174 SDDSNIVLWDVTGKSQEPILT----FTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
                I L   T ++    +T    FT  ++  V D +W   +  +F S   D  +++ D
Sbjct: 299 DCSGQIYL---TQRNTSKWVTDKQPFTVGNNKSVEDIQWSRTEATVFASCGCDGYVRIWD 355

Query: 230 QRIRD--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS-------KPL 280
            R +    A+    +    N ++++     L A+   +    ++D R+ +       +P+
Sbjct: 356 TRSKQHKPALSVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNINNVQPV 415

Query: 281 HMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQVPDDADDGS------ 333
                H+ A+TS+ F+P E+ ++  A  D    LWDL+ E   E++   A +        
Sbjct: 416 AQYDFHKGAITSISFNPLEESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELESIP 475

Query: 334 PEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
           P+++ +H   +  + D   +  IP    +   + +  +WK
Sbjct: 476 PQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 512

>TDEL0G03340 Chr7 (618276..619820) [1545 bp, 514 aa] {ON} Anc_2.401
           YMR131C
          Length = 514

 Score = 73.6 bits (179), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 90/402 (22%), Positives = 172/402 (42%), Gaps = 62/402 (15%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNRQE------MILGTHTSDEEQNYLKIAAI-Y 77
           P +Y+ +   N+ WP LTL+ +P    + R+       M   T  S +++N L +  +  
Sbjct: 118 PTVYEMLHNVNMPWPCLTLDIIPDGLGTERRNYPQSILMATATQASKKKENELMVLKLSQ 177

Query: 78  LPDEVVPDAEPKEEEEVLKSNVKIIKKFEHE--------NEVTRARYMPQDDNLIATISG 129
           L   +V D   +EE++    +       E+E        N +  + +    + L AT+S 
Sbjct: 178 LNKTLVKDDADEEEDDEDDEDNDSDPIIENEEISLRDTTNRLKISPFASSQEVLTATMSE 237

Query: 130 VGTIYLYNRANEVES-------------GLLSTFQFH-NENGYGLSFNPNEK-GKLLSGS 174
            G +Y+++   + ++               L T + H N  GYGL ++P  K G LL+G 
Sbjct: 238 NGEVYIHDLGPQTKAFETPGYQIPKSAKKPLHTIRNHGNVEGYGLDWSPLIKTGALLTGD 297

Query: 175 DDSNIVL-------WDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQL 227
               + L       W VT K  +P  TF++  S  + D +W   +  +F +   D  +++
Sbjct: 298 CSGQVYLTQRHTSKW-VTDK--QP-FTFSNNKS--IEDIQWSRTESTVFATSGCDGYIRI 351

Query: 228 HDQRIRD--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS-------K 278
            D R +    A+    +    N ++++     L A+   D    ++D R+ S       +
Sbjct: 352 WDTRSKKHKPAISTRASATDVNVISWNEKIGYLLASGDDDGRWGVWDLRQLSPNNSENVQ 411

Query: 279 PLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQVPDDADDGS---- 333
           P+     H+ A+TS+ F+P ++ ++  A  D    LWDL+ E   E++   A +      
Sbjct: 412 PVAQYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQ 471

Query: 334 --PEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
             P+++ +H   +  + D   +  IP    +   + +  VWK
Sbjct: 472 IPPQLLFVH--WQKEVKDVKWHRQIPGCLVSTGTDGL-NVWK 510

>Skud_13.291 Chr13 complement(506764..508293) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 71.2 bits (173), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 90/401 (22%), Positives = 175/401 (43%), Gaps = 61/401 (15%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNR----QEMILGTHT--SDEEQNYLKIAAIY- 77
           P +Y+ +   N+ WP LTL+ +P +  S R    Q ++L T T  S + +N L + A+  
Sbjct: 114 PSVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLATATQSSRKRENELMVLALSN 173

Query: 78  LPDEVVPDAEPKEEEEVLKSNVKIIKKFEH---ENEVTRARYMP----QDDNLIATISGV 130
           L   ++ D   ++++E  + +V  + + E+   ++   R +  P      + L AT+S  
Sbjct: 174 LTKTLLKDDNEEDDDEEEEDDVDAVIENENMPLKDTTNRLKVSPFAASNQEVLTATMSEN 233

Query: 131 GTIYLYNRANEVESGLLSTFQFH--------------NENGYGLSFNPNEK-GKLLSGSD 175
           G +Y+Y+ A + ++     +Q                N  GYGL ++P  K G LLSG  
Sbjct: 234 GDVYIYDLAPQSKAFSTPGYQISKSAKRPIHTVKSHGNVEGYGLDWSPLIKTGALLSGDC 293

Query: 176 DSNIVL-------WDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLH 228
              I         W VT K  +P   FT  ++  + D +W   +  +F +   D  +++ 
Sbjct: 294 SGQIYFTQRHTSRW-VTDK--QP---FTVSNNKSIEDIQWSRTESTVFATAGCDGYIRIW 347

Query: 229 DQRIRD--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS-------KP 279
           D R +    A+    +    N +++S     L A+   +    ++D R+ +       +P
Sbjct: 348 DTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADTVQP 407

Query: 280 LHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQVPDDADDGS----- 333
           +     H+ A+TS+ F+P ++ ++     D    LWDL+ E   E++     +       
Sbjct: 408 VAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKELQEI 467

Query: 334 -PEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
            P+++ +H   +  + D   +  IP    +   + +  VWK
Sbjct: 468 PPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 505

>TPHA0G02650 Chr7 (558370..559920) [1551 bp, 516 aa] {ON} Anc_2.401
           YMR131C
          Length = 516

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 94/407 (23%), Positives = 167/407 (41%), Gaps = 71/407 (17%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNRQE------MILGTHTSDEEQNYLKIAAIYL 78
           P +Y+ +   NL WP LTL+ +P +  S R+       M   T  S ++ N L +  +  
Sbjct: 119 PTVYEMLHNVNLPWPCLTLDIIPDNLGSERRNYPQSILMTTATQASKKKDNELMVLKLSH 178

Query: 79  PDEVVPDAEPKEEEEVLKSNVKIIKKFEHENE-------VTRARYMP----QDDNLIATI 127
             + +   +   + E    +     +   ENE         R R  P    Q + L +T+
Sbjct: 179 LTKTLVKDDDNVDNEDDDEDDDEAGEPILENESLPLRDTTNRLRISPYATVQQEILTSTM 238

Query: 128 SGVGTIYLYN-----RANEV--------ESGLLSTFQFH-NENGYGLSFNPNEK-GKLLS 172
           S  G +++Y+     RA E             L T + H N  GYGL ++P  K G LL+
Sbjct: 239 SENGEVFIYDLTPQTRAFETPGYQIPKTAKRPLHTIRNHGNVEGYGLDWSPLIKTGALLT 298

Query: 173 GSDDSNIVLWDVTGKSQEPILT----FTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLH 228
           G D S +V   +T +     +T    FT  ++  + D +W   +  +F +   D  +++ 
Sbjct: 299 G-DCSGMVY--LTQRHTSKWVTDKTPFTVGNNKSIEDIQWSRTESTVFATAGCDGYIRIW 355

Query: 229 DQRIRD--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASK------PL 280
           D R +     +  V +    N ++++     L A+        ++D R+ S       P+
Sbjct: 356 DTRSKKHKPVISTVVSNTDVNVISWNEKMGYLLASGDDKGTWGIWDLRQFSPNSEKALPV 415

Query: 281 HMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL-------------AEIGA-EQVP 326
                H+ A+TS+ F+P ++ ++  A  D    LWDL             AEI   EQ+P
Sbjct: 416 AQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQKAEIKELEQIP 475

Query: 327 DDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
                  P+++ +H   +  + D   +  IP    +   + +  VWK
Sbjct: 476 -------PQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 512

>NDAI0H02750 Chr8 (677299..678837) [1539 bp, 512 aa] {ON} Anc_2.401
           YMR131C
          Length = 512

 Score = 70.9 bits (172), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 88/402 (21%), Positives = 171/402 (42%), Gaps = 59/402 (14%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNRQE------MILGTHTSDEEQNYLKIAAIY- 77
           P +Y+ +   N+ WP LTL+ +P S  S R+       M   T  S +++N L + ++  
Sbjct: 113 PTVYEMLHNVNVPWPCLTLDIIPDSLGSERRNYPQSLLMTTATQASKKKENELMVLSLSN 172

Query: 78  LPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENE-------VTRARYMP----QDDNLIAT 126
           L   +V + +  +E+E  + N    K    ENE         R +  P      + L AT
Sbjct: 173 LTKTLVNEDKEDDEDEDDEDNEDNDKDPVMENENIPLRDTTNRLKVSPFANSSKEVLTAT 232

Query: 127 ISGVGTIYLYN-------------RANEVESGLLSTFQFH-NENGYGLSFNPN-EKGKLL 171
           +S  G +Y+++             +  +     + T + H N  GY L ++P+ + G LL
Sbjct: 233 MSENGEVYIFDLGPQSKAFSTPGYKIPKTAKRPIHTIKSHGNVEGYALDWSPSIQTGALL 292

Query: 172 SGSDDSNIVLWDVTGKSQEPILT----FTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQL 227
           +G     I     T +     +T    FT  ++  + D +W   +  +F S   D  +++
Sbjct: 293 TGDCSGQIYF---TQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEGTVFASAGCDGYIRI 349

Query: 228 HDQRIRD--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS-------K 278
            D R +    A+    +    N +++S     L A+   + +  ++D R+ S       +
Sbjct: 350 WDTRSKKHKPAISVKASNTDVNVISWSDKLGYLLASGDDNGVWGVWDLRQFSPDTANSVQ 409

Query: 279 PLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQVPDDADDGS---- 333
           P+     H+ A+TS+ F+P ++ ++  A  D    LWDL+ E   E++   A +      
Sbjct: 410 PVAQYDFHKGAITSISFNPLDESIVAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQ 469

Query: 334 --PEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
             P+++ +H   +  + D   +  IP    +   + +  +WK
Sbjct: 470 IPPQLLFVH--WQKEVKDVKWHKQIPGALVSTGTDGL-NIWK 508

>Kpol_1041.20 s1041 complement(56019..57566) [1548 bp, 515 aa] {ON}
           complement(56019..57566) [1548 nt, 516 aa]
          Length = 515

 Score = 70.1 bits (170), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 82/395 (20%), Positives = 160/395 (40%), Gaps = 49/395 (12%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNRQE------MILGTHTSDEEQNYLKIAAIYL 78
           P +Y+ +   NL WP +TL+ +P +  S R+       M   T  + ++ N L +  +  
Sbjct: 120 PTVYEMLHNVNLPWPCMTLDIIPDTYGSERRNYPQSILMTTATQAAKKKDNELMVLKLSQ 179

Query: 79  PDEVVPDAEPKEEEEVLKSNVKIIKKFEHEN-----EVTRARYMP----QDDNLIATISG 129
             + +     +EEE+   S+ +     E EN        R R  P      + L AT+S 
Sbjct: 180 LSKTLVKENEEEEEDEDNSDNESDPILEDENVPLKDTTNRLRVSPFASSGQEVLTATMSE 239

Query: 130 VGTIYLYNRANEVESGLLSTFQF--------------HNENGYGLSFNP-NEKGKLLSGS 174
            G +Y+++ A +  +     +Q                N  GY L ++P    G LL+G 
Sbjct: 240 NGEVYIFDIAPQSRAFDTPGYQIPKTAKRPIHTIRNHGNVEGYALDWSPLIRSGALLTGD 299

Query: 175 DDSNIVLWDV-TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIR 233
               +      T K       FT  ++  + D +W   +  +F +   D  +++ D R +
Sbjct: 300 CSGQVYFTQRHTSKWVTDKQPFTVSNNKSIEDIQWSRTEATVFATAGCDGYIRVWDTRSK 359

Query: 234 D--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS------KPLHMMPG 285
               A+    +    N ++++     L A+   +    ++D R+ S      +P+     
Sbjct: 360 KHKPAISTKASNTDVNVISWNEKMGYLLASGDDNGTWGVWDLRQFSPSNENAQPVAQYDF 419

Query: 286 HEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQVPDDADDGS------PEVMM 338
           H+ A+TS+ FHP ++ ++  A  D    LWDL+ E   E++     +        P+++ 
Sbjct: 420 HKGAITSISFHPTDESIVAVASEDNTVTLWDLSVEADDEEIKQQTAETKELAQIPPQLLF 479

Query: 339 IHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
           +H   +  + D   +  IP    +   + +  +WK
Sbjct: 480 VH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 511

>CAGL0K03861g Chr11 complement(360277..361818) [1542 bp, 513 aa]
           {ON} highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131c Ribosome assembly protein
          Length = 513

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 85/396 (21%), Positives = 167/396 (42%), Gaps = 52/396 (13%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNRQE------MILGTHTSDEEQNYLKIAAIYL 78
           P +Y+ +   N+ WP L+L+ +P +  S R+       M   T  S +++N L + ++  
Sbjct: 119 PTVYEMLHNVNMPWPCLSLDIIPDTLGSERRNYPQSILMTTATQASKKKENELMVLSLSN 178

Query: 79  PDEVVPDAEPKEEEEVLKSNVKIIKKFEHEN-----EVTRARYMP----QDDNLIATISG 129
             + +   E +EEEE    +V+ I   E+EN        R +  P      + L AT+S 
Sbjct: 179 LTKTLLKDEEEEEEEEDDDDVEPI--IENENIALRDTTNRIKVSPFASQSQEVLTATMSE 236

Query: 130 VGTIYLYNRANEVESGLLSTFQF--------------HNENGYGLSFNPNEK-GKLLSGS 174
            G +Y+++   + +      +Q                N  GYGL ++P  K G LLSG 
Sbjct: 237 NGEVYIFDIGAQAKCFNSPGYQIPKQSKRPVHTIRNHGNVEGYGLDWSPLIKSGALLSGD 296

Query: 175 DDSNIVLWDV-TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIR 233
               I L    T K       ++  ++  + D +W   +  +F +   D  +++ D R +
Sbjct: 297 CSGQIYLTQRHTSKWVTDKQAYSVGNNKSIEDIQWSKTESTVFATAGCDGYIRVWDTRSK 356

Query: 234 D--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS-------KPLHMMP 284
               A+    +    N ++++     L A+   +    ++D R+ +       +P+    
Sbjct: 357 KHKPAISVKASNTDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFTPDNAANIQPVAQYN 416

Query: 285 GHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQVPDDADDGS------PEVM 337
            H+ A+TS+ F+P E+ ++     D    LWDL+ E   E++    ++        P+++
Sbjct: 417 FHKGAITSIAFNPLEESIVAVGSEDNTVTLWDLSVEADDEEIKQQTEETKELKEIPPQLL 476

Query: 338 MIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
            +H   +  I D   +  IP    +   + +  +WK
Sbjct: 477 FVH--WQKEIKDVKWHKQIPGCLVSTGTDGL-NIWK 509

>Smik_13.329 Chr13 complement(515612..517141) [1530 bp, 509 aa] {ON}
           YMR131C (REAL)
          Length = 509

 Score = 69.3 bits (168), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 90/401 (22%), Positives = 174/401 (43%), Gaps = 61/401 (15%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNR----QEMIL--GTHTSDEEQNYLKIAAIY- 77
           P +Y+ +   N+ WP LTL+ +P +  S R    Q ++L   T +S +++N L + A+  
Sbjct: 114 PTVYEMLHNVNMPWPCLTLDVIPDTLGSERRNYPQSILLTTATQSSRKKENELMVLALSN 173

Query: 78  LPDEVVPDAEPKEEEEVLKSNVKIIKKFEH---ENEVTRARYMP----QDDNLIATISGV 130
           L   ++ D   +E+EE    ++  I + E+    +   R +  P      + L AT+S  
Sbjct: 174 LTKTLLKDENEEEDEEEDDDDIDPIIENENIPLRDTTNRLKVSPFAVSNQEVLTATMSEN 233

Query: 131 GTIYLYNRANEVESGLLSTFQF--------------HNENGYGLSFNPNEK-GKLLSGSD 175
           G +Y+Y+ A + ++     +Q                N  GYGL ++P  K G LLSG  
Sbjct: 234 GDVYIYDLAPQSKAFATPGYQIPKSAKRPIHTVKNHGNVEGYGLDWSPLIKTGSLLSGDC 293

Query: 176 DSNIVL-------WDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLH 228
              +         W VT K  +P   FT  ++  + D +W   +  +F +   D  +++ 
Sbjct: 294 SGQVYFTQRHTSRW-VTDK--QP---FTVSNNKSIEDIQWSRSESTVFATAGCDGYIRIW 347

Query: 229 DQRIRD--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRR-------ASKP 279
           D R +    A+    +    N +++S     L A+   +    ++D R+       + +P
Sbjct: 348 DTRSKKHKPAISVKASNTDVNVISWSDKIGYLLASGDDNGTWGVWDLRQFTPSNADSVQP 407

Query: 280 LHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQVPDDADDGS----- 333
           +     H+ A+TS+ F+P ++ ++     D    LWDL+ E   E++     +       
Sbjct: 408 VAQYDFHKGAITSIAFNPLDESIVAVGSEDNTVTLWDLSVEADDEEIKQQTAETKELQEI 467

Query: 334 -PEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
            P+++ +H   +  + D   +  IP    +   + +  VWK
Sbjct: 468 PPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 505

>KLTH0E09394g Chr5 complement(853592..855160) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|Q04225 Saccharomyces
           cerevisiae YMR131C RRB1 RiboSome Assembly 2
          Length = 522

 Score = 68.6 bits (166), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 84/396 (21%), Positives = 167/396 (42%), Gaps = 50/396 (12%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNR----QEMILGTHT--SDEEQNYLKIAAIYL 78
           P +Y+ +   NL WP L+L+ +P    S R    Q ++L T T  S ++ N L +  +  
Sbjct: 126 PTVYEMLHNVNLPWPCLSLDIVPDKLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 185

Query: 79  PDEVVPDAEPKEEEEVLKSNVKIIKKFEHEN-----EVTRARYMP----QDDNLIATISG 129
             + +   +  EEE+    +       E+EN        R +  P      + L AT+S 
Sbjct: 186 LAKTLVKDDNNEEEDDDDEDEDQDPIVENENIPLKDTTNRLKVSPFASESPEKLTATMSE 245

Query: 130 VGTIYLYNRANEVESGLLSTFQF--------------HNENGYGLSFNP-NEKGKLLSGS 174
            G +Y+++   +V++  +  +Q                N  GY L ++P N+ G LL+G 
Sbjct: 246 NGEVYIFDLGPQVKAFEIPGYQLPKTAKKPIHTVRSHGNVEGYALDWSPLNKSGSLLTGD 305

Query: 175 DDSNIVLWDV-TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIR 233
               + L    T K       F+  ++  + D ++   +  +F S   D  +++ D R +
Sbjct: 306 CSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFASCGCDGYIRIWDTRSK 365

Query: 234 D--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRR-------ASKPLHMMP 284
               A+    +    N ++++     L A+   +    ++D R+       ++ P+    
Sbjct: 366 KHKPAISVKASATDVNVISWNEKIGYLLASGDDNGSWGVWDLRQFSPNTAASTSPVAQYN 425

Query: 285 GHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQVPDDADDGS------PEVM 337
            H+ A+TS+ F+P +D ++  A  D    LWDL+ E   E++   A +        P+++
Sbjct: 426 FHKGAITSISFNPLDDSIIAVASEDNTVSLWDLSVEADDEEIKQQAAETRELQEIPPQLL 485

Query: 338 MIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
            +H   +  + D   +  IP    +   + +  +WK
Sbjct: 486 FVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 518

>TBLA0B09250 Chr2 (2194005..2195585) [1581 bp, 526 aa] {ON}
           Anc_2.401 YMR131C
          Length = 526

 Score = 68.2 bits (165), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 86/400 (21%), Positives = 172/400 (43%), Gaps = 53/400 (13%)

Query: 27  MYDFVSETNLTWPSLTLEWLPGSRSSNR----QEMILGTHT--SDEEQNYLKIAAI---- 76
           +Y+ +   NL+WP ++L+ +P S  + R    Q ++L T T  S ++ N L I  +    
Sbjct: 129 VYEMLHNVNLSWPCMSLDIIPDSLGNERRNYPQSILLTTATQASKKKDNELMILQLSQLT 188

Query: 77  --YLPDEVVPDAEPKEEEEVLKSNVKIIK--KFEHENEVTRARYMPQDDN-----LIATI 127
              L ++   + +  +E++  + +  I++       +   R +  P   N     L AT+
Sbjct: 189 KTLLKEDDDDNDDEDDEDDEDRESDPILEDANVALRDTTNRLKVTPFATNNNQEILTATM 248

Query: 128 SGVGTIYLYNRANEVESGLLSTFQFH--------------NENGYGLSFNPNEK-GKLLS 172
           S  G +Y+++  N+V+S  +  +Q                N  G+GL ++P  K G LL+
Sbjct: 249 SENGEVYIFDIINQVKSFQIPGYQVSKQSKRPIHTIRSHGNVEGFGLDWSPLIKSGALLT 308

Query: 173 GSDDSNIVLWDV-TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQR 231
           G     I L    T K      +F+  ++  + D +W   +Q +F +   D  +++ D R
Sbjct: 309 GDCSGEIFLTSRHTSKWITEKQSFSVGNNKSIEDIQWSKTEQTVFATAGCDGYIRIWDTR 368

Query: 232 IRD--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS------KPLHMM 283
            +    A+    +    N ++++     L A+     +  ++D R+ S       P+   
Sbjct: 369 SKKHKPAISTRASNVDVNVISWNEKMEYLLASGDDKGVWGVWDLRQFSPSQENASPVAQY 428

Query: 284 PGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQVPDDADDGS------PEV 336
             H+ A+TS+ F+P ++  +  A  D    LWDL+ E   E++     +        P++
Sbjct: 429 DFHKGAITSISFNPLDESTVAVASEDNTVTLWDLSVEADDEEIKQQTHETKELEQIPPQL 488

Query: 337 MMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSS 376
           + +H   +  + D   +  IP    +   + +  VWK  S
Sbjct: 489 LFVH--WQKEVKDVKWHRQIPGCLVSTGTDGL-NVWKTIS 525

>ADR242C Chr4 complement(1126441..1128006) [1566 bp, 521 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR131C
           (RRB1)
          Length = 521

 Score = 67.4 bits (163), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 85/399 (21%), Positives = 165/399 (41%), Gaps = 56/399 (14%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNRQE------MILGTHTSDEEQNYLKIAAI-Y 77
           P +Y+ +   NL WP +TL+ +P +  S R+       M   T  S ++ N L +  +  
Sbjct: 125 PTVYEMLHNVNLPWPCMTLDLIPDNLGSERRNYPQSILMTTATQASKKKDNELLVLKLSQ 184

Query: 78  LPDEVVPDAEPKEEEEVLKSNVKIIKKFEHEN-----EVTRARYMP----QDDNLIATIS 128
           L   +  D +   E++    +       E+EN        R +  P      + L AT+S
Sbjct: 185 LAKTLAKDEDDGAEDDEDDEDEDADPIIENENIKLRDTTNRMQVSPFAAESQEVLAATMS 244

Query: 129 GVGTIYLYNRANEVESGLLSTFQF--------------HNENGYGLSFNPNEK-GKLLSG 173
             G  ++++   +V++     +Q                N  GYGL ++P  K G LL+G
Sbjct: 245 ENGEAHIFDLGPQVKAFSSPGYQVPKAAQRPQYTIKNHGNVEGYGLDWSPLIKTGALLTG 304

Query: 174 SDDSNIVLWDVTGKSQEPILT----FTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
                + L   T ++    +T    FT  ++  + D KW   +  +F +   D  +++ D
Sbjct: 305 DCSGRVFL---TQRTSSKWITDKQPFTVDNNKSIEDIKWSPSENTVFATCGVDGHVRIWD 361

Query: 230 QRIRD--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS------KPLH 281
            R +    A+    +    N ++++   + L A    +    ++D R+ S       P+ 
Sbjct: 362 IRSKKHKPALSVKVSDTDVNVMSWNQKISYLLATGDDNGTWGVWDLRQFSNQQGGVSPVA 421

Query: 282 MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQVPDDADDGS------P 334
               H+ A+TS+ F+P ++ ++  A  D    LWDL+ E   E++   A +        P
Sbjct: 422 QYDFHKGAITSISFNPLDESIIAVASEDNTVTLWDLSVEADDEEIKQQAAEVKELQQIPP 481

Query: 335 EVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
           +++ +H   +  + D   +  IP    +   + +  VWK
Sbjct: 482 QLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NVWK 517

>Kpol_1048.59 s1048 complement(166721..169273) [2553 bp, 850 aa]
           {ON} complement(166721..169273) [2553 nt, 851 aa]
          Length = 850

 Score = 67.8 bits (164), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 104/240 (43%), Gaps = 34/240 (14%)

Query: 147 LSTFQFHN--ENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTG--------KSQEPILTFT 196
           +S + FHN  +N   L F+ N K    SG  DS I +W + G            PI +  
Sbjct: 509 VSIYTFHNTQKNMTSLEFSNNYK-LAASGFQDSYIKIWSLDGYPLSENDEMPNNPISSTC 567

Query: 197 DR---HSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSA 253
                HS  V    +   D+ +  S SED T++L   +     V     +KP   + FS 
Sbjct: 568 KTFIGHSGTVYSTSFSAGDEYLL-SASEDKTVRLWSVQDDKPLVSYKGHEKPVWDVEFSP 626

Query: 254 HSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI 313
              NLFA A  D    L+   R   PL +M GH + V  + FH   +G  I  GS  +T+
Sbjct: 627 SCNNLFATASNDQTARLWSCDRVY-PLRVMAGHLNDVDCVSFH--SNGRYIFTGSSDKTV 683

Query: 314 -LWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVW 372
            +WD+               + + + +  GH S++   S++P+  W+ +T  ++ I+ +W
Sbjct: 684 RMWDI--------------NTGDSVRLFMGHNSTVTSLSVSPDGKWI-STGSDDGIITIW 728

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 51/218 (23%), Positives = 83/218 (38%), Gaps = 52/218 (23%)

Query: 144 SGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIV 203
           S    TF  H+   Y  SF+  ++  LLS S+D  + LW V  +  +P++++   H   V
Sbjct: 564 SSTCKTFIGHSGTVYSTSFSAGDE-YLLSASEDKTVRLWSV--QDDKPLVSYKG-HEKPV 619

Query: 204 NDCKWHNFDQNIFGSVSEDSTLQL-HDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
            D ++     N+F + S D T +L    R+      +V A    +    S HS   +   
Sbjct: 620 WDVEFSPSCNNLFATASNDQTARLWSCDRVYPL---RVMAGHLNDVDCVSFHSNGRYIFT 676

Query: 263 GT-DSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHP--------QEDGV----------- 302
           G+ D  V ++D       + +  GH   VTSL   P         +DG+           
Sbjct: 677 GSSDKTVRMWDINTGDS-VRLFMGHNSTVTSLSVSPDGKWISTGSDDGIITIWDIGSGRK 735

Query: 303 -----------------------LISAGSDRRTILWDL 317
                                  L+S G+D+   +WDL
Sbjct: 736 LKNMRGHGKSSIHSLSYNPEGTLLVSGGADQSVRVWDL 773

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 8/90 (8%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGL-LSTFQFHNENG-YGLSFNP 164
           H + VT     P D   I+T S  G I ++    ++ SG  L   + H ++  + LS+NP
Sbjct: 700 HNSTVTSLSVSP-DGKWISTGSDDGIITIW----DIGSGRKLKNMRGHGKSSIHSLSYNP 754

Query: 165 NEKGKLLSGSDDSNIVLWDVTGKSQEPILT 194
            E   L+SG  D ++ +WD+   + EP LT
Sbjct: 755 -EGTLLVSGGADQSVRVWDLNKGTFEPSLT 783

>Ecym_6098 Chr6 (185368..185901,186107..186529) [957 bp, 318 aa]
           {ON} similar to Ashbya gossypii AFR199C
          Length = 318

 Score = 66.2 bits (160), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 113/240 (47%), Gaps = 27/240 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +P +   LLS S D  ++ W +TG+ Q+   P+ +F   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSPAQPNMLLSASRDKTLITWRLTGEDQQYGVPVKSFKG-HSHI 67

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           + DC   N D     S S D TL+L D    ++ +  V  K    +++  A +T + +A+
Sbjct: 68  IQDCTVTN-DGKYALSASWDKTLRLWDLASGESLIRFVGHKSDVMSVSIDAGATQIVSAS 126

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDG----VLISAGSDRRTILWDLA 318
             D  V +++     + +  + GH D V+ +   P+++      +ISAG D+   +WDL 
Sbjct: 127 -RDKTVKVWN--TVGECVVTLLGHNDWVSHVRIAPKDNADDPVTVISAGMDKVVKVWDLQ 183

Query: 319 EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
               E     AD           GH + +N  + +P+   + A+A ++  + +W  ++K+
Sbjct: 184 SFTIE-----AD---------FIGHNNYVNTVTPSPDGS-IFASAGKDGQIMLWNLNAKI 228

>NCAS0F01970 Chr6 complement(396326..397861) [1536 bp, 511 aa] {ON}
           Anc_2.401 YMR131C
          Length = 511

 Score = 66.6 bits (161), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 88/402 (21%), Positives = 171/402 (42%), Gaps = 59/402 (14%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNRQE------MILGTHTSDEEQNYLKIAAIY- 77
           P +Y+ +   N+ WP +TL+ +P +  S R+       M   T  S +++N L + ++  
Sbjct: 112 PSVYEMLHNVNVPWPCMTLDIIPDNLGSERRNYPQSLLMATATQASRKKENELMVLSLSN 171

Query: 78  LPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENE-------VTRARYMP----QDDNLIAT 126
           L   +V D E +EEE+V   + +       ENE         R +  P    +++ L AT
Sbjct: 172 LVKTLVKDDEEEEEEDVDNEDDRDDSDPIIENENIPLRDTTNRLKISPFASSKEEVLAAT 231

Query: 127 ISGVGTIYLYN-------------RANEVESGLLSTFQFH-NENGYGLSFNPNEK-GKLL 171
           +S  G +Y+++             +  +     + T + H N  GY L ++P  K G LL
Sbjct: 232 MSENGEVYIFDLGPQSKAFSTPGYKVPKAAKRPIHTVKNHGNVEGYALDWSPLTKTGALL 291

Query: 172 SGSDDSNIVLWDVTGKSQEPILT----FTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQL 227
           +G     I     T +     +T    FT  ++  + D +W   +  +F S   D  +++
Sbjct: 292 TGDCSGQIYF---TQRHTSKWITDKQPFTVANNQSIEDIQWSRTESTVFASAGCDGYIRI 348

Query: 228 HDQRIRD--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS-------K 278
            D R +    A+    +    N +++S     L A+   +    ++D R+ S       +
Sbjct: 349 WDTRSKKHKPAISVKASNTDVNVISWSEKLGYLLASGDDNGTWGVWDLRQFSPENAGSVQ 408

Query: 279 PLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQVPDDADDGS---- 333
           P+     H+ A+TS+ F+P ++ ++     D    LWDL+ E   E++   A +      
Sbjct: 409 PVAQYDFHKGAITSISFNPLDESIIAVGSEDNTVTLWDLSVEADDEEIKQQAAETKELQQ 468

Query: 334 --PEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
             P+++ +H   +  + D   +  IP    +   + +  +WK
Sbjct: 469 IPPQLLFVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 507

>NCAS0G01120 Chr7 complement(199561..201045) [1485 bp, 494 aa] {ON}
           Anc_6.276
          Length = 494

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 73/314 (23%), Positives = 126/314 (40%), Gaps = 54/314 (17%)

Query: 26  LMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILGTHTSDEEQNYLKIAAIYLPDEVVPD 85
           L +D ++E N+T+    ++WLP   +  +        TS E    L+I +         D
Sbjct: 141 LTWDKIAECNVTYSISNIQWLPSHVNPRK------IATSSES---LRIWSFN-------D 184

Query: 86  AEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESG 145
            E   +E++  S  K  K+  H+ +              A     G   +   +N V   
Sbjct: 185 EENTIQEQINLSLCKYNKQHHHQQQP-------------APSETPGGTVIDPLSNSVLGE 231

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           L     FH        +NP +   L+S S D+  ++WD+  +S   + T    H   V D
Sbjct: 232 LPPITSFH--------WNPIDTNLLISSSIDTTCIVWDL--QSSNYVKTQLIAHDSEVYD 281

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYN------------TLAFSA 253
            ++      +F S   D ++++ D  +R  A   +  + P +             L  S 
Sbjct: 282 VRFLTQSTQLFASCGGDGSVRVFD--LRSLAHSTIIYEPPVSDLNPDTSQFALLRLEPSP 339

Query: 254 HSTNLFAAAGTDS-MVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRT 312
           H  N+ A    DS  + + D R    PL ++ GH  +V  +++HP +  VL+S G D + 
Sbjct: 340 HDPNVMATFAADSNKILILDMRNPESPLMILEGHSASVNQIKWHPIKRNVLLSGGDDCQV 399

Query: 313 ILWDLAEIGAEQVP 326
           + WDL +  A   P
Sbjct: 400 LYWDLNKCTASSDP 413

 Score = 35.0 bits (79), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 3/82 (3%)

Query: 118 PQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDS 177
           P D N++AT +      L       ES L+   + H+ +   + ++P ++  LLSG DD 
Sbjct: 339 PHDPNVMATFAADSNKILILDMRNPESPLM-ILEGHSASVNQIKWHPIKRNVLLSGGDDC 397

Query: 178 NIVLWDV--TGKSQEPILTFTD 197
            ++ WD+     S +P+ T  D
Sbjct: 398 QVLYWDLNKCTASSDPVATTKD 419

>Kwal_47.17827 s47 complement(570622..572193) [1572 bp, 523 aa] {ON}
           YMR131C (RRB1) - RiboSome Assembly 2 [contig 204] FULL
          Length = 523

 Score = 66.2 bits (160), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 82/396 (20%), Positives = 164/396 (41%), Gaps = 50/396 (12%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNR----QEMILGTHT--SDEEQNYLKIAAIYL 78
           P +Y+ +   NL WP L+L+ +P    S R    Q ++L T T  S ++ N L +  +  
Sbjct: 127 PTVYEMLHNVNLPWPCLSLDIVPDRLGSERRNYPQSLLLTTATQASKKKDNELLLLKMSQ 186

Query: 79  PDEVVPDAEPKEEEEVLKSNVKIIKKFEHEN-----EVTRARYMP----QDDNLIATISG 129
             + +   +  ++EE    +       E+EN        R +  P      + L A++S 
Sbjct: 187 LTKTLVKEDEDDDEEDDDEDEDQDPIVENENIPLRDTTNRLKVSPFASESPEKLTASMSE 246

Query: 130 VGTIYLYNRANEVESGLLSTFQF--------------HNENGYGLSFNP-NEKGKLLSGS 174
            G +Y+++   +V+      +Q                N  GY L ++P N+ G LL+G 
Sbjct: 247 NGEVYIFDLGPQVKGFETPGYQIPKTAKKPIHTVKAHGNVEGYALDWSPLNKSGSLLTGD 306

Query: 175 DDSNIVLWDV-TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIR 233
               + L    T K       F+  ++  + D ++   +  +F +   D  +++ D R +
Sbjct: 307 CSGRVYLTQRHTSKWITDKTAFSAGNNQSIEDIQFSRTEATVFATCGCDGYIRIWDTRSK 366

Query: 234 D--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS-------KPLHMMP 284
               A+    +    N ++++     L A+   +    ++D R+ S        P+    
Sbjct: 367 KHKPAISVKASSTDVNVISWNEKIGYLLASGDDNGTWGVWDLRQFSPNNAASVSPVAQYS 426

Query: 285 GHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIGAEQVPDDADDGS------PEVM 337
            H+ A+TS+ F+P +D ++  A  D    LWDL+ E   E++   A +        P+++
Sbjct: 427 FHKGAITSIAFNPLDDSIIAVASEDNTVTLWDLSVEADDEEIKQQAAETKELQQIPPQLL 486

Query: 338 MIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
            +H   +  + D   +  IP    +   + +  +WK
Sbjct: 487 FVH--WQKEVKDVKWHKQIPGCLVSTGTDGL-NIWK 519

>TDEL0A06890 Chr1 (1202790..1204133) [1344 bp, 447 aa] {ON}
           Anc_6.276 YPL247C Two N bases added to fix a frameshift
           that can't be corrected using the reads.
          Length = 447

 Score = 65.9 bits (159), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 81/362 (22%), Positives = 135/362 (37%), Gaps = 70/362 (19%)

Query: 26  LMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILGTHTSDEEQNYLKIAAIYLPDEVVPD 85
           L +D V+E N+T+P  T++W P    +  Q     T  SD    +  +           +
Sbjct: 129 LSWDRVAECNVTFPVSTIQWQP----ARAQPRTFAT-CSDSLXXFWSLT----------E 173

Query: 86  AEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESG 145
            E   +E++   N+ + K  + ++E        +   L+ T             N V   
Sbjct: 174 DETAIQEQI---NLSLCKHNKQQSE--------KGKELVGT-------------NGVLGE 209

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           L     FH        +NP +   L+S S D+  ++WD+  +S   I T    H   V D
Sbjct: 210 LPPITSFH--------WNPTDPNLLISSSIDTTCIVWDL--QSANYIKTQLIAHDSEVFD 259

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQR------------IRDAAVEKVQAKKPYNTLAF-- 251
            ++      +F S   D ++++ D R            I D A +      P   L    
Sbjct: 260 VRFLTQSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPTIPDGAPDLPSPTVPPALLRLEP 319

Query: 252 SAHSTNLFAAAGTDS-MVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDR 310
           S    N+ A    DS  V + D R    PL  +  H   +  +++HP    VL+SA  D 
Sbjct: 320 SPFDPNVIATFAIDSSKVLILDMRSPGSPLLTLEAHTAPINQIKWHPTRRNVLLSASDDC 379

Query: 311 RTILWDL-AEIGAEQVPDDADDGSPEVM-----MIHAGHRSSINDFSMNPNIPWLTATAE 364
           + + WDL   + +E   D   D  P+       M +A     +N+    P   W  A + 
Sbjct: 380 QVLYWDLNTHLDSESTKDTTPDSQPDSTVQKPAMFYASGGQEVNNIVWRPQGDWFGAISH 439

Query: 365 EE 366
           + 
Sbjct: 440 KR 441

>Suva_14.22 Chr14 (36853..38262) [1410 bp, 469 aa] {ON} YNL317W
           (REAL)
          Length = 469

 Score = 65.1 bits (157), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 118/269 (43%), Gaps = 28/269 (10%)

Query: 107 HENEVTRARYMPQDDNLIAT-ISGVGTIYL--YNRANEVESGLLSTFQFHNENGYGLSFN 163
           H++ VT  +Y    D +I+    G+  I+   ++   E+++        H E+   ++F+
Sbjct: 136 HDSAVTTMKYSHDGDWMISGDADGMIKIWQPNFSMVKEIDAA-------HTESIRDMAFS 188

Query: 164 PNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDS 223
            N+  K ++ SDD+ + +W+ +   QE +L  +  H D V  C WH  +  +  S S+D+
Sbjct: 189 SND-SKFVTCSDDNILKIWNFSNGKQERVL--SGHHWD-VKSCDWHP-EMGLIASASKDN 243

Query: 224 TLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMM 283
            ++L D R  +     ++ K       F     NL  A   D    ++D R + K L  +
Sbjct: 244 LVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMCV 303

Query: 284 PGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGH 343
               D +T LE+HP  + +   A  D     +DL +           D +  ++ I   H
Sbjct: 304 RDETDYMT-LEWHPINESMFTLACYDGSLKHFDLLQ-----------DLNEPILTIPYAH 351

Query: 344 RSSINDFSMNPNIPWLTATAEEENIVQVW 372
              I   S NP +  + ATA ++  ++ W
Sbjct: 352 DKCITSLSYNP-VGHIFATAAKDRTIRFW 379

>Skud_14.22 Chr14 (34087..35490) [1404 bp, 467 aa] {ON} YNL317W
           (REAL)
          Length = 467

 Score = 65.1 bits (157), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 118/269 (43%), Gaps = 28/269 (10%)

Query: 107 HENEVTRARYMPQDDNLIAT-ISGVGTIYL--YNRANEVESGLLSTFQFHNENGYGLSFN 163
           H++ VT  +Y    D +I+    G+  I+   ++   E+++        H E+   ++F+
Sbjct: 134 HDSAVTTMKYSHDGDWMISGDADGMIKIWQPNFSMVKEIDAA-------HTESIRDMAFS 186

Query: 164 PNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDS 223
            N+  K ++ SDD+ + +W+ +   QE IL  +  H D V  C WH  +  +  S S+D+
Sbjct: 187 SND-SKFVTCSDDNILKIWNFSNGKQERIL--SGHHWD-VKSCDWHP-EMGLIASASKDN 241

Query: 224 TLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMM 283
            ++L D R  +     ++ K       F     NL  A   D    ++D R + + L  +
Sbjct: 242 LVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMRELMCV 301

Query: 284 PGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGH 343
               D +T LE+HP  + +   A  D     +DL +           D +  ++ I   H
Sbjct: 302 RDETDYMT-LEWHPINESMFTLACYDGSLKHFDLLQ-----------DLNEPILTIPYAH 349

Query: 344 RSSINDFSMNPNIPWLTATAEEENIVQVW 372
              I   S NP +  + ATA ++  ++ W
Sbjct: 350 DKCITSLSYNP-VGHIFATAAKDRTIRFW 377

>Ecym_6067 Chr6 (124870..126438) [1569 bp, 522 aa] {ON} similar to
           Ashbya gossypii ADR242C
          Length = 522

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 92/418 (22%), Positives = 174/418 (41%), Gaps = 65/418 (15%)

Query: 9   KPLSIDE--EYDLWKSNVPLMYDFVSETNLTWPSLTLEWLP---GSRSSNRQEMIL---G 60
           KPL  DE  E D      P +Y+ +   NL W  +TL+ +P   GS   N  + IL    
Sbjct: 113 KPLGPDEVLEAD------PTVYEMLHNVNLPWSCMTLDIIPDLLGSERRNYPQSILMTTA 166

Query: 61  THTSDEEQNYLKIAAI-YLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHE-----NEVTRA 114
           T  S ++ N L +  +  L   +V + E + +EE    +  +    E+E     +   R 
Sbjct: 167 TQASKKKDNELLVLKMSQLTKTLVKEEEDENDEEEDNEDNDLDPIIENESISLKDTTNRI 226

Query: 115 RYMP----QDDNLIATISGVGTIYLYNRANEVESGLLSTFQF--------------HNEN 156
           +  P      + L AT+S  G  Y+Y+   +V++     +Q                N  
Sbjct: 227 KISPFAAESPEVLAATMSENGEAYIYDLGPQVKAFTSPGYQIPKTAQKPLHSIRNHGNVE 286

Query: 157 GYGLSFNPNEK-GKLLSGSDDSNIVLWDVTGKS----QEPILTFTDRHSDIVNDCKWHNF 211
           GYGL ++P  K G +L+G     + L   T       ++P   FT  ++  + D +W   
Sbjct: 287 GYGLDWSPLIKTGSILTGDCSGRVYLTQRTASRWVTDKQP---FTVGNNKSIEDIQWSRA 343

Query: 212 DQNIFGSVSEDSTLQLHDQRIRD--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVY 269
           +  +F +   D  +++ D R +    A+  + +    N ++++     L A+        
Sbjct: 344 EMTVFATCGVDGHIRIWDTRSKKHKPALSVMVSDTDVNVMSWNEKIGYLLASGDDSGTWG 403

Query: 270 LYDRRRASK-------PLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA-EIG 321
           ++D R+ S        P+     H+ A+TS+ F+P ++ ++  A  D    LWDL+ E  
Sbjct: 404 VWDLRQFSAQNTEKTTPVAQYNFHKAAITSISFNPLDESIIAVASEDNTVTLWDLSVEAD 463

Query: 322 AEQVPDDADDGS------PEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
            E++     + +      P+++ +H   +  + D   +  IP    +   + +  +WK
Sbjct: 464 DEEIKQQTAETAELQQIPPQLLFVH--WQRDVKDVKWHRQIPGCLVSTGTDGL-NIWK 518

>AFR199C Chr6 complement(799873..800295,800490..801071) [1005 bp,
           334 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YMR116C (ASC1); 1-intron
          Length = 334

 Score = 63.5 bits (153), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 56/185 (30%), Positives = 86/185 (46%), Gaps = 12/185 (6%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     LS +P +   LLSGS D  ++ W +TG+ Q+   P+ +F   HS I
Sbjct: 25  LRGTLEGHNGWVTSLSTSPAQPNMLLSGSRDKTLITWKLTGEDQQYGVPVRSFKG-HSHI 83

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V DC     D     S S D TL+L D +        V  K    +++    +T + +A+
Sbjct: 84  VQDCT-VTHDGKYALSASWDKTLRLWDLQSGKCIKRFVGHKSDVMSVSIDPRATQIVSAS 142

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQE---DGV-LISAGSDRRTILWDLA 318
             D  V +++       +  + GH D V+++   P E   D V +ISAG D+   +WDL 
Sbjct: 143 -RDKTVKVWN--TVGDCVVTLLGHNDWVSNVRIAPSEKSDDAVTVISAGMDKVVKVWDLQ 199

Query: 319 EIGAE 323
               E
Sbjct: 200 SFTIE 204

>YKR036C Chr11 complement(508702..510633) [1932 bp, 643 aa] {ON}
           CAF4WD40 repeat-containing protein associated with the
           CCR4-NOT complex, interacts in a Ccr4p-dependent manner
           with Ssn2p; also interacts with Fis1p, Mdv1p and Dnm1p
           and plays a role in mitochondrial fission
          Length = 643

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 60/233 (25%), Positives = 101/233 (43%), Gaps = 41/233 (17%)

Query: 135 LYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVT-GKS-QEPI 192
           L  +  E+ +  +  F+ H +    LSF+      L+SGS D  I  WD+T GK  Q+  
Sbjct: 405 LKEKTEEIVTPCIHNFELHKDEITALSFDSE---ALVSGSRDKKIFHWDLTTGKCIQQLD 461

Query: 193 LTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFS 252
           L FT  HSDI    +  N    + G+                     + A + YN+    
Sbjct: 462 LIFTPTHSDIKMPARSLNNGACLLGT-----------------EAPMIGALQCYNSA--- 501

Query: 253 AHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRT 312
                  A    D +V L+D R   KP+ ++ GH D +TSL+F  ++   L++   D   
Sbjct: 502 ------LATGTKDGIVRLWDLR-VGKPVRLLEGHTDGITSLKFDSEK---LVTGSMDNSV 551

Query: 313 ILWDL-----AEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLT 360
            +WDL      ++ A  +P  + D   +++ + A +   +N F+M  +  W+T
Sbjct: 552 RIWDLRTSSILDVIAYDLPVSSLDFDGKLITVGA-NEGGVNVFNMERDEHWMT 603

>YNL317W Chr14 (40619..42016) [1398 bp, 465 aa] {ON}  PFS2Integral
           subunit of the pre-mRNA cleavage and polyadenylation
           factor (CPF) complex; plays an essential role in mRNA
           3'-end formation by bridging different processing
           factors and thereby promoting the assembly of the
           processing complex
          Length = 465

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 117/269 (43%), Gaps = 28/269 (10%)

Query: 107 HENEVTRARYMPQDDNLIAT-ISGVGTIYL--YNRANEVESGLLSTFQFHNENGYGLSFN 163
           H++ VT  +Y    D +I+    G+  I+   ++   E+++        H E+   ++F+
Sbjct: 134 HDSAVTTMKYSHDSDWMISGDADGMIKIWQPNFSMVKEIDAA-------HTESIRDMAFS 186

Query: 164 PNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDS 223
            N+  K ++ SDD+ + +W+ +   QE +L  +  H D V  C WH  +  +  S S+D+
Sbjct: 187 SND-SKFVTCSDDNILKIWNFSNGKQERVL--SGHHWD-VKSCDWHP-EMGLIASASKDN 241

Query: 224 TLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMM 283
            ++L D R  +     ++ K       F     NL  A   D    ++D R + K L  +
Sbjct: 242 LVKLWDPRSGNCISSILKFKHTVLKTRFQPTKGNLLMAISKDKSCRVFDIRYSMKELMCV 301

Query: 284 PGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGH 343
               D +T LE+HP  + +   A  D     +DL +   E            ++ I   H
Sbjct: 302 RDETDYMT-LEWHPINESMFTLACYDGSLKHFDLLQNLNE-----------PILTIPYAH 349

Query: 344 RSSINDFSMNPNIPWLTATAEEENIVQVW 372
              I   S NP +  + ATA ++  ++ W
Sbjct: 350 DKCITSLSYNP-VGHIFATAAKDRTIRFW 377

>Smik_14.14 Chr14 (25114..26514) [1401 bp, 466 aa] {ON} YNL317W
           (REAL)
          Length = 466

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 118/269 (43%), Gaps = 28/269 (10%)

Query: 107 HENEVTRARYMPQDDNLIAT-ISGVGTIYL--YNRANEVESGLLSTFQFHNENGYGLSFN 163
           H++ VT  +Y    D +I+    G+  I+   ++   E+++        H E+   ++F+
Sbjct: 134 HDSAVTTMKYSHDSDWMISGDADGMIKIWQPNFSMVKEIDAA-------HTESIRDMAFS 186

Query: 164 PNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDS 223
            N+  K ++ SDD+ + +W+ +   +E +L  +  H D V  C WH  +  +  S S+D+
Sbjct: 187 SND-SKFVTCSDDNILKIWNFSNGKEERVL--SGHHWD-VKSCDWHP-EMGLIASASKDN 241

Query: 224 TLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMM 283
            ++L D R  +     ++ K       F     NL  A   D    ++D R + K L  +
Sbjct: 242 LVKLWDPRSGNCISSILKFKHTVLKTRFQPVKGNLLMAISKDKSCRVFDIRYSMKELMCV 301

Query: 284 PGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGH 343
               D +T LE+HP  + +   A  D     +DL +           D +  V+ I   H
Sbjct: 302 RDETDYMT-LEWHPINESMFTLACYDGSLKHFDLLQ-----------DLNEPVLTIPYAH 349

Query: 344 RSSINDFSMNPNIPWLTATAEEENIVQVW 372
              I   S NP +  + ATA ++  ++ W
Sbjct: 350 DKCITSLSYNP-VGHIFATAAKDRTIRFW 377

>ZYRO0A08690g Chr1 (691253..692803) [1551 bp, 516 aa] {ON} highly
           similar to uniprot|Q04225 Saccharomyces cerevisiae
           YMR131C RRB1 RiboSome Assembly 2
          Length = 516

 Score = 63.5 bits (153), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 79/342 (23%), Positives = 146/342 (42%), Gaps = 54/342 (15%)

Query: 25  PLMYDFVSETNLTWPSLTLEWLPGSRSSNR----QEMILGTHT-----SDEEQNYLKIAA 75
           P +Y+ +   N+ WP +TL+ +P +  S R    Q ++L T T      D E   LK++ 
Sbjct: 118 PSVYEMLHNVNMPWPCMTLDVIPDTLGSERRSYPQSLLLTTATQATRKKDNELMVLKLSQ 177

Query: 76  I--YLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHEN-----EVTRARYMP----QDDNLI 124
           +   L  +   + +  +E++    +  II   E+EN        R +  P      + L 
Sbjct: 178 LSKTLVKDDTEENDEDDEDDEDADSDPII---ENENIALKDTTNRLKVSPFATHGQEVLT 234

Query: 125 ATISGVGTIYLYNRANEVES-------------GLLSTFQFH-NENGYGLSFNPNEK-GK 169
           AT+   G +Y+++   + ++               + T + H N  GYGL ++P  K G 
Sbjct: 235 ATMCENGEVYVFDLGAQTKAFETPGYQVPKTSRKAIHTIRNHGNVEGYGLDWSPLIKTGA 294

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILT----FTDRHSDIVNDCKWHNFDQNIFGSVSEDSTL 225
           LL+G     I L   T +     +T    FT  ++  V D +W   +  +F +   D  +
Sbjct: 295 LLTGDCSGQIFL---TQRHTSKWITDKQPFTAANNQSVEDIQWSPTESTVFATSGTDGYV 351

Query: 226 QLHDQRIRD--AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS------ 277
           ++ D R +    A+    +    N ++++     L A+   +    ++D R+ S      
Sbjct: 352 RIWDTRSKKHKPAISTRASNTDVNVISWNEKLGYLLASGDDNGSWGVWDLRQFSPANSEG 411

Query: 278 -KPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA 318
            +P+     H   +TS+ F+P +D V+  A  D    LWDL+
Sbjct: 412 VQPVAQYDFHRGPITSISFNPLDDSVVAVASEDNTVTLWDLS 453

>Smik_4.45 Chr4 (85422..89234) [3813 bp, 1270 aa] {ON} YDL195W
           (REAL)
          Length = 1270

 Score = 62.4 bits (150), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 105/220 (47%), Gaps = 21/220 (9%)

Query: 120 DDNLIATISGVGTIYLYNRANEVESGLLSTFQF--HNENGYGLSFNPNEKGKLLSGSDDS 177
           ++ +IA     G++ LY+  NEV   + S  +F  H+ +   + FN  +   L SG ++ 
Sbjct: 73  NNKIIAGALDNGSLELYS-TNEVNDAISSMAKFSNHSSSVKTVKFNAKQDNVLASGGNNG 131

Query: 178 NIVLWDVTGKSQEPI----LTFTDRHSDI--VNDCKWHNFDQNIFGSVSEDSTLQLHDQR 231
            I +WD+   ++ P     LT     S +  VN   W+    ++F S    +   + D +
Sbjct: 132 EIFIWDMNKCTESPANYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

Query: 232 IRDAAVEKVQA------KKPYNTLAF-SAHSTNLFAAAGTDS--MVYLYDRRRASKPLHM 282
            +   +           K+  + + +   +ST +  A G+D+   + ++D R A+ PL  
Sbjct: 192 AKKEVIHLCYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQT 251

Query: 283 M-PGHEDAVTSLEFHPQEDGVLISAGSDRRTILW--DLAE 319
           +  GH+  + SL++  Q++ +L+S+G D   +LW  +LAE
Sbjct: 252 LNQGHQKGILSLDWCHQDENLLLSSGRDNTVLLWNPELAE 291

>Suva_11.268 Chr11 complement(492639..494576) [1938 bp, 645 aa] {ON}
           YKR036C (REAL)
          Length = 645

 Score = 61.6 bits (148), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 103/233 (44%), Gaps = 41/233 (17%)

Query: 135 LYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKS-QEPI 192
           L   A EV +  L  F+ H++    LSF+      L+SGS D  I+ WD VTGK  Q+  
Sbjct: 407 LKQNAEEVVTPCLHNFELHSDEITALSFDSE---ALISGSKDRKILHWDLVTGKCVQQLD 463

Query: 193 LTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFS 252
           L  T  ++D     +  N   ++ GS                     + A + YN+    
Sbjct: 464 LIVTPTYNDTKVSARSANNSTSVLGS-----------------EAPMIGALQCYNS---- 502

Query: 253 AHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRT 312
                  A+   D +V L+D  R  KP+  + GH D +TSL+F  ++   L++   D   
Sbjct: 503 -----ALASGTKDGVVRLWD-LRIGKPVRALEGHTDGITSLKFDSEK---LVTGSMDNSV 553

Query: 313 ILWDL-----AEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLT 360
            +WDL      ++ A  +P  + D   +++ + A + + +N F+M  +  W+T
Sbjct: 554 RIWDLRTSSIIDVIAYDLPITSLDFDDKLITVGA-NETGVNVFNMERDEHWMT 605

>Skud_4.63 Chr4 (104587..108408) [3822 bp, 1273 aa] {ON} YDL195W
           (REAL)
          Length = 1273

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/216 (23%), Positives = 101/216 (46%), Gaps = 21/216 (9%)

Query: 120 DDNLIATISGVGTIYLYNRANEVESGLLSTFQF--HNENGYGLSFNPNEKGKLLSGSDDS 177
           ++ +IA     GT+ LY+  NE    + ST +F  H+ +   + FN  +   L SG ++ 
Sbjct: 73  NNEIIAGALDNGTLELYS-TNEANDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNG 131

Query: 178 NIVLWDVTGKSQEPI----LTFTDRHSDI--VNDCKWHNFDQNIFGSVSEDSTLQLHDQR 231
            I +WD+   ++ P     LT     S +  VN   W+    ++F S    +   + D +
Sbjct: 132 EIFIWDMNKCTESPSTYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLK 191

Query: 232 IRDAAVEKVQAKKPYNTLA--------FSAHSTNLFAAAGTDS--MVYLYDRRRASKPLH 281
            +   +  +    P + +            +ST +  A G+D+   + ++D R A+ P+ 
Sbjct: 192 AKKEVIH-LSYTSPSSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPMQ 250

Query: 282 MM-PGHEDAVTSLEFHPQEDGVLISAGSDRRTILWD 316
            +  GH+  + SL++  Q++ +L+S+G D   +LW+
Sbjct: 251 TLNQGHQKGILSLDWCDQDENLLLSSGRDNTVLLWN 286

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/156 (23%), Positives = 67/156 (42%), Gaps = 14/156 (8%)

Query: 174 SDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIR 233
           S DS++ LW +     E  L      S   ND  W + ++ I G++ ++ TL+L+     
Sbjct: 37  STDSSLELWSLLATDSEKPLASLQVDSKF-NDLDWSHNNEIIAGAL-DNGTLELYSTNEA 94

Query: 234 DAAVEKVQA----KKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKP----LHMMPG 285
           +  +              T+ F+A   N+ A+ G +  ++++D  + ++       + PG
Sbjct: 95  NDTISSTAKFGSHSSSVKTVKFNARQDNVLASGGNNGEIFIWDMNKCTESPSTYTPLTPG 154

Query: 286 HE----DAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
                 D V SL ++     V  SAGS     +WDL
Sbjct: 155 QSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDL 190

>Kpol_1060.24 s1060 complement(61507..62967) [1461 bp, 486 aa] {ON}
           complement(61507..62967) [1461 nt, 487 aa]
          Length = 486

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/203 (24%), Positives = 86/203 (42%), Gaps = 25/203 (12%)

Query: 162 FNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSE 221
           +NP +   L+S S D+  ++WD+  +S   + T    H   V D K+      +F S   
Sbjct: 230 WNPIDTNLLISSSIDTTCIVWDL--QSSNYVRTQLIAHDSEVFDVKFLAHSTQLFASCGG 287

Query: 222 DSTLQLHD----------------QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
           D ++++ D                Q   D   +  ++      L  S    N+ A    D
Sbjct: 288 DGSVRVFDLRSLAHSTIIYESNSDQNGSDTLTDNEKSPSALLRLQPSPSDPNVMATFALD 347

Query: 266 SM-VYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE----- 319
           S  + + D R    P+  + GH  AV  +++HP++  VL+S G D + + WDL E     
Sbjct: 348 SKSILILDMRNPGSPVLTLEGHSAAVNQIKWHPKKSNVLLSCGDDCQVLYWDLNEWLSPT 407

Query: 320 -IGAEQVPDDADDGSPEVMMIHA 341
            + A +   +A+DG      I+A
Sbjct: 408 SLSANENKVNANDGPISGQQINA 430

>ZYRO0G20152g Chr7 complement(1669233..1669655,1669872..1670408)
           [960 bp, 319 aa] {ON} highly similar to uniprot|P38011
           Saccharomyces cerevisiae YMR116C ASC1 WD repeat protein
           (G-beta like protein) involved in translation regulation
           required for repression of Gcn4p activity in the absence
           of amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 60.1 bits (144), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 62/242 (25%), Positives = 104/242 (42%), Gaps = 28/242 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +  +   LLS S D  ++ W +TG  ++   P+ +F   H+ I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDKQYGVPVRSFQG-HNHI 67

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V DC     D     S S D TL+L D          V  K    ++A    ++ + + +
Sbjct: 68  VQDCS-LTADGAYALSASWDKTLRLWDVATGQTYQRFVGHKSDVMSVAIDRKASMIISGS 126

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDG-----VLISAGSDRRTILWDL 317
             D  V ++  R   + L  M GH D V+ +   P ED       +ISAG D+    W++
Sbjct: 127 -RDRTVKVWTIR--GQCLATMLGHNDWVSQVRIAPTEDANDDTVTVISAGMDKMVKAWNV 183

Query: 318 AEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSK 377
                 Q   +AD           GH + +N  + +P+   L A+A ++  + +W  + K
Sbjct: 184 -----NQFQIEAD---------FIGHNNYVNTITASPDGS-LVASAGKDGEIMLWNLADK 228

Query: 378 LP 379
           +P
Sbjct: 229 VP 230

>Skud_11.271 Chr11 complement(490869..492809) [1941 bp, 646 aa] {ON}
           YKR036C (REAL)
          Length = 646

 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 58/222 (26%), Positives = 94/222 (42%), Gaps = 41/222 (18%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDV-TGKS-QEPILTFTDRHSDIV 203
            +  F+ HN+    LSF+      L+SGS D  I  WD+ TGK  QE  L FT  H+D  
Sbjct: 419 CIHNFELHNDEITALSFDSE---ALISGSKDKKIFHWDLATGKCVQELNLIFTPTHNDTK 475

Query: 204 NDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAG 263
              +       + G+                     + A + YN+           A   
Sbjct: 476 TSTRSGKNGTYLLGT-----------------EAPMIGALQCYNSA---------LATGT 509

Query: 264 TDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL-----A 318
            D +V L+D R   KP+  + GH D +TSL+F  ++   L++   D    +WDL      
Sbjct: 510 KDGVVRLWDLR-IGKPVRSLEGHTDGITSLKFDSEK---LVTGSMDNSVRIWDLRTSSIV 565

Query: 319 EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLT 360
           ++ A  +P  + D   +++ + A  R  +N F+M  +  W+T
Sbjct: 566 DVIAYDLPVTSLDFDDKLITVGANER-GVNIFNMERDEHWMT 606

>NDAI0G03830 Chr7 (919944..921476) [1533 bp, 510 aa] {ON} Anc_3.25
          Length = 510

 Score = 60.5 bits (145), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 57/231 (24%), Positives = 110/231 (47%), Gaps = 13/231 (5%)

Query: 93  EVLKSNVKIIKKFE-HENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQ 151
           ++ ++N  ++K+ +    E  R      +D+   + S    + ++N +N     +LS   
Sbjct: 146 KIWQANFNMVKELDDAHTECIRDVAFSGNDSKFVSCSDDNILKIWNFSNGKLERVLSG-- 203

Query: 152 FHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDIVNDCKWHN 210
            H+ +     ++P E G ++S S D+ I LWD  +G     IL F  +H+  V   K+  
Sbjct: 204 -HHWDVKSCDWHP-EMGLIISASKDNLIKLWDPRSGNCVSTILKF--KHT--VLKVKFQP 257

Query: 211 FDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYL 270
              N+  ++S+D + ++ D R     +  V+ +  Y TL ++  + ++F     D  +  
Sbjct: 258 TGGNMIAAISKDKSCRVFDIRHSMKELLCVRDEVDYMTLLWNPINESMFTVGNYDGSIKH 317

Query: 271 YDRRR-ASKPLHMMP-GHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
           +D  +  +KP H++P  H+  VTSL ++P  + +L SA  DR    W  A 
Sbjct: 318 FDLLQDLTKPTHVIPYAHDKCVTSLSYNPMGN-ILASASKDRTVRFWTRAS 367

>SAKL0E03960g Chr5 complement(319708..320130,320346..320885) [963
           bp, 320 aa] {ON} highly similar to with YMR116C
           uniprot|P38011 Saccharomyces cerevisiae YMR116C ASC1 WD
           repeat protein (G- beta like protein) involved in
           translation regulation required for repression of Gcn4p
           activity in the absence of amino-acid starvation core
           component of the ribosome ortholog of mammalian RACK1
          Length = 320

 Score = 59.7 bits (143), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 104/240 (43%), Gaps = 28/240 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +P +   LLS S D  ++ W +TG  Q+   P+ +F   HS I
Sbjct: 10  LRGTLEGHNGWVTSLATSPAQPNLLLSASRDKTLITWKLTGDDQQYGVPVRSFKG-HSHI 68

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           + DC     D     S S D T++L +          V  K    ++A    +T + +A+
Sbjct: 69  IQDCT-VTADGEYALSASWDKTIRLWELATGKCVKRFVGHKSDVLSVAIDRRATQIVSAS 127

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQED-----GVLISAGSDRRTILWDL 317
             D  V +++     + +  + GH D V+ +   P ED       +ISAG D+   +W+L
Sbjct: 128 -RDKTVKVWN--TLGECMVTLLGHNDWVSQVRVAPNEDPEDKTVTVISAGMDKVVKVWNL 184

Query: 318 AEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSK 377
                 Q+  D             GH + +N  + +P+   L A+A ++  + +W  + K
Sbjct: 185 HSF---QIEAD-----------FIGHNNYVNTVTASPDGS-LVASAGKDGQIMLWNLTEK 229

>ZYRO0E08184g Chr5 (639823..641343) [1521 bp, 506 aa] {ON} similar
           to uniprot|Q12523 Saccharomyces cerevisiae YPL247C
           Hypothetical ORF
          Length = 506

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 89/384 (23%), Positives = 147/384 (38%), Gaps = 81/384 (21%)

Query: 26  LMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILGTHTSDEEQNYLKIAAIYLPDEVVPD 85
           L +D V+E N+T+P  T++W P      R         SD     L+I +          
Sbjct: 150 LSWDRVAECNVTFPVSTIQWQPSMTHPRRFATC-----SDS----LRIWSFC-------- 192

Query: 86  AEPKEEEEVLKS--NVKIIKKFEHENEVTRARYMPQDDNLIATISGVGTIYLYNRAN-EV 142
               EEE  L+   N+ + K  + +   +R           A   G G+I    R N + 
Sbjct: 193 ----EEERNLQEQINLSLCKYDKQQQGASRVN---------AAAGGSGSI----RTNPQQ 235

Query: 143 ESGLLSTF----QFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDR 198
           + GL+        FH        +NP +   L+S S D+  ++WD+  +S   + T    
Sbjct: 236 QQGLIGELPPITSFH--------WNPVDPNLLISSSIDTTCIVWDL--QSSNYVRTQLIA 285

Query: 199 HSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRI------------RDAAVEKVQAKK-- 244
           H   V D ++      +F S   D ++++ D R               A ++   A    
Sbjct: 286 HDSEVYDVRFLTQTTQLFSSCGGDGSVRVFDLRCLAHSTIIYEPPSSPATLQPTTAAGSS 345

Query: 245 ---------PYNTLAFSAHSTNLFAAAGTDS-MVYLYDRRRASKPLHMMPGHEDAVTSLE 294
                    P   L  S    N+ A    DS  V + D R    P+ ++ GH  AV  + 
Sbjct: 346 SAADSDTGVPLLRLEPSPFDPNVIATFAIDSPRVLILDMRNPGSPVLVLEGHSAAVNQMR 405

Query: 295 FHPQEDGVLISAGSDRRTILWDLAE--IG--AEQVPDDADDGSPEVMMIHAGHRSSINDF 350
           +HP +  VL+S   D + + WDL    +G   +Q PD A D   +   +   +  ++   
Sbjct: 406 WHPSKRNVLLSCADDCQVLYWDLNNYIMGHPTDQDPDHAVDSQQQNNPVAKWNSKNVLRT 465

Query: 351 SMNPNIPWLTATAEEENIVQVWKP 374
              P++ +     E  NI  VW+P
Sbjct: 466 LDTPSMFYSNGGQEVNNI--VWRP 487

>NCAS0C04450 Chr3 (912688..914073) [1386 bp, 461 aa] {ON} Anc_3.25
          Length = 461

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/232 (24%), Positives = 113/232 (48%), Gaps = 15/232 (6%)

Query: 93  EVLKSNVKIIKKFEHEN-EVTRARYMPQDDNLIATISGVGTIYLYNRAN-EVESGLLSTF 150
           ++ + N  ++K+FE+ + E  R      +D+   T S    + ++N +N +VE     T 
Sbjct: 157 KIWQPNFNMVKEFENAHTECIRDISFSNNDSKFVTCSDDNVLKIWNFSNGQVER----TL 212

Query: 151 QFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDIVNDCKWH 209
             H+ +     ++P E G ++S S D+ + LWD  +G+    I+ F  +H+  V   ++ 
Sbjct: 213 SGHHWDIKSCDWHP-EMGLIVSASKDNLVKLWDPRSGQCISTIIKF--KHT--VLKTRFQ 267

Query: 210 NFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVY 269
               N+  ++S+D + ++ D R     +  V+ +  Y TL ++  + ++F     D  + 
Sbjct: 268 PTRGNLLAAISKDKSCRVFDIRHSMKELMCVRDEVDYMTLTWNPINESMFTVGNYDGAMK 327

Query: 270 LYDRRR-ASKPLHMMP-GHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
            +D  +    P H++P  H+  VTS+ ++P  + +L SA  DR    W  A+
Sbjct: 328 YFDLLQDLEGPSHVIPYAHDKCVTSMAYNPAGN-ILASASKDRTIRFWTRAK 378

>KLTH0F19294g Chr6 complement(1560167..1561522) [1356 bp, 451 aa]
           {ON} similar to uniprot|P42841 Saccharomyces cerevisiae
           YNL317W PFS2 Integral subunit of the pre-mRNA cleavage
           and polyadenylation factor (CPF) complex plays an
           essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 451

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 56/226 (24%), Positives = 93/226 (41%), Gaps = 14/226 (6%)

Query: 153 HNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFD 212
           H +   G+SF+  +  K ++ SDD+ + +W+ +   QE   T T  H D V  C WH   
Sbjct: 166 HTQCIRGISFSGTDS-KFVTCSDDNILKIWNFSNGQQES--TLTGHHWD-VRSCDWHP-T 220

Query: 213 QNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYD 272
             +  S S+D+ ++L D R        +  K    +  F     N+ A    D    ++D
Sbjct: 221 MGLIASGSKDNLIKLWDPRSGQCISTILGCKHTIISTKFQPTKGNMLAVISKDKSCRVFD 280

Query: 273 RRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDG 332
            R+  K L +     D + SL +HP  + +      D     +DL      Q P D+  G
Sbjct: 281 IRQNMKELAVYRDESDYM-SLTWHPINESIFTVGCYDGSMKHFDLM-----QEPQDSSSG 334

Query: 333 SPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
                 I   H   I   + NP +  + A+A ++  ++ W  S  L
Sbjct: 335 C--FHNIPYAHDKCITSLAYNP-VGHILASASKDRTIRFWTRSRPL 377

>YNL035C Chr14 complement(568522..569691) [1170 bp, 389 aa] {ON}
           Putative protein of unknown function with similarity to
           proteins containing WD-40 domains; green fluorescent
           protein (GFP)-fusion protein localizes to the nucleus;
           YNL035C is not an essential gene
          Length = 389

 Score = 59.3 bits (142), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 54/183 (29%), Positives = 87/183 (47%), Gaps = 17/183 (9%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDIVN 204
           L+ +  F +EN + L   P+ K  LL+G  +  I L D  TGKS + I          +N
Sbjct: 6   LVESNSFGSEN-WCLKLQPSYKHGLLTGLSNGEIRLLDWSTGKSVQKIKA----SETAIN 60

Query: 205 DCK--WHNFDQNIFGSVSEDSTLQLHDQRIRDAAVE-KVQAKKPYNTL----AFSAHSTN 257
           D K    +F      S +    +++ D R  D   + + +A  P+ +L       A  T 
Sbjct: 61  DMKVIGSDFSAGHLVSSASIDAVKVFDIRTNDRIAQIQNEANSPFISLDSRHGLLACGTE 120

Query: 258 LFAAAGTDSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWD 316
           L    G D+ VY+YD R+   PL  ++  H D VT ++FHP +  +L+S  +D  T ++D
Sbjct: 121 L---QGIDAAVYIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYD 177

Query: 317 LAE 319
           L +
Sbjct: 178 LKQ 180

>ADL184W Chr4 (375530..376879) [1350 bp, 449 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL317W (PFS2)
          Length = 449

 Score = 59.3 bits (142), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 61/263 (23%), Positives = 119/263 (45%), Gaps = 16/263 (6%)

Query: 93  EVLKSNVKIIKKFEHEN-EVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQ 151
           ++ + N  ++K  +  + E  R       D    T S    + ++N +N  +  +LS   
Sbjct: 146 KIWQPNFNMVKVLDRAHTECMRDISFSYSDQKFVTCSDDNVLKIWNFSNGQQERVLSG-- 203

Query: 152 FHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDIVNDCKWHN 210
            H+ +     ++P + G ++SGS D+ I LWD  TG++   IL    +H+ I    K+  
Sbjct: 204 -HHWDVKSCDWHP-KMGLIVSGSKDNLIKLWDPRTGRNVSTILGL--KHTVI--KTKFQP 257

Query: 211 FDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMV-- 268
              N+   VS+D +++++D R     ++ ++    Y +L++   +  +F+    +  +  
Sbjct: 258 TQGNLLAVVSKDKSIKIYDMRQHMRELQTIRDDMDYMSLSWHPINETIFSVGCYNGAIKH 317

Query: 269 --YLYDRRRASKPLHMMP-GHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQV 325
              L+D   ++   H +P  HE +VTSL + P    +L SA  DR    W  +       
Sbjct: 318 FDLLHDNSNSTPACHTIPYAHEKSVTSLAYSPVGH-ILASAAKDRTIRFWARSRPVDPNA 376

Query: 326 PDDADDGSPEVMMIHAGHRSSIN 348
            DD    + +V   + G  ++IN
Sbjct: 377 FDDPTYNNKKVNAWYFGINNNIN 399

>Smik_11.298 Chr11 complement(497968..499956) [1989 bp, 662 aa] {ON}
           YKR036C (REAL)
          Length = 662

 Score = 59.3 bits (142), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 59/221 (26%), Positives = 97/221 (43%), Gaps = 41/221 (18%)

Query: 147 LSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDV-TGKS-QEPILTFTDRHSDIVN 204
           +  F+ H++    LSF+      L+SGS D  I+ WD+ TGK  Q+  L F   H+D   
Sbjct: 436 IHNFEIHDDEITALSFDSEA---LISGSKDKKILHWDMATGKCIQQLDLIFAPTHND--- 489

Query: 205 DCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGT 264
                     I    S  ST      R+ D     + A + Y +           A    
Sbjct: 490 --------SRISAPSSNYST------RLLDTDAPMIGALQCYKSA---------LATGTK 526

Query: 265 DSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL-----AE 319
           D +V L+D R   KP+ ++ GH D +TSL+F  ++   L++   D    +WDL      +
Sbjct: 527 DGIVRLWDLR-VGKPVRLLRGHTDGITSLKFDSEK---LVTGSMDNSVRIWDLRTSSVVD 582

Query: 320 IGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLT 360
           + A  +P  + D   +++ + A  R  +N F+M  +  W+T
Sbjct: 583 VIAYDLPVTSLDFDDKLIAVGANER-GVNVFNMELDEHWMT 622

>Suva_4.53 Chr4 (95619..99434) [3816 bp, 1271 aa] {ON} YDL195W
           (REAL)
          Length = 1271

 Score = 59.7 bits (143), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 51/213 (23%), Positives = 100/213 (46%), Gaps = 24/213 (11%)

Query: 126 TISGV---GTIYLYNRANEVESGLLSTFQF--HNENGYGLSFNPNEKGKLLSGSDDSNIV 180
           TI+G    GT+ LY+   +    ++ST +F  H+ +   + FN  +   L SG ++  I 
Sbjct: 76  TIAGALDNGTLELYS-IGDAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIF 134

Query: 181 LWDVTGKSQEPI----LTFTDRHSDI--VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRD 234
           +WD+   ++ P     LT     S +  VN   W+    ++F S    +   + D + + 
Sbjct: 135 IWDMNKCTESPSSYTPLTPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDLKAKK 194

Query: 235 AAVEKVQAKKPYNTLA--------FSAHSTNLFAAAGTDS--MVYLYDRRRASKPLHMMP 284
             +  +    P + +            +ST +  A G+D+   + ++D R A+ PL  + 
Sbjct: 195 EVIH-LSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQTLS 253

Query: 285 -GHEDAVTSLEFHPQEDGVLISAGSDRRTILWD 316
            GH+  + SL++  Q++ +L+S+G D   +LW+
Sbjct: 254 QGHQKGILSLDWCHQDENLLLSSGRDNTVLLWN 286

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 76/159 (47%), Gaps = 20/159 (12%)

Query: 174 SDDSNIVLWDV-TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRI 232
           S DS++ LW + T  S++P+ +   +     ND  W + ++ I G++ ++ TL+L+   I
Sbjct: 37  STDSSLELWSLLTTDSEKPMASL--QVDSKFNDLDWSHNNKTIAGAL-DNGTLELYS--I 91

Query: 233 RDAAVEKVQAKKPYN------TLAFSAHSTNLFAAAGTDSMVYLYDRRRASKP----LHM 282
            DA    V   K  N      T+ F++   N+ A+ G +  ++++D  + ++       +
Sbjct: 92  GDAHDTIVSTAKFSNHSSSVKTVKFNSKQDNVLASGGNNGEIFIWDMNKCTESPSSYTPL 151

Query: 283 MPGHE----DAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
            PG      D V SL ++     V  SAGS     +WDL
Sbjct: 152 TPGQSMSSVDEVNSLAWNQSLAHVFASAGSSNFASIWDL 190

>KLLA0E07085g Chr5 (645766..647124) [1359 bp, 452 aa] {ON} similar
           to uniprot|P42841 Saccharomyces cerevisiae YNL317W PFS2
           Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 452

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 55/225 (24%), Positives = 97/225 (43%), Gaps = 16/225 (7%)

Query: 151 QFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHN 210
           Q H E    +SF+P ++ K +S SDD+ + +W+ +   QE +L  +  H D V  C WH 
Sbjct: 162 QAHMECVREISFSPTDQ-KFVSCSDDNVLKIWNFSNGQQERVL--SGHHWD-VKSCDWHP 217

Query: 211 FDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYL 270
               +  S S+D+ ++  D R        +  K    +  F     NL +    D    +
Sbjct: 218 -KMGLIVSGSKDNLIKFWDPRSGSCVSTMLGFKHTIISTKFQPKQGNLLSVISKDKTCKV 276

Query: 271 YDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDAD 330
           YD R+ +K L  +    D +T L++HP ++ V      D     +DL++   E  P+   
Sbjct: 277 YDIRQQAKELFSVRDDVDYMT-LQWHPIDETVFTVGCYDGSIKHFDLSQ---ENQPNKPT 332

Query: 331 DGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPS 375
              P        H   +   + +P I  + A+A ++  ++ W  S
Sbjct: 333 HNIP------YAHEKCVTSLAYSP-IGHIMASASKDRTIRFWTRS 370

>ZYRO0C03124g Chr3 complement(240321..241658) [1338 bp, 445 aa] {ON}
           highly similar to uniprot|Q75AV4 Ashbya gossypii ADL184W
           PSF2 Polyadenylation factor subunit 2 and similar to
           YNL317W uniprot|P42841 Saccharomyces cerevisiae YNL317W
           PFS2 Integral subunit of the pre-mRNA cleavage and
           polyadenylation factor (CPF) complex plays an essential
           role in mRNA 3'-end formation by bridging different
           processing factors and thereby promoting the assembly of
           the processing complex
          Length = 445

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 111/270 (41%), Gaps = 30/270 (11%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYL----YNRANEVESGLLSTFQFHNENGYGLSF 162
           H+  VT   Y    D +I+  +  GTI +    +N   E++         H E    ++F
Sbjct: 122 HDTAVTTMEYSRAGDWMISGDTD-GTIKIWQPNFNMVKELDRA-------HTECIRDIAF 173

Query: 163 NPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSED 222
           + N+  K ++ SDD+ + +W+ +   QE +L  +  H D V  C WH     +  S S+D
Sbjct: 174 SHND-SKFVTCSDDNILKIWNFSNGQQERVL--SGHHWD-VKSCDWHP-QMGLIASASKD 228

Query: 223 STLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHM 282
           + ++L D R        ++ K       F     NL AA   D    ++D R++ K L +
Sbjct: 229 NLVKLWDPRSGQCVSTLLKFKHTVLKTKFQPTQGNLMAAISKDKSCRVFDLRQSMKELMV 288

Query: 283 MPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAG 342
                D +T L +HP  + +   A  D           G+ +  D   D       I   
Sbjct: 289 TRDEVDYMT-LLWHPINETMFTVACYD-----------GSLKNFDILQDTEGPTHTIPYA 336

Query: 343 HRSSINDFSMNPNIPWLTATAEEENIVQVW 372
           H   I   S NP +  + A+A ++  ++ W
Sbjct: 337 HDKCITSLSYNP-VGHILASASKDRTIRFW 365

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 59/260 (22%), Positives = 116/260 (44%), Gaps = 13/260 (5%)

Query: 93  EVLKSNVKIIKKFEHEN-EVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQ 151
           ++ + N  ++K+ +  + E  R      +D+   T S    + ++N +N  +  +LS   
Sbjct: 148 KIWQPNFNMVKELDRAHTECIRDIAFSHNDSKFVTCSDDNILKIWNFSNGQQERVLSG-- 205

Query: 152 FHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDIVNDCKWHN 210
            H+ +     ++P + G + S S D+ + LWD  +G+    +L F  +H+  V   K+  
Sbjct: 206 -HHWDVKSCDWHP-QMGLIASASKDNLVKLWDPRSGQCVSTLLKF--KHT--VLKTKFQP 259

Query: 211 FDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYL 270
              N+  ++S+D + ++ D R     +   + +  Y TL +   +  +F  A  D  +  
Sbjct: 260 TQGNLMAAISKDKSCRVFDLRQSMKELMVTRDEVDYMTLLWHPINETMFTVACYDGSLKN 319

Query: 271 YDRRRASK-PLHMMP-GHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDD 328
           +D  + ++ P H +P  H+  +TSL ++P    +L SA  DR    W  A        DD
Sbjct: 320 FDILQDTEGPTHTIPYAHDKCITSLSYNPVGH-ILASASKDRTIRFWTRARPYDPNAFDD 378

Query: 329 ADDGSPEVMMIHAGHRSSIN 348
               + +V     G  + IN
Sbjct: 379 PTYNNKKVNAWFFGINNGIN 398

>TPHA0I01880 Chr9 complement(418620..421724) [3105 bp, 1034 aa] {ON}
           Anc_8.544 YBR198C
          Length = 1034

 Score = 58.9 bits (141), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 89/211 (42%), Gaps = 28/211 (13%)

Query: 172 SGSDDSNIVLWDVTGKSQE----------PILTFTDRHSDIVNDCKWHNFDQNIFGSVSE 221
           +G  DS I +W + G S             I      HSD V    +   ++ +  S S 
Sbjct: 722 TGFQDSYIKIWSLEGTSINENEQNYSQINSIFKTLVGHSDAVYSVNFSPCNRFLL-SGSG 780

Query: 222 DSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLH 281
           D T +L         V     +KP   + FS    NLFA A +D+   ++   R   P+ 
Sbjct: 781 DKTARLWSTDTYKGLVSYKGHEKPIWDVNFSPTGNNLFATASSDNTARVWSCDRVY-PVR 839

Query: 282 MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHA 341
           ++ GH   V  + FHP    V  +  SD+ + +WDL+              S + + +  
Sbjct: 840 ILAGHLSDVDCVSFHPNGQYVF-TGSSDKTSRMWDLS--------------SGDSVRLFI 884

Query: 342 GHRSSINDFSMNPNIPWLTATAEEENIVQVW 372
           GH S++   +++P+  WL +TA E+  + VW
Sbjct: 885 GHSSAVTATAVSPDGRWL-STANEDGTITVW 914

 Score = 35.4 bits (80), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 57/262 (21%), Positives = 110/262 (41%), Gaps = 38/262 (14%)

Query: 60  GTHTSDEEQNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQ 119
           GT  ++ EQNY +I +I+                      K +    H + V    + P 
Sbjct: 736 GTSINENEQNYSQINSIF----------------------KTL--VGHSDAVYSVNFSPC 771

Query: 120 DDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNI 179
           +  L++  SG  T  L+  + +   GL+S ++ H +  + ++F+P       + S D+  
Sbjct: 772 NRFLLSG-SGDKTARLW--STDTYKGLVS-YKGHEKPIWDVNFSPTGNNLFATASSDNTA 827

Query: 180 VLWDVTGKSQEPILTFTDRHSDIVNDC-KWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVE 238
            +W        P+       SD+  DC  +H   Q +F + S D T ++ D    D+   
Sbjct: 828 RVWSC--DRVYPVRILAGHLSDV--DCVSFHPNGQYVF-TGSSDKTSRMWDLSSGDSVRL 882

Query: 239 KVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGH-EDAVTSLEFHP 297
            +         A S       + A  D  + ++D   + K L  M GH ++++ SL ++ 
Sbjct: 883 FIGHSSAVTATAVSPDGR-WLSTANEDGTITVWDIG-SGKKLKSMRGHGKNSIYSLSYN- 939

Query: 298 QEDGVLISAGSDRRTILWDLAE 319
           +   +L+S+G+D    +WD+ +
Sbjct: 940 KTGNILVSSGADNSVRVWDIKK 961

 Score = 32.3 bits (72), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 99/227 (43%), Gaps = 47/227 (20%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGT--IYLYNRANEVE--SGLLSTFQFHNENGYGLSF 162
           HE  +    + P  +NL AT S   T  ++  +R   V   +G LS           +SF
Sbjct: 801 HEKPIWDVNFSPTGNNLFATASSDNTARVWSCDRVYPVRILAGHLSDVDC-------VSF 853

Query: 163 NPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVN-----DCKWHNFDQNIFG 217
           +PN +  + +GS D    +WD++  S + +  F    S +       D +W         
Sbjct: 854 HPNGQ-YVFTGSSDKTSRMWDLS--SGDSVRLFIGHSSAVTATAVSPDGRW-------LS 903

Query: 218 SVSEDSTLQLHD----QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDR 273
           + +ED T+ + D    ++++     +   K    +L+++  + N+  ++G D+ V ++D 
Sbjct: 904 TANEDGTITVWDIGSGKKLKSM---RGHGKNSIYSLSYN-KTGNILVSSGADNSVRVWDI 959

Query: 274 RRAS-----KPLHMMPG-HEDAVTSLEFHPQEDGVLISAGSDRRTIL 314
           ++ +     +P  + PG   D VTS+    +E G        RRTI+
Sbjct: 960 KKNTHEPSLEPEEIYPGLGNDNVTSMNQDIKEYG-------RRRTIV 999

>NCAS0F01850 Chr6 complement(371372..371794,372104..372637) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 106/239 (44%), Gaps = 27/239 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +  +   LLSGS D  ++ W +TG  Q+   P+ +F   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKG-HSHI 67

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V DC     D     S S D TL+L D    +     V  K    ++A    ++ + + +
Sbjct: 68  VQDCTLTQ-DGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGS 126

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHP---QEDGV-LISAGSDRRTILWDLA 318
             D  + ++  +   + L  + GH D V+ +   P    +D V +ISAG+D+    W+L 
Sbjct: 127 -RDKTIKVWTIK--GQCLATLLGHNDWVSQVRIAPTDQNDDAVTVISAGNDKMVKAWNLN 183

Query: 319 EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSK 377
           +    Q+  D             GH  ++N  + +P+   L A+A ++  + +W  + K
Sbjct: 184 QF---QIEAD-----------FVGHNGNVNAVTASPDGT-LIASAGKDGEIMLWNLAEK 227

>NCAS0A04270 Chr1 (862892..863425,863734..864156) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 106/239 (44%), Gaps = 27/239 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +  +   LLSGS D  ++ W +TG  Q+   P+ +F   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSGSRDKTLISWKLTGDDQKFGVPVRSFKG-HSHI 67

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V DC     D     S S D TL+L D    +     V  K    ++A    ++ + + +
Sbjct: 68  VQDCTLTQ-DGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGS 126

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHP---QEDGV-LISAGSDRRTILWDLA 318
             D  + ++  +   + L  + GH D V+ +   P    +D V +ISAG+D+    W+L 
Sbjct: 127 -RDKTIKVWTIK--GQCLATLLGHNDWVSQVRIAPTDQNDDSVTVISAGNDKMVKAWNLN 183

Query: 319 EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSK 377
           +    Q+  D             GH  ++N  + +P+   L A+A ++  + +W  + K
Sbjct: 184 QF---QIEAD-----------FVGHNGNVNTVTASPDGT-LIASAGKDGEIMLWNLAEK 227

>Suva_14.311 Chr14 complement(553987..555156) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 58.2 bits (139), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 63/203 (31%), Positives = 98/203 (48%), Gaps = 28/203 (13%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDI-V 203
           L+    F +EN + L   P  K  LL+G  +  I L D  TGK  + I     R S+  +
Sbjct: 6   LVDLNSFGSEN-WCLKLQPAYKHGLLTGLSNGEICLLDWNTGKPLQKI-----RASETAI 59

Query: 204 NDCKWHNFD---QNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFA 260
           ND K  + D    N+  S S DS +++ D R  D  V K+  +   N+   S  S +   
Sbjct: 60  NDMKIIDSDFVAGNLISSASIDS-VKVFDIRSNDC-VAKINNET--NSPFLSLDSRHGLL 115

Query: 261 AAGT-----DSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTIL 314
           A GT     D+ +++YD R+   PL  ++  H D VT ++FHP +  VL+S  +D  T +
Sbjct: 116 ACGTELQGIDAAIHIYDVRKWDAPLRSLVDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNI 175

Query: 315 WDLAEIGAEQVPDDADDGSPEVM 337
           +DL +       DD +D   +V+
Sbjct: 176 YDLKQ-------DDEEDALHQVI 191

>Skud_14.298 Chr14 complement(546083..547252) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/185 (31%), Positives = 93/185 (50%), Gaps = 21/185 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDIVN 204
           L+ +  F +EN + L   P+ K  LL+G  +  I L D  +G+S + I          +N
Sbjct: 6   LVESNSFGSEN-WCLKLQPSYKYGLLTGLSNGEIRLLDWNSGQSLQKIKASETS----IN 60

Query: 205 DCKWHNFD---QNIFGSVSEDSTLQLHDQRIRDAAVEKV--QAKKPYNTL----AFSAHS 255
           D K  + D    ++  S S D+ +++ D R  +A V K+  +A  P+ +L       A  
Sbjct: 61  DLKVIDSDFAAGHLVSSASIDA-VKVFDIRT-NACVAKIHNEANSPFISLDSRHGLLACG 118

Query: 256 TNLFAAAGTDSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTIL 314
           T L    G D+ VY+YD RR   PL  ++  H D VT ++FHP +  VL+S  +D  T +
Sbjct: 119 TEL---QGIDAAVYIYDIRRWDAPLRSIIDSHHDDVTCIKFHPSDVNVLLSGSTDGYTNI 175

Query: 315 WDLAE 319
           +DL +
Sbjct: 176 YDLKQ 180

>TPHA0C03370 Chr3 complement(738736..739977) [1242 bp, 413 aa] {ON}
           Anc_2.283 YNL035C
          Length = 413

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/185 (24%), Positives = 95/185 (51%), Gaps = 12/185 (6%)

Query: 142 VESGLLSTFQFHNENGYGLSFNP-NEKGKLLSGSDDS-NIVLWDVTGKSQEPILTFTDRH 199
           + + L++   F N+N + L   P   +G L S S+ S N++ W+     ++  +  T+ +
Sbjct: 1   MSAKLVNQITFGNDN-WCLELKPLYSRGLLCSSSNGSVNLIDWNSPSIIKKFEVGETNIN 59

Query: 200 S-DIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNL 258
           S  ++N+    +F+     + +  ++++++D R  D+ V  ++  K    L+  +    L
Sbjct: 60  SLRVINN----DFENGCIFAATSLASVKIYDVRNGDSPVATIKNDKNSVFLSLESRHDML 115

Query: 259 FAAA---GTDSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTIL 314
                  G D+ +++YD R  SKP+   +  H D +T ++FHP +  +L+S  +D  T +
Sbjct: 116 VCGTELTGVDAEMFIYDVRYFSKPVRAFVDSHHDDITDIKFHPSDKNILLSGSTDGYTNI 175

Query: 315 WDLAE 319
           +DLA+
Sbjct: 176 YDLAQ 180

>AEL269C Chr5 complement(134760..136127) [1368 bp, 455 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR178W
           (PRP4)
          Length = 455

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/167 (30%), Positives = 89/167 (53%), Gaps = 13/167 (7%)

Query: 159 GLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGS 218
           GL ++P+    LLSG  D+ + LWD+T  S E +      H+  V+  K H     +  S
Sbjct: 220 GLDWHPDGN-HLLSGGGDNLVKLWDMTSNSFEELRG----HAGRVSRVKVHP-SGRLAAS 273

Query: 219 VSEDSTLQLHD-QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS 277
            S D T  L D +R  +  +++  +K  Y T+AF +    L A+AG D++  ++D  R+ 
Sbjct: 274 ASFDLTWILWDLERKVELQLQEGHSKAVY-TIAFQSDGA-LLASAGLDAVCAIWD-LRSG 330

Query: 278 KPLHMMPGHEDAVTSLEFHPQEDGV-LISAGSDRRTILWDLAEIGAE 323
           +P+  + GH  A++ +++ P  +G  L +AG+D    +WD+  +G E
Sbjct: 331 EPIMKLEGHAGAISGVDWSP--NGYQLATAGADGTVRVWDIRNVGTE 375

>TDEL0A02070 Chr1 (372046..372582,372798..373220) [960 bp, 319 aa]
           {ON} Anc_2.431 YMR116C
          Length = 319

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 62/240 (25%), Positives = 103/240 (42%), Gaps = 28/240 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +  +   LLS S D  ++ W +TG  Q+   P+ +F   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSFKG-HSHI 67

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V DC     D     S S D TL+L D    +     V  K    ++A    ++ + + +
Sbjct: 68  VQDCA-LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGS 126

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQED-----GVLISAGSDRRTILWDL 317
             D  V ++  +   + L  M GH D V+ +   P ED       +ISAG D+    W++
Sbjct: 127 -RDKTVKVWTIK--GQCLATMLGHNDWVSQVRIVPTEDVNDDTVTVISAGMDKMVKAWNV 183

Query: 318 AEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSK 377
                 Q   +AD           GH + +N  + +P+   L A+A ++  + +W  + K
Sbjct: 184 -----NQFQIEAD---------FIGHNNYVNTVTASPDGS-LIASAGKDGEIMLWNLADK 228

>KAFR0I02840 Chr9 complement(570039..571409) [1371 bp, 456 aa] {ON}
           Anc_3.25 YNL317W
          Length = 456

 Score = 57.8 bits (138), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 111/270 (41%), Gaps = 30/270 (11%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYL----YNRANEVESGLLSTFQFHNENGYGLSF 162
           H++ VT  +Y    D +++  +  G I +    +N   E+E+        H E    +SF
Sbjct: 122 HDSAVTTMKYSNAGDWMVSGDTD-GNIKIWQPNFNMVKELENA-------HTECIRDISF 173

Query: 163 NPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSED 222
           N N   K ++ SDD+ + +W+ +   QE +L  +  H D V  C WH     +  S S+D
Sbjct: 174 N-NADSKFVTCSDDNILKIWNFSNGQQERVL--SGHHWD-VKSCDWHP-TMGLIASASKD 228

Query: 223 STLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHM 282
           + ++L D R  +     ++ K       F     NL  A   D    ++D R + K L +
Sbjct: 229 NLIKLWDPRSGNCVSTILKFKHTVLKTRFQPTKGNLLVAISKDKSCRVFDIRHSMKELMV 288

Query: 283 MPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAG 342
           +    D +T L +HP  + V      D           G+ +  D   D S     I   
Sbjct: 289 VRDEVDYMT-LLWHPINESVFTVGNYD-----------GSLKHFDILQDLSNPTHSIPFA 336

Query: 343 HRSSINDFSMNPNIPWLTATAEEENIVQVW 372
           H   I   S N  +  + A+A ++  V+ W
Sbjct: 337 HDKCITSMSYNA-MGTVLASASKDRTVRFW 365

>Suva_13.295 Chr13 complement(480518..480940,481217..481753) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 104/240 (43%), Gaps = 28/240 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +  +   LLS S D  ++ W +TG  Q+   P+ +F   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKG-HSHI 67

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V DC     D     S S D TL+L D    +     V  K    ++     ++ + + +
Sbjct: 68  VQDCT-LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGS 126

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDG-----VLISAGSDRRTILWDL 317
             D  + ++  +   + L  + GH D V+ +   P E        +ISAG+D+    W+L
Sbjct: 127 -RDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNL 183

Query: 318 AEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSK 377
            +    Q+  D             GH S+IN  + +P+   L A+A ++  + +W  ++K
Sbjct: 184 NQF---QIEAD-----------FIGHNSNINTLTASPDGT-LIASAGKDGEIMLWNLAAK 228

>Skud_13.275 Chr13 complement(474770..475192,475471..476007) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 104/240 (43%), Gaps = 28/240 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +  +   LLS S D  ++ W +TG  Q+   P+ +F   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKG-HSHI 67

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V DC     D     S S D TL+L D    +     V  K    ++     ++ + + +
Sbjct: 68  VQDCT-LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGS 126

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDG-----VLISAGSDRRTILWDL 317
             D  + ++  +   + L  + GH D V+ +   P E        +ISAG+D+    W+L
Sbjct: 127 -RDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNL 183

Query: 318 AEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSK 377
            +    Q+  D             GH S+IN  + +P+   L A+A ++  + +W  ++K
Sbjct: 184 NQF---QIEAD-----------FIGHNSNINTLTASPDGT-LIASAGKDGEIMLWNLAAK 228

>Smik_13.305 Chr13 complement(482912..483334,483612..484148) [960
           bp, 319 aa] {ON} YMR116C (REAL)
          Length = 319

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 104/240 (43%), Gaps = 28/240 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +  +   LLS S D  ++ W +TG  Q+   P+ +F   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKG-HSHI 67

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V DC     D     S S D TL+L D    +     V  K    ++     ++ + + +
Sbjct: 68  VQDCT-LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGS 126

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDG-----VLISAGSDRRTILWDL 317
             D  + ++  +   + L  + GH D V+ +   P E        +ISAG+D+    W+L
Sbjct: 127 -RDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNL 183

Query: 318 AEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSK 377
            +    Q+  D             GH S+IN  + +P+   L A+A ++  + +W  ++K
Sbjct: 184 NQF---QIEAD-----------FIGHNSNINTLTASPDGT-LIASAGKDGEIMLWNLAAK 228

>YMR116C Chr13 complement(499456..499878,500152..500688) [960 bp,
           319 aa] {ON}  ASC1G-protein beta subunit and guanine
           nucleotide dissociation inhibitor for Gpa2p; ortholog of
           RACK1 that inhibits translation; core component of the
           small (40S) ribosomal subunit; represses Gcn4p in the
           absence of amino acid starvation
          Length = 319

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 104/240 (43%), Gaps = 28/240 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +  +   LLS S D  ++ W +TG  Q+   P+ +F   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKG-HSHI 67

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V DC     D     S S D TL+L D    +     V  K    ++     ++ + + +
Sbjct: 68  VQDCT-LTADGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVDIDKKASMIISGS 126

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDG-----VLISAGSDRRTILWDL 317
             D  + ++  +   + L  + GH D V+ +   P E        +ISAG+D+    W+L
Sbjct: 127 -RDKTIKVWTIK--GQCLATLLGHNDWVSQVRVVPNEKADDDSVTIISAGNDKMVKAWNL 183

Query: 318 AEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSK 377
            +    Q+  D             GH S+IN  + +P+   L A+A ++  + +W  ++K
Sbjct: 184 NQF---QIEAD-----------FIGHNSNINTLTASPDGT-LIASAGKDGEIMLWNLAAK 228

>Kwal_33.15136 s33 (974095..975516) [1422 bp, 473 aa] {ON} YLL011W
           (SOF1) - 56 kDa nucleolar snRNP protein that shows
           homology to beta subunits of G-proteins and the splicing
           factor Prp4 [contig 94] FULL
          Length = 473

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/171 (28%), Positives = 82/171 (47%), Gaps = 12/171 (7%)

Query: 144 SGLLSTFQFHNENGY-GLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDI 202
           +GL+ TF  H E+ + G+  + +    +  G++   I LWD T     PI   +   +D 
Sbjct: 165 NGLIKTF--HGEHAFLGIDHHRSNSNFVTGGAE---INLWDST--RSRPITNLS-WGADN 216

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V+  K++  + +IF S   D+++ L+D R  ++  +K   K   N L ++      F  A
Sbjct: 217 VSTVKFNQNETDIFASAGSDNSVVLYDLRT-NSPTQKFVQKMRTNALCWNPMEAYNFVVA 275

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI 313
             D   Y YD R  S+ LH+   H  AV  ++F P  D ++   GS  +TI
Sbjct: 276 NEDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEIV--TGSYDKTI 324

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 82/184 (44%), Gaps = 24/184 (13%)

Query: 153 HNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKW---- 208
           H +  Y ++ N +   KL + S D  +  W+++  ++E + +F   +  I   C      
Sbjct: 66  HRDGVYTIAKNYHVLNKLATASADGVVKYWNMS--TREEVCSFKAHYGLIHGLCVTPQHL 123

Query: 209 -HNFDQNIFGSVSEDSTLQLHDQRIRDAAVEK--VQAKKPYNTLAFSAH----------- 254
             N ++N   S  +D T++L      D + E+   +  K  N L  + H           
Sbjct: 124 SQNKNENYMLSCGDDRTVKLWSVNTDDFSSERGDEEVIKSGNGLIKTFHGEHAFLGIDHH 183

Query: 255 -STNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI 313
            S + F   G +  + L+D  R S+P+  +    D V++++F+  E  +  SAGSD   +
Sbjct: 184 RSNSNFVTGGAE--INLWDSTR-SRPITNLSWGADNVSTVKFNQNETDIFASAGSDNSVV 240

Query: 314 LWDL 317
           L+DL
Sbjct: 241 LYDL 244

>CAGL0M04081g Chr13 complement(450572..451939) [1368 bp, 455 aa]
           {ON} highly similar to uniprot|P42841 Saccharomyces
           cerevisiae YNL317w PFS2 polyadenylation factor I
          Length = 455

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 51/231 (22%), Positives = 110/231 (47%), Gaps = 13/231 (5%)

Query: 93  EVLKSNVKIIKKFEH-ENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQ 151
           ++ + N  ++K+ +    E  R      +D+   T S    + ++N +N  +  +LS   
Sbjct: 149 KIWQPNFNMVKELDRIHTEGIRDVAFSNNDSKFVTCSDDNILKIWNFSNGQQERVLSG-- 206

Query: 152 FHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDIVNDCKWHN 210
            H+ +     ++P E G ++SGS D+ + LWD  +G+    +L F  +H+  V   ++  
Sbjct: 207 -HHWDVRSCDWHP-ELGLIVSGSKDNLVKLWDPRSGQCVSTLLKF--KHT--VLKTRFQP 260

Query: 211 FDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYL 270
              N+  ++S+D + ++ D R     +  V+ +  +  L +S  + ++F     D  +  
Sbjct: 261 TKGNLLAAISKDKSCRVFDLRASMNELMCVRDEVDFMELEWSTINESMFTVGCYDGSLKH 320

Query: 271 YDRRR-ASKPLHMMP-GHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
           +D  +   KP+H++P  HE  ++++ ++P    +L +A  DR    W  A 
Sbjct: 321 FDLGQDTEKPIHIIPFAHEKCISAIAYNPV-GHILATAAKDRTIRFWTRAR 370

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 62/270 (22%), Positives = 110/270 (40%), Gaps = 30/270 (11%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYL----YNRANEVESGLLSTFQFHNENGYGLSF 162
           H+  VT  +Y    D +I+     GTI +    +N   E++       + H E    ++F
Sbjct: 123 HDTSVTTMKYSHAGDWMISG-DADGTIKIWQPNFNMVKELD-------RIHTEGIRDVAF 174

Query: 163 NPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSED 222
           + N+  K ++ SDD+ + +W+ +   QE +L  +  H D V  C WH  +  +  S S+D
Sbjct: 175 SNND-SKFVTCSDDNILKIWNFSNGQQERVL--SGHHWD-VRSCDWHP-ELGLIVSGSKD 229

Query: 223 STLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHM 282
           + ++L D R        ++ K       F     NL AA   D    ++D R +   L M
Sbjct: 230 NLVKLWDPRSGQCVSTLLKFKHTVLKTRFQPTKGNLLAAISKDKSCRVFDLRASMNEL-M 288

Query: 283 MPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAG 342
               E     LE+    + +      D     +DL +           D    + +I   
Sbjct: 289 CVRDEVDFMELEWSTINESMFTVGCYDGSLKHFDLGQ-----------DTEKPIHIIPFA 337

Query: 343 HRSSINDFSMNPNIPWLTATAEEENIVQVW 372
           H   I+  + NP +  + ATA ++  ++ W
Sbjct: 338 HEKCISAIAYNP-VGHILATAAKDRTIRFW 366

>NDAI0A02090 Chr1 complement(466744..470346) [3603 bp, 1200 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1200

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 57/246 (23%), Positives = 104/246 (42%), Gaps = 25/246 (10%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           +L+ F+  +    G++F+P+ +  +L     S I LWD    +   +L   + H   V  
Sbjct: 3   MLTKFESKSSRAKGIAFHPS-RPWVLVALFSSTIQLWDYRMGT---LLHRFEDHEGPVRG 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q IF S  +D T+++      +  +  +Q    Y    F  H      +A  D
Sbjct: 59  LDFHP-TQPIFVSAGDDYTIKVWSLET-NKCLYTLQGHLDYVRTVFFHHELPWIISASDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA------- 318
             + +++ +   K +  + GH   V   +FHP ED +++SA  D    +WD++       
Sbjct: 117 QTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPNED-LVVSASLDESVRVWDISGLRKKHS 174

Query: 319 ---------EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIV 369
                    +I A+    D   G   V  I  GH   +N  S +P +P L  +  ++  V
Sbjct: 175 APGTTSMEDQIAAQNNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQV 233

Query: 370 QVWKPS 375
           ++W+ S
Sbjct: 234 KLWRMS 239

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 76/175 (43%), Gaps = 39/175 (22%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           ++SGSDD  + LW ++      + T     +++  DC   +  QN+  SV ED TL++ D
Sbjct: 224 IVSGSDDRQVKLWRMSQTKAWEVDTCRGHTNNV--DCVIFHPHQNLIISVGEDKTLRIWD 281

Query: 230 QRIRDAAVEKVQAKKPYNTL-AFSAH-STNLFAAA-GTDSMVYLYDRRRAS--------- 277
               D  V   Q K+ ++     +AH + NLF AA  T  MV+  DR R           
Sbjct: 282 ---LDKRVPVKQFKREHDRFWLIAAHPNINLFGAAHDTGIMVFKLDRERPCSFIHQNQLI 338

Query: 278 -----KPLHMMPGHE-----------------DAVTSLEFHPQEDGVLISAGSDR 310
                K L +   H+                 +A  S+ ++P +  VL++ G+D+
Sbjct: 339 FINKEKQLQIFDYHKRVTSLPYVSLKKIGLAWNAFRSISYNPSQHSVLVNLGNDK 393

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 54/234 (23%), Positives = 92/234 (39%), Gaps = 31/234 (13%)

Query: 132 TIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEP 191
           TI ++N  N  E   L+    HN       F+PNE   ++S S D ++ +WD++G  ++ 
Sbjct: 118 TIRIWNWQNRKEIACLTG---HNHFVMCAQFHPNED-LVVSASLDESVRVWDISGLRKKH 173

Query: 192 ILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAF 251
               T    D +     +N     FG       L+ H + +  A                
Sbjct: 174 SAPGTTSMEDQI--AAQNNLLDGGFGDCVVKFILEGHTRGVNWA---------------- 215

Query: 252 SAHSTNLFAAAGTDSMVYLYDRRRASKP--LHMMPGHEDAVTSLEFHPQEDGVLISAGSD 309
           S H T     +G+D       R   +K   +    GH + V  + FHP ++ ++IS G D
Sbjct: 216 SFHPTLPLIVSGSDDRQVKLWRMSQTKAWEVDTCRGHTNNVDCVIFHPHQN-LIISVGED 274

Query: 310 RRTILWDL-AEIGAEQVPDDADD-----GSPEVMMIHAGHRSSINDFSMNPNIP 357
           +   +WDL   +  +Q   + D        P + +  A H + I  F ++   P
Sbjct: 275 KTLRIWDLDKRVPVKQFKREHDRFWLIAAHPNINLFGAAHDTGIMVFKLDRERP 328

>TDEL0A00440 Chr1 (78820..80175) [1356 bp, 451 aa] {ON} Anc_3.25
           YNL317W
          Length = 451

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 117/260 (45%), Gaps = 13/260 (5%)

Query: 93  EVLKSNVKIIKKFEHEN-EVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQ 151
           ++ + N  ++K+ +  + E  R      +D+   T S    + ++N +N  +  +LS   
Sbjct: 148 KIWQPNFNMVKELDRAHTECIRDVAFSGNDSKFVTCSDDNILKIWNFSNGQQERVLSG-- 205

Query: 152 FHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDIVNDCKWHN 210
            H+ +     ++P E G + S S D+ + LWD   G+    IL F  +H+  V   ++  
Sbjct: 206 -HHWDVKSCDWHP-EMGLIASASKDNLVKLWDPRVGQCISTILKF--KHT--VLKTRFQP 259

Query: 211 FDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYL 270
              N+  ++S+D + ++ D R     +  V+ +  Y TL ++  + ++   A  D  +  
Sbjct: 260 TGGNLLAAISKDKSCRVFDIRHSLKELMVVRDEVDYMTLLWNPINESMLTVACYDGSLKD 319

Query: 271 YDR-RRASKPLHMMP-GHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDD 328
           +D  +   KP+H +P  H+  +TSL ++P    +L SA  DR    W  A        DD
Sbjct: 320 FDVVQDLKKPVHTIPYAHDKCITSLSYNPVGH-ILASASKDRTIRFWTRARPSDPNAFDD 378

Query: 329 ADDGSPEVMMIHAGHRSSIN 348
               + +V     G  + IN
Sbjct: 379 PTYNNKKVNAWFFGINNGIN 398

>TPHA0G02380 Chr7 (484477..485010,485373..485795) [957 bp, 318 aa]
           {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 105/251 (41%), Gaps = 46/251 (18%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +  +   L+S S D  ++ W +TG  Q+   P+ +F   H+ I
Sbjct: 8   LRGTLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKG-HNHI 66

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V DC     D     S S D TL+L +          V   + Y    F+ H +++ + A
Sbjct: 67  VQDCA-LTADGAYALSASWDKTLRLWN----------VATGETYQR--FTGHKSDVMSVA 113

Query: 263 --GTDSMVYLYDRRRASK-------PLHMMPGHEDAVTSLEFHP---QEDG--VLISAGS 308
                SM+    R +  K        L  + GH D V+ +   P   QED    LISAGS
Sbjct: 114 IDRKASMIISGSRDKTIKVWSIKGDCLATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGS 173

Query: 309 DRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENI 368
           D+    W++ +    Q+  D             GH + IN  + +P+   L A+A ++  
Sbjct: 174 DKMVKAWNINQF---QIEAD-----------FVGHNNYINSITASPDGS-LVASAGKDGD 218

Query: 369 VQVWKPSSKLP 379
           + +W    K P
Sbjct: 219 IMLWNLKQKTP 229

>NDAI0F01240 Chr6 complement(302631..304205) [1575 bp, 524 aa] {ON}
           Anc_6.276 YPL247C
          Length = 524

 Score = 57.0 bits (136), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/171 (23%), Positives = 74/171 (43%), Gaps = 19/171 (11%)

Query: 162 FNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSE 221
           +NP +   L+S S D+  ++WD+  +S   + T    H   V D ++      +F S   
Sbjct: 256 WNPIDTNLLISSSIDTTCIIWDL--ESSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGG 313

Query: 222 DSTLQLHDQRIRDAAVEKVQAKKPYNT--------------LAFSAHSTNLFAAAGTDS- 266
           D ++++ D  +R  A   +  + P                 L  S H  N+ A    DS 
Sbjct: 314 DGSVRVFD--LRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSN 371

Query: 267 MVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
            + + D R    P+  + GH  ++  +++HP E  +L+S   D + + WDL
Sbjct: 372 KIIILDMRNPETPVLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDL 422

 Score = 35.4 bits (80), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 118 PQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDS 177
           P D N++AT +      +       E+ +L T Q H+ +   + ++P E+  LLS +DD 
Sbjct: 357 PHDPNIVATFAADSNKIIILDMRNPETPVL-TLQGHSSSLNQIKWHPTERNILLSCADDC 415

Query: 178 NIVLWDV 184
            ++ WD+
Sbjct: 416 QVLYWDL 422

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 40/183 (21%), Positives = 72/183 (39%), Gaps = 24/183 (13%)

Query: 208 WHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAK-KPYNTLAFSAHSTNLFAAAGTDS 266
           W+  D N+  S S D+T  + D    +    ++ A       + F   ST LFA+ G D 
Sbjct: 256 WNPIDTNLLISSSIDTTCIIWDLESSNYVKTQLIAHDSEVFDVRFLTQSTQLFASCGGDG 315

Query: 267 MVYLYDRRRASK-------PLHMMPGHEDA----VTSLEFHPQEDGVLISAGSDRRTILW 315
            V ++D R  +        P  M P    A    +  LE  P +  ++ +  +D   I+ 
Sbjct: 316 SVRVFDLRSLAHSTIIYEPPAQMDPSSSAAASNALLRLEPSPHDPNIVATFAADSNKII- 374

Query: 316 DLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPS 375
            + ++   + P          ++   GH SS+N    +P    +  +  ++  V  W  +
Sbjct: 375 -ILDMRNPETP----------VLTLQGHSSSLNQIKWHPTERNILLSCADDCQVLYWDLN 423

Query: 376 SKL 378
           S L
Sbjct: 424 SSL 426

>ZYRO0F05808g Chr6 complement(479060..482908) [3849 bp, 1282 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1282

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 51/217 (23%), Positives = 98/217 (45%), Gaps = 19/217 (8%)

Query: 120 DDNLIATISGVGTIYLYN-RANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSN 178
           D+ +IA     G++ L++  A+ ++S   + FQ H        FN  +   L +G     
Sbjct: 73  DNKIIAGALDNGSVELFSYNADSLKSE--AKFQRHKTTAKVARFNAKQFNVLATGGTKGE 130

Query: 179 IVLWDVTGKSQEP----ILTFTDRHSDI--VNDCKWHNFDQNIFGSVSEDSTLQLHDQRI 232
           I +WDV    + P     LT  +  + +  +    W+    ++F S    S   + D + 
Sbjct: 131 IFIWDVNKCLENPNDYTPLTPGNSMTPVEEITSLAWNQSLAHVFASAGSTSYASIWDLKA 190

Query: 233 RDAAVE------KVQAKKPYNTLAF-SAHSTNLFAAAGTDS--MVYLYDRRRASKPLHMM 283
           +   +           K P + + +   +ST +  A G+D+   + ++D R A+ PL ++
Sbjct: 191 KKEVIHLSYTSPNTGLKAPLSVVEWHPKNSTRVATATGSDNDPSILVWDLRNANTPLQVL 250

Query: 284 P-GHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
             GH   V SL++  Q++ +L+S+G D   +LW+  E
Sbjct: 251 SQGHSKGVLSLDWCNQDENLLLSSGRDNTVVLWNPQE 287

>TDEL0C02360 Chr3 (412482..416276) [3795 bp, 1264 aa] {ON} Anc_7.310
           YDL195W
          Length = 1264

 Score = 57.4 bits (137), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/214 (23%), Positives = 90/214 (42%), Gaps = 19/214 (8%)

Query: 120 DDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNI 179
           DD +IA     G + L++   +      + FQ H      + FN  +   L SG     I
Sbjct: 73  DDKIIAGALDSGVVELFSSTGDSLKSE-ARFQQHQGAAKTVKFNSKQNNVLASGGSKGEI 131

Query: 180 VLWDVTG--KSQEPILTFTDRHSDI----VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIR 233
            +WD+    K+ E     T   +      V    W+    ++F S    S   + D + +
Sbjct: 132 YIWDLNTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGSTSYASIWDLKAK 191

Query: 234 DAAVEKVQAKKPYNTLA--------FSAHSTNLFAAAGTDS--MVYLYDRRRASKPLHMM 283
              +    A  P   L            +ST +  A G+D+  ++ ++D R A+ PL ++
Sbjct: 192 KEVIHLSYAS-PSTGLKSQLSVVEWHPKNSTRVATATGSDTEPLILVWDLRNANTPLQVL 250

Query: 284 -PGHEDAVTSLEFHPQEDGVLISAGSDRRTILWD 316
             GH   + SL++  Q++ +L+S+G D   +LW+
Sbjct: 251 SKGHSKGILSLDWCSQDEELLLSSGRDNTIVLWN 284

 Score = 36.2 bits (82), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 56/126 (44%), Gaps = 15/126 (11%)

Query: 204 NDCKWHNFDQNIFGSVSEDSTLQLH----DQRIRDAAVEKVQAKKPYNTLAFSAHSTNLF 259
           ND  W N D+ I G++ +   ++L     D    +A  ++ Q      T+ F++   N+ 
Sbjct: 66  NDLDWSNDDKIIAGAL-DSGVVELFSSTGDSLKSEARFQQHQGAA--KTVKFNSKQNNVL 122

Query: 260 AAAGTDSMVYLYDRRRASKPLH----MMPGHE----DAVTSLEFHPQEDGVLISAGSDRR 311
           A+ G+   +Y++D     K       + PG      + VTSL ++     V  SAGS   
Sbjct: 123 ASGGSKGEIYIWDLNTCLKNSEGYTPLTPGVASTPIEEVTSLAWNQSLAHVFASAGSTSY 182

Query: 312 TILWDL 317
             +WDL
Sbjct: 183 ASIWDL 188

>TPHA0P01490 Chr16 complement(302996..304375) [1380 bp, 459 aa] {ON}
           Anc_3.25 YNL317W
          Length = 459

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 113/270 (41%), Gaps = 30/270 (11%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYL----YNRANEVESGLLSTFQFHNENGYGLSF 162
           H+  VT   Y    D +I+     GTI +    +N   E++         H E    ++F
Sbjct: 127 HDTSVTAMEYSHAGDWMISG-DADGTIKIWQPNFNMVKELDKA-------HTECIRDIAF 178

Query: 163 NPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSED 222
           + N+  K ++ SDD+ + +W+ +   QE   T +  H D V  C WH  +  +  S S+D
Sbjct: 179 SKND-SKFVTCSDDNILKIWNFSNGKQE--RTLSGHHWD-VKSCDWHP-EMGLIVSASKD 233

Query: 223 STLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHM 282
           + ++L D R        +  K       F     NL AA   D    ++D R   K L +
Sbjct: 234 NLIKLWDPRSGQCVSTLLNFKHTVLKTKFQPTKGNLLAAISKDKSCRVFDIRYHMKELTV 293

Query: 283 MPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAG 342
           +    D +T L +HP  + +   A  D     +D+ +   E          P+ ++ +A 
Sbjct: 294 IRDEVDYMT-LLWHPTNESMFTIASYDGAIKHFDILQNLEE----------PQQVIPYA- 341

Query: 343 HRSSINDFSMNPNIPWLTATAEEENIVQVW 372
           H   I   S NP +  + A+A ++  ++ W
Sbjct: 342 HDKCITSLSYNP-VGHILASAAKDRTIRFW 370

>ZYRO0G10472g Chr7 complement(844939..846621) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003C CDH1 CDC20 homolog 1 protein required for Clb2
           and Ase1 degradation
          Length = 560

 Score = 56.6 bits (135), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/173 (28%), Positives = 82/173 (47%), Gaps = 14/173 (8%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           L  G  +  + ++DV  K  + I T +  H D V    W+N+   +  S S D  +   D
Sbjct: 311 LAVGQGNGLVEIYDVVKK--KCIRTLSG-HMDRVACLSWNNY---VLTSGSRDRRILHRD 364

Query: 230 QRIRDAAVEKVQA-KKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHED 288
            RI D+  E+++A  +    L ++    N  A+ G D+M+++YD   A  P+     H  
Sbjct: 365 VRIPDSYFERIEAHTQEVCGLKWNVDD-NKLASGGNDNMLFVYD-STARNPVLTFNEHTA 422

Query: 289 AVTSLEFHPQEDGVLISAG--SDRRTILWDLAEIGAEQVPDDADDGSPEVMMI 339
           AV ++ + P + GVL S G  +DRR  +W+   +   Q   D D GS    M+
Sbjct: 423 AVKAMAWSPHKRGVLGSGGGTADRRLKVWN---VNTSQKISDVDTGSQVCNMV 472

>Kpol_297.7 s297 (10035..10568,10902..11324) [957 bp, 318 aa] {ON}
           (10035..10568,10902..11324) [957 nt, 319 aa]
          Length = 318

 Score = 55.8 bits (133), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 103/251 (41%), Gaps = 46/251 (18%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +  +   LLS S D  ++ W +TG  Q+   P+ +F   HS I
Sbjct: 8   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGNDQQYGVPVRSFKG-HSHI 66

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V DC     D     S S D TL+L +          V   + Y    F+ H +++ + A
Sbjct: 67  VQDCA-LTADGAYALSASWDKTLRLWN----------VATGETYQR--FTGHKSDVMSVA 113

Query: 263 --GTDSMVYLYDRRRASK-------PLHMMPGHEDAVTSLEFHPQEDG-----VLISAGS 308
                SM+    R +  K        L  M GH D V+ +   P E+       LISAG 
Sbjct: 114 IDRKASMIISGSRDKTIKVWTIKGDCLATMLGHNDWVSQVRVAPNENEDDETVRLISAGM 173

Query: 309 DRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENI 368
           D+    W++ +    Q+  D             GH + IN  + +P+   L A+A ++  
Sbjct: 174 DKMVKAWNVNQF---QIEAD-----------FVGHNNYINTITASPDGT-LIASAGKDGD 218

Query: 369 VQVWKPSSKLP 379
           + +W    K P
Sbjct: 219 IMLWNLKEKSP 229

>KLLA0F15598g Chr6 (1439610..1441046) [1437 bp, 478 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011W
          Length = 478

 Score = 56.2 bits (134), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 57/216 (26%), Positives = 99/216 (45%), Gaps = 24/216 (11%)

Query: 111 VTRARYMPQDDNLIATISGVGTIYLYN-------------RANEVESGLLSTFQFHNENG 157
           VT +   PQ +N + +     T+ L++             R N  + G++ TF  H E+ 
Sbjct: 118 VTPSYLSPQRENFMLSCGDDKTVKLWSVNSDDFSNVKDDTRLN-TDEGIIKTF--HGEHA 174

Query: 158 YGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFG 217
           +    +  +K   ++G   + I LWD T +S+ PI   +   +D +N  +++  + +I  
Sbjct: 175 FQSLDHHRQKSNFVTGG--AQIELWD-TNRSK-PISNLS-WGADNINHVRFNQNEVDILA 229

Query: 218 SVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS 277
           S   D+++ L+D R      + VQ  +  N++ ++      F  A  D   Y YD R  S
Sbjct: 230 STGSDNSVVLYDLRTNSPTQKIVQTMRT-NSICWNPVEAFNFVIANEDHNAYYYDMRNMS 288

Query: 278 KPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI 313
           K LH+   H  AV  ++F P  D V+   GS  +TI
Sbjct: 289 KALHVFKDHVSAVMDVDFSPTGDEVV--TGSYDKTI 322

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 82/201 (40%), Gaps = 44/201 (21%)

Query: 122 NLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLS-----FNPNEKGKLLSGSDD 176
           N +AT SG G I  +N +   E   LS+F+ H     GL       +P  +  +LS  DD
Sbjct: 81  NKLATASGDGVIKYWNMSTREE---LSSFKAHYGMVTGLCVTPSYLSPQRENFMLSCGDD 137

Query: 177 SNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAA 236
             + LW V           +D  S++ +D +  N D+ I                     
Sbjct: 138 KTVKLWSVN----------SDDFSNVKDDTRL-NTDEGI--------------------- 165

Query: 237 VEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFH 296
           ++    +  + +L      +N F   G  + + L+D  R SKP+  +    D +  + F+
Sbjct: 166 IKTFHGEHAFQSLDHHRQKSN-FVTGG--AQIELWDTNR-SKPISNLSWGADNINHVRFN 221

Query: 297 PQEDGVLISAGSDRRTILWDL 317
             E  +L S GSD   +L+DL
Sbjct: 222 QNEVDILASTGSDNSVVLYDL 242

>Kpol_1028.41 s1028 (100720..102258) [1539 bp, 512 aa] {ON}
           (100720..102258) [1539 nt, 513 aa]
          Length = 512

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 75/313 (23%), Positives = 122/313 (38%), Gaps = 73/313 (23%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSF---- 162
           H N V    + P D  LIAT S   T+ L+        G     + H +    LS+    
Sbjct: 182 HHNWVLCVSWSP-DGELIATGSMDNTVRLWESKTGKPFG--DALRGHGKWITSLSWEPIH 238

Query: 163 --NPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFT-DRHSDIVNDCKWHNFDQNIFGSV 219
              P E+ +L + S D  I +WD T +    + T T   H+  V+  KW    QN   S 
Sbjct: 239 LVTPGERPRLATSSKDGTIKIWDTTRR----VCTMTLSGHTSSVSCVKWGG--QNFLYSG 292

Query: 220 SEDSTLQLHDQR--------IRDAA------------------------------VEKVQ 241
           S D T+++ D +        +++ A                              + K +
Sbjct: 293 SHDKTVRVWDMKNSGRCINILKNHAHWVNHLSLSTDYALRVGPFDYTGEQPATPEIAKAK 352

Query: 242 AKKPYNTLA-FSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQED 300
           A K Y  +A  +   T L   A  D  ++L+D  R +KP+  M GH+  V  + F P  D
Sbjct: 353 ALKNYEKVAKRNGKETELMVTASDDFTMFLWDPLRTTKPIARMTGHQKLVNHVAFSP--D 410

Query: 301 GV-LISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWL 359
           G  ++SA  D    LW            D+ DG  + +    GH +S+   + + +   L
Sbjct: 411 GRHIVSASFDNSIKLW------------DSRDG--KFITTFRGHVASVYQVAWSSDCR-L 455

Query: 360 TATAEEENIVQVW 372
             +  ++  ++VW
Sbjct: 456 LVSCSKDTTLKVW 468

 Score = 40.4 bits (93), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/182 (19%), Positives = 78/182 (42%), Gaps = 16/182 (8%)

Query: 148 STFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCK 207
           S    H       +F P+   ++++G+ D+   +WD    +Q P+ T T  H+ ++  C 
Sbjct: 134 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDC--DTQTPMATLTGHHNWVL--CV 189

Query: 208 WHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNL--------F 259
             + D  +  + S D+T++L + +      + ++    + T + S    +L         
Sbjct: 190 SWSPDGELIATGSMDNTVRLWESKTGKPFGDALRGHGKWIT-SLSWEPIHLVTPGERPRL 248

Query: 260 AAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
           A +  D  + ++D  R    +  + GH  +V+ +++  Q    L S   D+   +WD+  
Sbjct: 249 ATSSKDGTIKIWDTTRRVCTM-TLSGHTSSVSCVKWGGQN--FLYSGSHDKTVRVWDMKN 305

Query: 320 IG 321
            G
Sbjct: 306 SG 307

>TBLA0B09100 Chr2 complement(2156320..2156742,2157014..2157544) [954
           bp, 317 aa] {ON} Anc_2.431 YMR116C
          Length = 317

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 63/240 (26%), Positives = 105/240 (43%), Gaps = 28/240 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +  +   LLS S D  ++ W +TG  Q+   P+ +F   HS I
Sbjct: 7   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQQYGVPVRSFKG-HSHI 65

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V DC     D     S S D T++L D    +     V  K    ++A    ++ + + +
Sbjct: 66  VQDCA-LTADGAYALSASWDKTIRLWDVSTGETFQRFVGHKGDVMSVAIDRKASMIISGS 124

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEF----HPQEDGV-LISAGSDRRTILWDL 317
             D  + ++  +   + L  M GH D V+ +       P++D V +ISAGSD+    W++
Sbjct: 125 -RDKTIKVWSIK--GECLATMLGHNDWVSQVRVAPNDKPEDDTVTVISAGSDKVVKSWNV 181

Query: 318 AEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSK 377
                 Q   DAD           GH + IN    +P+   L A+A ++  + +W  + K
Sbjct: 182 -----NQFQIDAD---------FIGHNNYINAIVASPDGS-LIASAGKDGEIMMWDLAQK 226

>TBLA0F04130 Chr6 complement(1021035..1022579) [1545 bp, 514 aa]
           {ON} Anc_6.340 YCR072C
          Length = 514

 Score = 56.2 bits (134), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 72/317 (22%), Positives = 124/317 (39%), Gaps = 71/317 (22%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNP-- 164
           H N V    + P D  +IAT S   TI L+N  N    G   + + H++    L++ P  
Sbjct: 184 HSNWVLCVAWSP-DAEVIATGSMDNTIRLWNGINGKPIG--DSLRGHSKWITSLAWEPLH 240

Query: 165 ----NEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVS 220
                +K +L S S D  I +WD TG+     L     H+  V+  +W    QN+  + S
Sbjct: 241 LVKVGQKPRLASASKDGTIKVWDTTGRV---CLYTLSGHTSSVSCVRWGG--QNMLYTGS 295

Query: 221 EDSTLQLHDQRIRDAAVEKVQAKKPY-NTLAFS--------------------------- 252
            D T+++ D       +  +++   + N L+ S                           
Sbjct: 296 HDKTIRVWDMNSNGRCINILKSHAHWVNHLSLSTDYALRIGPFDHSGAKPAIAEEARDKA 355

Query: 253 -----------AHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDG 301
                       H+  L   A  D  ++L++  +++KPL  M GH+  V  + F P  DG
Sbjct: 356 LKNYEKIVKKNGHTEELMVTASDDFTMFLWNPLKSTKPLARMTGHQKLVNHVAFSP--DG 413

Query: 302 V-LISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLT 360
             ++SA  D    LW            D  DG  + +    GH +S+   + + +   L 
Sbjct: 414 RHIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQVAWSSDCR-LL 458

Query: 361 ATAEEENIVQVWKPSSK 377
            +  ++  ++VW   +K
Sbjct: 459 VSCSKDTTLKVWDVRTK 475

 Score = 39.3 bits (90), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 44/194 (22%), Positives = 79/194 (40%), Gaps = 40/194 (20%)

Query: 148 STFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCK 207
           S    H       +F PN   ++++G+ D+   LWD    +Q P+ T +  HS+ V    
Sbjct: 136 SAIAGHGSTILCSAFAPNSSSRMVTGAGDNTARLWDC--DTQTPMATLSG-HSNWVLCVA 192

Query: 208 WHNFDQNIFGSVSEDSTLQL---------------HDQRIRDAAVEKVQ----AKKPYNT 248
           W + D  +  + S D+T++L               H + I   A E +      +KP   
Sbjct: 193 W-SPDAEVIATGSMDNTIRLWNGINGKPIGDSLRGHSKWITSLAWEPLHLVKVGQKPR-- 249

Query: 249 LAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGS 308
                      A+A  D  + ++D       L+ + GH  +V+ + +  Q    ++  GS
Sbjct: 250 ----------LASASKDGTIKVWD-TTGRVCLYTLSGHTSSVSCVRWGGQN---MLYTGS 295

Query: 309 DRRTI-LWDLAEIG 321
             +TI +WD+   G
Sbjct: 296 HDKTIRVWDMNSNG 309

>KNAG0A01230 Chr1 complement(17341..21306) [3966 bp, 1321 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1321

 Score = 56.2 bits (134), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 46/196 (23%), Positives = 79/196 (40%), Gaps = 26/196 (13%)

Query: 122 NLIATISGVGTIYLY--NRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNI 179
           N +A  +   T+ L+  NRAN+ +S L+S+   H  +     FN  +   L+SG  D  +
Sbjct: 205 NYVAVCTNSTTVSLFDINRANQTDSALVSSLAEHTRSVNSFDFNMMQTNLLISGGQDGCV 264

Query: 180 VLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEK 239
            +WD+           T+  + IVN C         FGS+ +   +  ++    D     
Sbjct: 265 KIWDIR----------TNNPTKIVNTCDVR--INTTFGSIRDIKWMPGYNFSGNDR---- 308

Query: 240 VQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQE 299
                  N     +H    FA+      +  +D R+ ++P   +  H      L +HP +
Sbjct: 309 -------NYTDLRSHGGYKFASIHDSGALLKFDMRQPNQPEKRINAHTGPGLCLNWHPHQ 361

Query: 300 DGVLISAGSDRRTILW 315
           D  + S G D +  LW
Sbjct: 362 D-YIASGGRDGKCCLW 376

>Kpol_1014.19 s1014 complement(30466..31824) [1359 bp, 452 aa] {ON}
           complement(30466..31824) [1359 nt, 453 aa]
          Length = 452

 Score = 55.8 bits (133), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 120/262 (45%), Gaps = 17/262 (6%)

Query: 93  EVLKSNVKIIKKFE-HENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQ 151
           ++ + N  ++K+ +    E  R     ++D+   T +    + ++N +N  +  +LS   
Sbjct: 149 KIWQPNFNMVKEIDGAHTEGIRDIAFSKNDSKFVTCADDNVLKIWNFSNGQQERVLSG-- 206

Query: 152 FHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDIVNDCKWHN 210
            H+ +     ++P E G ++S S D+ I LWD  +G+    +L F  +H+  V   ++  
Sbjct: 207 -HHWDVKSCDWHP-EMGLIVSASKDNLIRLWDPRSGQCISSLLNF--KHT--VLKTRFQP 260

Query: 211 FDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTN--LFAAAGTDSMV 268
              N+  ++S+D + ++ D  IR +  E +  +   + +    H TN  +F  A  D  +
Sbjct: 261 TKGNLLTAISKDKSCRVFD--IRHSMRELMVYRDEVDYMTLEWHPTNETMFTVASYDGSL 318

Query: 269 YLYD-RRRASKPLHMMP-GHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVP 326
             +D  +   KP H++P  H+  +TSL ++P    +L SA  DR    W  A        
Sbjct: 319 KHFDILQDLEKPTHVVPYAHDKCITSLSYNPVGH-ILASAAKDRTIRFWTRARPVDPNAY 377

Query: 327 DDADDGSPEVMMIHAGHRSSIN 348
           DD    + ++   + G  + IN
Sbjct: 378 DDPTYNNKKINGWYFGINNCIN 399

>KAFR0L01390 Chr12 (257344..260964) [3621 bp, 1206 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1206

 Score = 56.2 bits (134), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 105/247 (42%), Gaps = 25/247 (10%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           +L+ F+  +    G++F+P+ +  +L     S I LWD    +   +L   + H   V  
Sbjct: 3   MLTKFESKSTRVKGIAFHPS-RPLVLVALFSSTIQLWDYRMGT---LLHRFEGHDGPVRG 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q IF S  +D+T+++      +  +        Y    F  H      +A  D
Sbjct: 59  IDFHP-TQPIFASTGDDATIRIWSLDT-NKCLYTFTGHLDYVRTVFFHHELPWLISASDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEI----- 320
             + +++ +   K +  + GH   V   +FHP ED +++SA  D    +WD++ +     
Sbjct: 117 QTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPTED-LVVSASLDETVRVWDISGLRKKHS 174

Query: 321 --GAEQVPD---------DADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIV 369
             GA  + D         D   G   V  I  GH   +N  S +P +P + +  ++   V
Sbjct: 175 APGAMSMEDQMIAQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGGDDRQ-V 233

Query: 370 QVWKPSS 376
           ++W+ SS
Sbjct: 234 KLWRMSS 240

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/239 (25%), Positives = 97/239 (40%), Gaps = 41/239 (17%)

Query: 132 TIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEP 191
           TI ++N  N  E   L+    HN       F+P E   ++S S D  + +WD++G     
Sbjct: 118 TIRIWNWQNRKEIACLTG---HNHFVMCAQFHPTED-LVVSASLDETVRVWDISG----- 168

Query: 192 ILTFTDRHSDIVNDCKWHNFDQNIFGSVS-EDSTL---QLHDQRIRDAAVEKVQAKKPYN 247
                 +HS                G++S ED  +    L D    D  V+ +       
Sbjct: 169 ---LRKKHSAP--------------GAMSMEDQMIAQQNLLDGGFGDCVVKFILEGHTRG 211

Query: 248 TLAFSAHST-NLFAAAGTDSMVYLYDRRRASKPLHM--MPGHEDAVTSLEFHPQEDGVLI 304
               S H T  L  + G D  V L+ R  ++K   +    GH + V  + FHPQ++ ++I
Sbjct: 212 VNWASFHPTLPLIVSGGDDRQVKLW-RMSSTKAWEIDSCRGHTNNVDCVIFHPQQN-LII 269

Query: 305 SAGSDRRTILWDL-AEIGAEQVPDDADD-----GSPEVMMIHAGHRSSINDFSMNPNIP 357
           SAG D+   +WDL   +  +Q   + D        P + +  A H S I  F ++   P
Sbjct: 270 SAGEDKTLRVWDLDKRVPVKQFKRENDRFWLVAAHPTINLFGAAHDSGIMIFKLDRERP 328

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 8/115 (6%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           ++SG DD  + LW ++      I +     +++  DC   +  QN+  S  ED TL++ D
Sbjct: 224 IVSGGDDRQVKLWRMSSTKAWEIDSCRGHTNNV--DCVIFHPQQNLIISAGEDKTLRVWD 281

Query: 230 QRIRDAAVEKVQAKKPYNTL-AFSAHST-NLFAAA-GTDSMVYLYDRRRASKPLH 281
               D  V   Q K+  +     +AH T NLF AA  +  M++  DR R    +H
Sbjct: 282 ---LDKRVPVKQFKRENDRFWLVAAHPTINLFGAAHDSGIMIFKLDRERPCSVIH 333

>KNAG0A01250 Chr1 (23559..24917) [1359 bp, 452 aa] {ON} Anc_3.25
           YNL317W
          Length = 452

 Score = 55.5 bits (132), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 60/261 (22%), Positives = 99/261 (37%), Gaps = 61/261 (23%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYL---YNRANEVESGLLSTFQFHNENGYGLSFN 163
           H++ +T  +Y    D LI+  +  G       +N   E++         H E    ++F+
Sbjct: 123 HDSSITTMQYSHMGDWLISGDADGGIKIWQPNFNMVKELDGA-------HTECIRDVAFS 175

Query: 164 PNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDS 223
            N+  K +S SDD+ + +W+ T   QE +LT    H D V  C WH     +  S S+D+
Sbjct: 176 ANDS-KFVSCSDDNILKIWNFTNGQQERVLT--GHHWD-VKSCDWHP-TMGLIASASKDN 230

Query: 224 TLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRR-------- 275
            ++L D R  +     ++ K       F     NL      D    ++D R+        
Sbjct: 231 LVKLWDPRTGNCVSTILKFKHTVLKTRFQPGGGNLLLGISKDKSCRVFDIRQNMTELMVF 290

Query: 276 ------------------------------------ASKPLHMMP-GHEDAVTSLEFHPQ 298
                                                +KP+H++P  H+  VTSL ++P 
Sbjct: 291 RDDVDYMTLLWHPINHSTFTVGNYDGSIKHFDVLQDITKPVHVIPFAHDKCVTSLSYNPA 350

Query: 299 EDGVLISAGSDRRTILWDLAE 319
            + +L SA  DR    W  A 
Sbjct: 351 GN-ILASASKDRTIRFWTRAR 370

>Kwal_56.23685 s56 complement(656691..659999) [3309 bp, 1102 aa]
           {ON} YDR128W - Hypothetical ORF [contig 174] FULL
          Length = 1102

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/140 (24%), Positives = 70/140 (50%), Gaps = 2/140 (1%)

Query: 180 VLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRI-RDAAVE 238
           +LW+++  S + I      HS  + D  +H     I  + S D+ +   D R  R A   
Sbjct: 94  LLWNLSRNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDMRSPRRAYYS 153

Query: 239 KVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQ 298
                   + + ++  ++N+ A+A ++  VY++D R+   PLH++ GH ++V S++F   
Sbjct: 154 ASVWSAGASQVKWNYKNSNVMASAHSND-VYIWDLRKGCTPLHVLQGHVNSVNSIDFSKF 212

Query: 299 EDGVLISAGSDRRTILWDLA 318
           ++  ++S+ +D     WD +
Sbjct: 213 DETEIMSSSNDGTVKFWDYS 232

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 42/97 (43%), Gaps = 12/97 (12%)

Query: 276 ASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPE 335
           A + LH +   E A      HP +   +IS  S+++ +LW+L+            + S  
Sbjct: 58  APRWLHHITSWEVADVQWSPHPSKPSWVIST-SNQKALLWNLSR-----------NSSDA 105

Query: 336 VMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVW 372
           +  +  GH  +I D + +P  P + AT   +  V  W
Sbjct: 106 IEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAW 142

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 13/60 (21%), Positives = 28/60 (46%)

Query: 258 LFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
           + + +   ++++   R  +    H++ GH  A+T + FHP    +L +   D     WD+
Sbjct: 85  VISTSNQKALLWNLSRNSSDAIEHVLHGHSRAITDINFHPTHPEILATCSIDAYVHAWDM 144

>YDL195W Chr4 (107208..111029) [3822 bp, 1273 aa] {ON}
           SEC31Component of the Sec13p-Sec31p complex of the COPII
           vesicle coat, required for vesicle formation in ER to
           Golgi transport; mutant has increased aneuploidy
           tolerance
          Length = 1273

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/216 (22%), Positives = 100/216 (46%), Gaps = 21/216 (9%)

Query: 120 DDNLIATISGVGTIYLYNRANEVESGL--LSTFQFHNENGYGLSFNPNEKGKLLSGSDDS 177
           ++ +IA     G++ LY+  NE  + +  ++ F  H+ +   + FN  +   L SG ++ 
Sbjct: 73  NNKIIAGALDNGSLELYS-TNEANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNG 131

Query: 178 NIVLWDVTGKSQEPI----LTFTDRHSDI--VNDCKWHNFDQNIFGSVSEDSTLQLHDQR 231
            I +WD+   ++ P     LT     S +  V    W+    ++F S    +   + D +
Sbjct: 132 EIFIWDMNKCTESPSNYTPLTPGQSMSSVDEVISLAWNQSLAHVFASAGSSNFASIWDLK 191

Query: 232 IRDAAVEKVQAKKPYNTLA--------FSAHSTNLFAAAGTDS--MVYLYDRRRASKPLH 281
            +   +  +    P + +            +ST +  A G+D+   + ++D R A+ PL 
Sbjct: 192 AKKEVIH-LSYTSPNSGIKQQLSVVEWHPKNSTRVATATGSDNDPSILIWDLRNANTPLQ 250

Query: 282 MM-PGHEDAVTSLEFHPQEDGVLISAGSDRRTILWD 316
            +  GH+  + SL++  Q++ +L+S+G D   +LW+
Sbjct: 251 TLNQGHQKGILSLDWCHQDEHLLLSSGRDNTVLLWN 286

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 37/157 (23%), Positives = 73/157 (46%), Gaps = 16/157 (10%)

Query: 174 SDDSNIVLWDV-TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRI 232
           S DS++ LW +    S++PI +   +     ND  W + ++ I G++ ++ +L+L+    
Sbjct: 37  STDSSLELWSLLAADSEKPIASL--QVDSKFNDLDWSHNNKIIAGAL-DNGSLELYSTNE 93

Query: 233 RDAAVEKVQA----KKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKP----LHMMP 284
            + A+  +           T+ F+A   N+ A+ G +  ++++D  + ++       + P
Sbjct: 94  ANNAINSMARFSNHSSSVKTVKFNAKQDNVLASGGNNGEIFIWDMNKCTESPSNYTPLTP 153

Query: 285 GHE----DAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
           G      D V SL ++     V  SAGS     +WDL
Sbjct: 154 GQSMSSVDEVISLAWNQSLAHVFASAGSSNFASIWDL 190

>KLTH0D04466g Chr4 (413024..413560,413816..414238) [960 bp, 319 aa]
           {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 319

 Score = 54.7 bits (130), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 59/240 (24%), Positives = 104/240 (43%), Gaps = 28/240 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +P +   LLSGS D +++ W +TG  Q+   P+ +F   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRG-HSHI 67

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V DC     D     S S D T++L +          V  K    ++     ++ + +A+
Sbjct: 68  VQDCT-VTPDGEYALSASWDKTVRLWELASGKCIQRFVGHKSDVLSVTIDRRASQIVSAS 126

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQ-----EDGVLISAGSDRRTILWDL 317
             D  V +++     + +  + GH D V+ +   P      E   +ISAG D+   +W+L
Sbjct: 127 -RDKTVKVWN--TLGECMVTLLGHNDWVSQVRVAPNETPEDETVTVISAGMDKVVKVWNL 183

Query: 318 AEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSK 377
                 Q+  D             GH + +N  + +P+   L A+A ++  + +W  + K
Sbjct: 184 HSF---QIEAD-----------FIGHNNYVNTVTASPDGT-LVASAGKDGQIMLWNLTEK 228

>TBLA0B08730 Chr2 complement(2077729..2079114) [1386 bp, 461 aa]
           {ON} Anc_3.25 YNL317W
          Length = 461

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 67/276 (24%), Positives = 109/276 (39%), Gaps = 30/276 (10%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYL----YNRANEVESGLLSTFQFHNENGYGLSF 162
           H+  ++   Y    D LI+  S  GTI +    +N   E+++        H E    +SF
Sbjct: 124 HDTAISTMVYSHAGDWLISGDSS-GTIKIWQPNFNMVKEIDNS-------HTECLRDISF 175

Query: 163 NPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSED 222
           + N   K ++ SDD+ + +W+ +   QE IL  T  H D V  C WH  +  +  S S+D
Sbjct: 176 S-NTDSKFVTCSDDNILKIWNFSNGKQERIL--TGHHWD-VKSCDWHP-EMGLIVSGSKD 230

Query: 223 STLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHM 282
           + ++  D R        +  K       F     N       D    ++D R  +K L  
Sbjct: 231 NLVKFWDPRSGQCVSTILNFKHTVLRTRFQPTRGNYLLGISKDKSCRVFDIRNHTKELLT 290

Query: 283 MPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAG 342
           +    D +T L +HP  + V   A  D     +D+ E           D    +  I   
Sbjct: 291 VRDEVDFMT-LSWHPINESVFTLANYDGSIKHFDILE-----------DLEKPIHTIPFA 338

Query: 343 HRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSKL 378
           H   I   S NP I  + A+A ++  ++ W  S  +
Sbjct: 339 HEKCITAMSYNP-IGHILASASKDRTIRFWTRSKPI 373

>Kpol_1019.30 s1019 (56367..60125) [3759 bp, 1252 aa] {ON}
           (56367..60125) [3759 nt, 1253 aa]
          Length = 1252

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/222 (24%), Positives = 102/222 (45%), Gaps = 31/222 (13%)

Query: 121 DNL-IATISGVGTIYLYNRANEVES----GLLSTFQFHNENGYGLSFNPNEKGKLLSGSD 175
           DN+ IA     G I L+N  N+ ++    G LS    H  +   L FN  +   L+SGSD
Sbjct: 73  DNINIAGALDNGNIELFNFDNKSQTIKSLGNLSDSNKHKGSVKTLKFNTKQSNLLVSGSD 132

Query: 176 -DSNIVLWDVTGKSQEPI-----LTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
            +  I++WD+    + P+     +T T+     +    W+    ++F   S  S + + D
Sbjct: 133 KNGEILIWDLNNLDKTPLTPGMPMTPTNE----ITSLAWNKSLSHVFSCSSNTSNVSIFD 188

Query: 230 QRIRDAAVEKVQAKKPYNTLA--FSA------HSTNLFAAA-GTDSM----VYLYDRRRA 276
            + +   +  +    P N +   FS       +ST +  A    DS     ++++D R +
Sbjct: 189 LKAKKEVIH-LNYTNPVNNVKSLFSVVEWHPKNSTRIATATLNNDSTESDSIFIWDLRNS 247

Query: 277 SKPLHMMP--GHEDAVTSLEFHPQEDGVLISAGSDRRTILWD 316
             PL ++   GH + + SL++   ++ +L+S+G D   +LW+
Sbjct: 248 HTPLQILSKDGHSNGILSLDWCSTDENLLLSSGRDNSVMLWN 289

>NDAI0H02710 Chr8 complement(668900..669322,669678..670211) [957 bp,
           318 aa] {ON} Anc_2.431 YMR116C
          Length = 318

 Score = 53.9 bits (128), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 57/234 (24%), Positives = 101/234 (43%), Gaps = 27/234 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +  +   LLS S D  ++ W +TG  Q+   P+ +F   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLLSASRDKTLISWKLTGDDQKFGVPVRSFKG-HSHI 67

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V DC     D     S S D TL+L D    +     V  K    ++A    ++ + + +
Sbjct: 68  VQDCTLTQ-DGAYALSASWDKTLRLWDVATGETYQRFVGHKSDVMSVAIDRKASMIISGS 126

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDG----VLISAGSDRRTILWDLA 318
             D  + ++  +   + L  + GH D V+ +   P +       +ISAG+D+    W+L 
Sbjct: 127 -RDKTIKVWTIK--GQCLATLLGHNDWVSQVRIAPTDQNDDTVTVISAGNDKMVKAWNLN 183

Query: 319 EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVW 372
           +    Q+  D             GH  ++N  + +P+   L A+A ++  + +W
Sbjct: 184 QF---QIEAD-----------FVGHNGNVNAVTASPDGS-LIASAGKDGEIMLW 222

>TDEL0C02240 Chr3 complement(388060..391665) [3606 bp, 1201 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1201

 Score = 54.7 bits (130), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 58/247 (23%), Positives = 104/247 (42%), Gaps = 25/247 (10%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           +L+ F+  +    G++F+P+ +  +L     S I LWD    +   +L   + H   V  
Sbjct: 3   MLTKFESKSTRAKGIAFHPS-RPWVLVALFSSTIQLWDYRMGT---LLHRFEDHEGPVRG 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q IF S  +D ++++      +  +  +     Y    F         +A  D
Sbjct: 59  IDFHP-TQPIFVSAGDDYSIKVWSLET-NKCLYTLNGHLDYVRTVFFHRELPWIISASDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEI----- 320
             + +++ +   K L  + GH   V   +FHP ED +++SA  D    +WD+A +     
Sbjct: 117 QTIRIWNWQN-RKELACLTGHNHFVMCAQFHPTED-LVVSASLDETIRVWDIAGLRKRHS 174

Query: 321 --GAEQVPD---------DADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIV 369
             GA    D         DA  G   V  I  GH   +N  S +P +P + +  ++   V
Sbjct: 175 APGASSFEDQMASQQNLLDAGFGDCVVKFILEGHTRGVNWASFHPTLPLIVSGGDDRQ-V 233

Query: 370 QVWKPSS 376
           ++W+ SS
Sbjct: 234 KLWRMSS 240

 Score = 39.3 bits (90), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 65/317 (20%), Positives = 125/317 (39%), Gaps = 66/317 (20%)

Query: 99  VKIIKKFEHENEVTRARYMPQDDN----LIATISGVGTIYLYNRANEVESGLLSTFQFHN 154
           +K++ KFE ++  TRA+ +    +    L+A  S    ++ Y         LL  F+ H 
Sbjct: 1   MKMLTKFESKS--TRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGT-----LLHRFEDHE 53

Query: 155 ENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQN 214
               G+ F+P +    +S  DD +I +W +        L   + H D V    +H     
Sbjct: 54  GPVRGIDFHPTQP-IFVSAGDDYSIKVWSL---ETNKCLYTLNGHLDYVRTVFFHRELPW 109

Query: 215 IFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAH---STNLFAAAGTDSMVYLY 271
           I  S S+D T+++ + + R    +++     +N     A    + +L  +A  D  + ++
Sbjct: 110 II-SASDDQTIRIWNWQNR----KELACLTGHNHFVMCAQFHPTEDLVVSASLDETIRVW 164

Query: 272 D----RRRASKP-------------------------LHMMPGHEDAVTSLEFHPQEDGV 302
           D    R+R S P                           ++ GH   V    FHP    +
Sbjct: 165 DIAGLRKRHSAPGASSFEDQMASQQNLLDAGFGDCVVKFILEGHTRGVNWASFHPTLP-L 223

Query: 303 LISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTAT 362
           ++S G DR+  LW ++   A +V                GH ++++    +P+   + + 
Sbjct: 224 IVSGGDDRQVKLWRMSSTKAWEVD------------TCRGHTNNVDSVIFHPHQNLIISV 271

Query: 363 AEEENIVQVWKPSSKLP 379
            E++ + +VW    + P
Sbjct: 272 GEDKTL-RVWDLDKRTP 287

 Score = 37.0 bits (84), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 52/113 (46%), Gaps = 4/113 (3%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           ++SG DD  + LW ++      + T    H++ V+   +H   QN+  SV ED TL++ D
Sbjct: 224 IVSGGDDRQVKLWRMSSTKAWEVDT-CRGHTNNVDSVIFHP-HQNLIISVGEDKTLRVWD 281

Query: 230 QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA-GTDSMVYLYDRRRASKPLH 281
              R    +  +    +  +A   H  NLF AA  +  MV+  DR R     H
Sbjct: 282 LDKRTPVKQFKRENDRFWLIAAHPH-INLFGAAHDSGIMVFKLDRERPCSVTH 333

>Skud_10.102 Chr10 (173179..175305) [2127 bp, 708 aa] {ON} YJL112W
           (REAL)
          Length = 708

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/181 (27%), Positives = 81/181 (44%), Gaps = 36/181 (19%)

Query: 139 ANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDV-TGKSQEPI-LTFT 196
           A++++S  + TF+ H +    LS +PN    L+SGS D  I  WD+ +GK  + I L+F 
Sbjct: 481 ASQIDSPCVFTFEAHIDEVTALSLDPNF---LVSGSQDRTIRQWDLCSGKCMQTIDLSFA 537

Query: 197 DRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHST 256
           +  +   N              +S+ + L    +R    A++   A              
Sbjct: 538 NVLTTATN------------VDLSKSTLLTQRSERPTIGALQSFDAA------------- 572

Query: 257 NLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWD 316
              A    D +V L+D  R+ K +  + GH DA+TSL+F   +   L++   DR   +WD
Sbjct: 573 --LATGTKDGIVRLWD-LRSGKVIRTLEGHTDAITSLKF---DSACLVTGSYDRTVRVWD 626

Query: 317 L 317
           L
Sbjct: 627 L 627

>Kpol_1003.34 s1003 complement(85833..86999) [1167 bp, 388 aa] {ON}
           complement(85833..86999) [1167 nt, 389 aa]
          Length = 388

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 64/119 (53%), Gaps = 5/119 (4%)

Query: 210 NFDQNIFGSVSEDSTLQLHDQRIR-DAAVEKVQAKKPYNTLAFSAHSTNLFAA---AGTD 265
           ++D     SV+ +  +++ D R++ ++ V ++  +K    L+  +    L      +G D
Sbjct: 68  DYDNGSVFSVAMNDAVKVLDLRVQGNSIVAELNNEKKTPFLSLDSRHGMLACGTELSGVD 127

Query: 266 SMVYLYDRRRASKPLHMM-PGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAE 323
           + +++YD R   KP+ M+   H D VT ++FHP +  VL+S  +D  T ++DL ++  E
Sbjct: 128 AEIHIYDIRNFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNVYDLTQVEEE 186

 Score = 30.4 bits (67), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 2/62 (3%)

Query: 168 GKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQL 227
           G  LSG D + I ++D+     +P+    D H D V D K+H  D N+  S S D    +
Sbjct: 120 GTELSGVD-AEIHIYDIR-NFDKPVRMLVDSHHDDVTDIKFHPSDPNVLLSGSTDGYTNV 177

Query: 228 HD 229
           +D
Sbjct: 178 YD 179

>TPHA0F00770 Chr6 (175091..176986) [1896 bp, 631 aa] {ON} Anc_4.122
           YGL003C
          Length = 631

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 68/144 (47%), Gaps = 11/144 (7%)

Query: 199 HSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQA-KKPYNTLAFSAHSTN 257
           HSD V+   W+N   +I  S S D  +   D R  D+   +++   +    L ++    N
Sbjct: 408 HSDRVSCLSWNN---HILSSGSRDRKILHRDVRSPDSYFTQIETHTQEVCGLKWNIED-N 463

Query: 258 LFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAG--SDRRTILW 315
             A+ G D++VY+YD    SKP  M   H  AV ++ + P   G+L + G  +DRR  +W
Sbjct: 464 RLASGGNDNIVYVYDGVN-SKPTLMFTEHTAAVKAMTWSPHRRGILATGGGTADRRLKIW 522

Query: 316 DLAEIGAEQVPDDADDGSPEVMMI 339
           +   +      +D D GS    MI
Sbjct: 523 N---VNTSAKLNDVDSGSQICNMI 543

>YPL247C Chr16 complement(82625..84196) [1572 bp, 523 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and nucleus; similar to the petunia WD repeat protein
           an11; overexpression causes a cell cycle delay or arrest
          Length = 523

 Score = 53.9 bits (128), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 51/234 (21%), Positives = 99/234 (42%), Gaps = 38/234 (16%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           ++S S D+  ++WD+  +S   + T    H   V D ++      +F S   D ++++ D
Sbjct: 259 IISSSIDTTCIVWDL--QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFD 316

Query: 230 QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYL------------------- 270
             +R  A   +  + P ++++ +   T   ++ G+D+++ L                   
Sbjct: 317 --LRSLAHSTIIYEPPSSSVSGATAGTITPSSKGSDALLRLEPSPYDPNVLATFAADSNK 374

Query: 271 ---YDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL----AEIGAE 323
               D R    P+  + GH  +V  +++HP +  VL+S G D + + WDL     EI A 
Sbjct: 375 IIILDMRNPESPILNLQGHGSSVNGIKWHPTKRNVLLSCGDDCQVLYWDLNSSFMEINAA 434

Query: 324 QVPDDADDGSP------EVMMIHAGHRSSIND--FSMNPNIPWLTATAEEENIV 369
                +  G+       +  M   G  S +N+   S+N N   +  T E  N++
Sbjct: 435 GSKSPSIHGTSLEDPDGDTEMTDGGAGSGLNEDPLSLNNNSKQVCKTLETPNMM 488

 Score = 33.9 bits (76), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 35/73 (47%), Gaps = 1/73 (1%)

Query: 118 PQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDS 177
           P D N++AT +      +       ES +L+  Q H  +  G+ ++P ++  LLS  DD 
Sbjct: 359 PYDPNVLATFAADSNKIIILDMRNPESPILN-LQGHGSSVNGIKWHPTKRNVLLSCGDDC 417

Query: 178 NIVLWDVTGKSQE 190
            ++ WD+     E
Sbjct: 418 QVLYWDLNSSFME 430

>CAGL0A00605g Chr1 complement(67281..69203) [1923 bp, 640 aa] {ON}
           similar to uniprot|P53197 Saccharomyces cerevisiae
           YGL003c CDH1 substrate-specific activator of
           APC-dependent proteolysis
          Length = 640

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 82/173 (47%), Gaps = 14/173 (8%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           L  G  +  + ++DVT   +E  +     H D V    W+N   +I  S S D T+   D
Sbjct: 391 LAIGQGNGIVEIYDVT---KEKCIRTLSGHLDRVACLSWNN---HILSSGSRDRTILHRD 444

Query: 230 QRIRDAAVEKVQA-KKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHED 288
            R+ D   EK++  ++    L ++ +  N  A+ G D+MV++YD   +  P   +  H+ 
Sbjct: 445 VRMADPFFEKIETHEQEICGLKWNTND-NKLASGGNDNMVFVYD-GTSRTPFLSINEHKA 502

Query: 289 AVTSLEFHPQEDGVLISAG--SDRRTILWDLAEIGAEQVPDDADDGSPEVMMI 339
           AV ++ + P + G+L + G  +DR   +W+   +      +D D GS    M+
Sbjct: 503 AVKAMAWSPHKQGILATGGGTADRTLKMWN---VNTSVKLNDVDTGSQVCNMV 552

>KLLA0F05159g Chr6 (506007..509702) [3696 bp, 1231 aa] {ON} similar
           to uniprot|P38968 Saccharomyces cerevisiae YDL195W SEC31
           involved in protein transport from endoplasmic reticulum
           to Golgi Component (p150) of COPII coat of secretory
           pathway vesicles
          Length = 1231

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 88/216 (40%), Gaps = 21/216 (9%)

Query: 120 DDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENG--YGLSFNPNEKGKLLSGSDDS 177
           DD +IA     G +  ++        L S  + H   G    L FN  +   L+SG    
Sbjct: 73  DDKIIAGALENGVVEFFD-----PKALKSVAKIHKHQGPVKTLKFNAKQNNVLVSGGTQG 127

Query: 178 NIVLWDVTGKSQEPILTFTDRHS----DIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIR 233
            I +WD           F+   S    D V+   W+    ++F S S      + D + +
Sbjct: 128 EIFVWDSNKIGSSDYSPFSAGISNTPIDEVSSLSWNQSLAHVFASASSSGYASVWDLKAK 187

Query: 234 DAAV------EKVQAKKPYNTLAFSAHSTNLFAAAG---TDSMVYLYDRRRASKPLHMMP 284
              +           K P   + +   S+ + A A    T+ +V  +D R A  PL ++ 
Sbjct: 188 KQVLHLNHSSSTTGIKVPLTVVDWHPTSSTIIATASSSDTEPLVLTWDLRNAHVPLKVLS 247

Query: 285 -GHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
            GH   V SL++  Q++ +L+S+G D  ++LW+  E
Sbjct: 248 QGHSKGVLSLDWCKQDENLLLSSGRDNTSVLWNPQE 283

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 18/65 (27%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 258 LFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
           + A A  + +V  +D + A K +  +  H+  V +L+F+ +++ VL+S G+     +WD 
Sbjct: 76  IIAGALENGVVEFFDPK-ALKSVAKIHKHQGPVKTLKFNAKQNNVLVSGGTQGEIFVWDS 134

Query: 318 AEIGA 322
            +IG+
Sbjct: 135 NKIGS 139

>TPHA0D04500 Chr4 (978756..982382) [3627 bp, 1208 aa] {ON} Anc_7.322
           YDL145C
          Length = 1208

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/251 (22%), Positives = 105/251 (41%), Gaps = 29/251 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           LL+ F+  +    G++F+P+ +  +L     S I LWD    +   +L   + H   V  
Sbjct: 3   LLTKFESKSTRAKGIAFHPS-RPWVLVALFSSTIQLWDYRMGT---LLHRFEDHDGPVRG 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q +F S  +D T+++      +  +  ++    Y    F         +A  D
Sbjct: 59  IDFHP-TQPLFVSAGDDYTIKVWSLET-NKCLYTLEGHLDYVRTVFFHRELPWIISASDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE------ 319
             + +++ +   K +  + GH   V   +FHP ED +++SA  D    +WD+++      
Sbjct: 117 QTIRIWNWQN-RKEIACITGHNHFVMCAQFHPTED-LIVSASLDETVRVWDISKLREKHS 174

Query: 320 --------------IGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEE 365
                         I A+Q   D   G   V  I  GH   +N  S +P +P + +  ++
Sbjct: 175 APGGANIPSTFEEKIAAQQNLLDGGFGDCTVKFILEGHTRGVNWASFHPTLPLIVSGGDD 234

Query: 366 ENIVQVWKPSS 376
              V++WK S+
Sbjct: 235 RQ-VKLWKMSA 244

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 62/267 (23%), Positives = 105/267 (39%), Gaps = 29/267 (10%)

Query: 100 KIIKKFEHENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYG 159
           K +   E   +  R  +  ++   I + S   TI ++N  N  E   ++    HN     
Sbjct: 86  KCLYTLEGHLDYVRTVFFHRELPWIISASDDQTIRIWNWQNRKEIACITG---HNHFVMC 142

Query: 160 LSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSV 219
             F+P E   ++S S D  + +WD++           ++HS          F++ I    
Sbjct: 143 AQFHPTED-LIVSASLDETVRVWDIS--------KLREKHSAPGGANIPSTFEEKI---- 189

Query: 220 SEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHST-NLFAAAGTDSMVYLYDRRRASK 278
              +   L D    D  V+ +           S H T  L  + G D  V L+ +  A+K
Sbjct: 190 --AAQQNLLDGGFGDCTVKFILEGHTRGVNWASFHPTLPLIVSGGDDRQVKLW-KMSATK 246

Query: 279 P--LHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL-AEIGAEQVPDDADD---- 331
              L    GH + V S+ FHP ++ ++IS G D+   +WDL   +  +Q   + D     
Sbjct: 247 AWELDSCRGHTNNVDSVIFHPTQN-LIISVGEDKTLRIWDLDKRVPVKQFKRENDRFWLI 305

Query: 332 -GSPEVMMIHAGHRSSINDFSMNPNIP 357
              P + +  A H S I  F ++   P
Sbjct: 306 AAHPNINLFGAAHDSGIMIFKLDRERP 332

 Score = 33.1 bits (74), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 76/180 (42%), Gaps = 41/180 (22%)

Query: 170 LLSGSDDSNIVLWDVTG-KSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLH 228
           ++SG DD  + LW ++  K+ E  L     H++ V+   +H   QN+  SV ED TL++ 
Sbjct: 228 IVSGGDDRQVKLWKMSATKAWE--LDSCRGHTNNVDSVIFHP-TQNLIISVGEDKTLRIW 284

Query: 229 DQRIRDAAVEKVQAKKPYNTL-AFSAH-STNLFAAA-GTDSMVYLYDRRRAS-------- 277
           D    D  V   Q K+  +     +AH + NLF AA  +  M++  DR R +        
Sbjct: 285 D---LDKRVPVKQFKRENDRFWLIAAHPNINLFGAAHDSGIMIFKLDRERPAFNIYQNNL 341

Query: 278 ------KPLHMMPGHED-----------------AVTSLEFHPQEDGVLISAGSDRRTIL 314
                 K L     +                   A  S+ ++P +  VL++ G D  +++
Sbjct: 342 FYVNNEKQLQTFDYNNKVSSLPYVSLKKLGETWVAFRSISYNPSQHSVLVNQGDDHYSLV 401

>Suva_16.159 Chr16 complement(275378..276733) [1356 bp, 451 aa] {ON}
           YPL151C (REAL)
          Length = 451

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/201 (25%), Positives = 91/201 (45%), Gaps = 33/201 (16%)

Query: 161 SFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVS 220
           + +P +    ++GS+D+ + +WD+     +  LT    H   V D    +    +F SVS
Sbjct: 146 AIDPVDNEWFVTGSNDTTMKVWDLASGKLKVTLT---GHVMTVRDIAVSDRHPYLF-SVS 201

Query: 221 EDSTLQLHDQRIRDAAVEKVQAKKPYN-----TLAFSAHST-NLFAAAGTDSMVYLYDRR 274
           ED T++  D       +EK Q  + Y+         S H T +L A AG DS+V L+D  
Sbjct: 202 EDKTVKCWD-------LEKNQIIRDYHGHLSGVRTVSIHPTLDLIATAGRDSVVKLWD-I 253

Query: 275 RASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSP 334
           R   P+  + GH+  +  +E  P  D  ++S+ +D    LWD+               + 
Sbjct: 254 RTRVPVITLVGHKGPINQVECAPV-DPQIVSSSTDATVRLWDIV--------------AG 298

Query: 335 EVMMIHAGHRSSINDFSMNPN 355
           + M +   H+ S+   +++PN
Sbjct: 299 KAMKVLTHHKRSVRAIALHPN 319

 Score = 34.7 bits (78), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 28/127 (22%), Positives = 57/127 (44%), Gaps = 25/127 (19%)

Query: 259 FAAAGTDSMVYLYD----RRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTIL 314
           F     D+ + ++D    + + +   H+M   + AV+  + HP     L S   D+    
Sbjct: 155 FVTGSNDTTMKVWDLASGKLKVTLTGHVMTVRDIAVS--DRHP----YLFSVSEDKTVKC 208

Query: 315 WDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKP 374
           WDL +               +++  + GH S +   S++P +  L ATA  +++V++W  
Sbjct: 209 WDLEK--------------NQIIRDYHGHLSGVRTVSIHPTLD-LIATAGRDSVVKLWDI 253

Query: 375 SSKLPRI 381
            +++P I
Sbjct: 254 RTRVPVI 260

>ADL186C Chr4 complement(369320..373405) [4086 bp, 1361 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL138C
          Length = 1361

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 84/201 (41%), Gaps = 38/201 (18%)

Query: 122 NLIATISGVGT---IYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSN 178
           N IA I G  T   IY  NRA+  +S L++T   H+ +   + FN  +   L+SG  D  
Sbjct: 197 NYIA-ICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQDGC 255

Query: 179 IVLWDVTG---KSQEPILTFTDRHSDIVNDCKWH-NFDQNIFGSVSEDSTLQLHDQRIRD 234
           I +WD+     K     L F +  SD V D KW   +D   F S+  D++L         
Sbjct: 256 IKVWDLRSHSYKVNRSDLNF-NSGSDSVRDVKWMPTYD---FASLGADTSL--------- 302

Query: 235 AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLE 294
                            S+  +N FA+     ++  +D R+ ++    +  H      + 
Sbjct: 303 ----------------CSSGRSNKFASVHDSGLLLTFDMRQPNQVERKINAHSGPGLCMH 346

Query: 295 FHPQEDGVLISAGSDRRTILW 315
           +HP  D  +IS G D +  LW
Sbjct: 347 WHPHMD-YIISGGRDGKCALW 366

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 34/68 (50%), Gaps = 4/68 (5%)

Query: 254 HSTNLFAAAGTDSMVYLYDRRRASKP----LHMMPGHEDAVTSLEFHPQEDGVLISAGSD 309
           H  N  A  GT + V +YD  RAS      +  +  H  ++ S++F+  +  +LIS G D
Sbjct: 194 HHKNYIAICGTSTSVSIYDINRASAKDSPLITTLSEHSRSINSVDFNMGQTHLLISGGQD 253

Query: 310 RRTILWDL 317
               +WDL
Sbjct: 254 GCIKVWDL 261

>Ecym_7038 Chr7 (80529..82931) [2403 bp, 800 aa] {ON} similar to
           Ashbya gossypii AEL246C
          Length = 800

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 93/236 (39%), Gaps = 28/236 (11%)

Query: 147 LSTFQFHNENGYGLSFNPNEKGKLLS-GSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           +  + FHN N    S   +E  +L++ G  DS+I +W + G   E  L    + +     
Sbjct: 463 VCMYTFHNTNRDMTSLQFSEDSRLVAAGFQDSHIKIWSLDGTPLESKLPSKSKEASNTTT 522

Query: 206 CKWHNF---------DQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHST 256
              H+          D     S SED T++L         V       P   + FS    
Sbjct: 523 LIGHSGPVYSVSFSPDNRYLVSASEDKTVRLWSLDTFTCLVSYKGHNHPVWDVKFSPLG- 581

Query: 257 NLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWD 316
           + FA    D    L+       PL +  GH + V  + FHP    VL +  SD+   +WD
Sbjct: 582 HYFATVSHDQTARLWSCDHI-YPLRIFAGHLNDVDCVAFHPNGTYVL-TGSSDKTCRMWD 639

Query: 317 LAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVW 372
           +      Q  D         + +  GH +S+   +++P+  WLT T  E+ ++ VW
Sbjct: 640 I------QTGDS--------VRLFLGHTASVVSVAVSPDGRWLT-TGSEDGVIIVW 680

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 53/223 (23%), Positives = 90/223 (40%), Gaps = 49/223 (21%)

Query: 143 ESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDI 202
           E+   +T   H+   Y +SF+P+ +  L+S S+D  + LW +   +    L     H+  
Sbjct: 516 EASNTTTLIGHSGPVYSVSFSPDNR-YLVSASEDKTVRLWSLDTFT---CLVSYKGHNHP 571

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQL------HDQRIRDAAVEKVQ--AKKPYNTLA---- 250
           V D K+       F +VS D T +L      +  RI    +  V   A  P  T      
Sbjct: 572 VWDVKFSPLGH-YFATVSHDQTARLWSCDHIYPLRIFAGHLNDVDCVAFHPNGTYVLTGS 630

Query: 251 ------------------FSAHSTNLFAAAGT-----------DSMVYLYDRRRASKPLH 281
                             F  H+ ++ + A +           D ++ ++D     K + 
Sbjct: 631 SDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWLTTGSEDGVIIVWDIG-TGKRIK 689

Query: 282 MMPGH-EDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAE 323
            M GH + AV SL F+ +E  +L+S G+D+   +WDL +   E
Sbjct: 690 QMRGHGKSAVNSLSFN-KEGNILVSGGADQSVRVWDLKKFTNE 731

>Kwal_56.24526 s56 (1036575..1040207) [3633 bp, 1210 aa] {ON}
           YDL145C (COP1) - alpha subunit of the coatamer complex;
           gamma-alpha-COP [contig 161] FULL
          Length = 1210

 Score = 53.9 bits (128), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 104/247 (42%), Gaps = 25/247 (10%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           +L+ F+  +    GL+F+P+ +  +L     S+I LWD    +   +L   + H   V  
Sbjct: 3   MLTKFESKSTRAKGLAFHPS-RPWVLVALFSSSIQLWDYRMGT---LLHKFEDHEGPVRG 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q +F S  +D T+++     +      +     Y    F         +A  D
Sbjct: 59  IDFHP-TQPLFVSAGDDYTIKVWSLDTKKCLF-TLNGHLDYVRTVFFHRELPWIISASDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA------- 318
             + +++ +   K +  + GH   V   +FHP ED +++SA  D    +WD++       
Sbjct: 117 QTIRIWNWQN-RKEIACLTGHNHFVMCADFHPTED-LVVSASLDETVRVWDISGLRKRHS 174

Query: 319 ---------EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIV 369
                    +I A+Q   D   G   V  I  GH   +N  S +P +P + +  ++   V
Sbjct: 175 APSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHSRGVNWASFHPTLPLIVSGGDDRQ-V 233

Query: 370 QVWKPSS 376
           ++W+ SS
Sbjct: 234 KLWRMSS 240

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 70/317 (22%), Positives = 126/317 (39%), Gaps = 66/317 (20%)

Query: 99  VKIIKKFEHENEVTRARYMPQDDN----LIATISGVGTIYLYNRANEVESGLLSTFQFHN 154
           +K++ KFE ++  TRA+ +    +    L+A  S    ++ Y         LL  F+ H 
Sbjct: 1   MKMLTKFESKS--TRAKGLAFHPSRPWVLVALFSSSIQLWDYRMGT-----LLHKFEDHE 53

Query: 155 ENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQN 214
               G+ F+P +    +S  DD  I +W +  K     L   + H D V    +H     
Sbjct: 54  GPVRGIDFHPTQP-LFVSAGDDYTIKVWSLDTKK---CLFTLNGHLDYVRTVFFHRELPW 109

Query: 215 IFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSA--HST-NLFAAAGTDSMVYLY 271
           I  S S+D T+++ + + R    +++     +N     A  H T +L  +A  D  V ++
Sbjct: 110 II-SASDDQTIRIWNWQNR----KEIACLTGHNHFVMCADFHPTEDLVVSASLDETVRVW 164

Query: 272 D----RRRASKP-------------------------LHMMPGHEDAVTSLEFHPQEDGV 302
           D    R+R S P                           ++ GH   V    FHP    +
Sbjct: 165 DISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHSRGVNWASFHPTLP-L 223

Query: 303 LISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTAT 362
           ++S G DR+  LW ++   A +V                GH ++++    +P+   + + 
Sbjct: 224 IVSGGDDRQVKLWRMSSTKAWEVD------------TCRGHTNNVDSVIFHPHQNLIISV 271

Query: 363 AEEENIVQVWKPSSKLP 379
            E++  V+VW    + P
Sbjct: 272 GEDKT-VRVWDLDKRTP 287

>KLTH0H01892g Chr8 complement(167262..170891) [3630 bp, 1209 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
           coatomer complex which surrounds transport vesicles in
           the early secretory pathway
          Length = 1209

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 56/247 (22%), Positives = 105/247 (42%), Gaps = 25/247 (10%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           +L+ F+  +    GL+F+P+ +  +L     S+I LWD    +   +L   + H   V  
Sbjct: 3   MLTKFESKSTRAKGLAFHPS-RPWVLVALFSSSIQLWDYRMGT---LLHKFEDHEGPVRG 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q +F S  +D T+++     +   +  +     Y    F         +A  D
Sbjct: 59  IDFHP-TQPLFVSAGDDYTIKVWSLDTKKC-LFTLNGHLDYVRTVFFHRELPWIISASDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA------- 318
             + +++ +   K +  + GH   V   +FHP ED +++SA  D    +WD++       
Sbjct: 117 QTIRIWNWQN-RKEIACLTGHNHFVMCADFHPTED-LVVSASLDETVRVWDISGLRKRHS 174

Query: 319 ---------EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIV 369
                    +I A+Q   D   G   V  I  GH   +N  S +P +P + +  ++   V
Sbjct: 175 APSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHARGVNWASFHPTLPLIVSGGDDRQ-V 233

Query: 370 QVWKPSS 376
           ++W+ SS
Sbjct: 234 KLWRMSS 240

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 70/317 (22%), Positives = 126/317 (39%), Gaps = 66/317 (20%)

Query: 99  VKIIKKFEHENEVTRARYMPQDDN----LIATISGVGTIYLYNRANEVESGLLSTFQFHN 154
           +K++ KFE ++  TRA+ +    +    L+A  S    ++ Y         LL  F+ H 
Sbjct: 1   MKMLTKFESKS--TRAKGLAFHPSRPWVLVALFSSSIQLWDYRMGT-----LLHKFEDHE 53

Query: 155 ENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQN 214
               G+ F+P +    +S  DD  I +W +  K     L   + H D V    +H     
Sbjct: 54  GPVRGIDFHPTQP-LFVSAGDDYTIKVWSLDTKK---CLFTLNGHLDYVRTVFFHRELPW 109

Query: 215 IFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSA--HST-NLFAAAGTDSMVYLY 271
           I  S S+D T+++ + + R    +++     +N     A  H T +L  +A  D  V ++
Sbjct: 110 II-SASDDQTIRIWNWQNR----KEIACLTGHNHFVMCADFHPTEDLVVSASLDETVRVW 164

Query: 272 D----RRRASKP-------------------------LHMMPGHEDAVTSLEFHPQEDGV 302
           D    R+R S P                           ++ GH   V    FHP    +
Sbjct: 165 DISGLRKRHSAPSTYTLEDQIAAQQNLLDGGFGDCVVKFILEGHARGVNWASFHPTLP-L 223

Query: 303 LISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTAT 362
           ++S G DR+  LW ++   A +V                GH ++++    +P+   + + 
Sbjct: 224 IVSGGDDRQVKLWRMSSTKAWEVD------------TCRGHTNNVDSVIFHPHQNLIISV 271

Query: 363 AEEENIVQVWKPSSKLP 379
            E++ I +VW    + P
Sbjct: 272 GEDKTI-RVWDLDKRTP 287

>KNAG0I02840 Chr9 (554645..556204) [1560 bp, 519 aa] {ON} Anc_6.340
           YCR072C
          Length = 519

 Score = 53.5 bits (127), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 59/256 (23%), Positives = 109/256 (42%), Gaps = 40/256 (15%)

Query: 124 IATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD 183
           +A+ S  GTI +++ A  V    L T   H+ +   + +    +G L SGS D  + +WD
Sbjct: 253 LASASKDGTIKIWDTARRV---CLYTLSGHSNSVACVKWG--GEGLLYSGSHDKTVRVWD 307

Query: 184 VTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLH-----DQRIRDAAVE 238
           +   +    ++    H+  VN             S+S D  L++        +    A  
Sbjct: 308 MNSATVGKCISILKNHAHWVNHL-----------SLSTDYALRIGPFDHTGVKPSTPAEA 356

Query: 239 KVQAKKPYNTLA-FSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHP 297
           K +A+  Y+ +A  +  +  L   A  D  ++L++ ++ +KPL  M GH+  V  + F P
Sbjct: 357 KRRAQANYDKVAKRNGSAEELMVTASDDFTMFLWNPKKLTKPLARMTGHQKLVNHVAFSP 416

Query: 298 QEDG-VLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNI 356
             DG  ++SA  D    LW            D  DG  + +    GH +S+   + + + 
Sbjct: 417 --DGRYIVSASFDNSIKLW------------DGRDG--KFLSTFRGHVASVYQVAWSSDC 460

Query: 357 PWLTATAEEENIVQVW 372
             L  +  ++  ++VW
Sbjct: 461 R-LLVSCSKDTTLKVW 475

 Score = 39.7 bits (91), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 41/188 (21%), Positives = 80/188 (42%), Gaps = 30/188 (15%)

Query: 148 STFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCK 207
           S    H       +F P+   ++++G+ D+   +WD    +Q P+ T  + HS+ V    
Sbjct: 133 SAIAGHGSTILCSAFAPDTSSRMVTGAGDNTARIWDC--DTQTPLATL-EGHSNWVLCVS 189

Query: 208 WHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHS---TNL------ 258
           W + D  +  + S DST+     R+ ++   K       ++ A   H    T+L      
Sbjct: 190 W-SPDGEVIATGSMDSTI-----RLWESTKGKPVGGGNGSSSALKGHMKWITSLSWEPLH 243

Query: 259 ---------FAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSD 309
                     A+A  D  + ++D  R    L+ + GH ++V  +++    +G+L S   D
Sbjct: 244 LVPDGAKPRLASASKDGTIKIWDTAR-RVCLYTLSGHSNSVACVKW--GGEGLLYSGSHD 300

Query: 310 RRTILWDL 317
           +   +WD+
Sbjct: 301 KTVRVWDM 308

>SAKL0F10648g Chr6 (827399..831010) [3612 bp, 1203 aa] {ON} highly
           similar to uniprot|P53622 Saccharomyces cerevisiae
           YDL145C COP1 Alpha subunit of COPI vesicle coatomer
           complex which surrounds transport vesicles in the early
           secretory pathway
          Length = 1203

 Score = 53.9 bits (128), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 53/247 (21%), Positives = 103/247 (41%), Gaps = 25/247 (10%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           +L+ F+  +    G++F+P+ +  +L     S I LWD    +   +L   + H   V  
Sbjct: 3   MLTKFESKSTRAKGIAFHPS-RPWVLVALFSSTIQLWDYRMGT---LLHRFEDHEGPVRG 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q +F S  +D T+++     +      +     Y    F  H      +   D
Sbjct: 59  IDFHP-TQPLFVSAGDDYTIKVWSLETKKCLF-TLNGHLDYVRTVFFHHELPWIISCSDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA------- 318
             + +++ +   K +  + GH   V   +FHP ED +++SA  D    +WD++       
Sbjct: 117 QTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPSED-LVVSASLDETVRVWDISGLRKKHS 174

Query: 319 ---------EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIV 369
                    ++ A+Q   D   G   V  I  GH   +N  S +P +P + +  ++   V
Sbjct: 175 APGASSFEEQMIAQQNLLDGGFGECVVKFILEGHTRGVNWASFHPTLPLIVSGGDDRQ-V 233

Query: 370 QVWKPSS 376
           ++W+ S+
Sbjct: 234 KIWRMSA 240

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 95/246 (38%), Gaps = 39/246 (15%)

Query: 124 IATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD 183
           I + S   TI ++N  N  E   L+    HN       F+P+E   ++S S D  + +WD
Sbjct: 110 IISCSDDQTIRIWNWQNRKEIACLTG---HNHFVMCAQFHPSED-LVVSASLDETVRVWD 165

Query: 184 VTG---KSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKV 240
           ++G   K   P  +  +            N     FG       L+ H + +  A     
Sbjct: 166 ISGLRKKHSAPGASSFEEQM-----IAQQNLLDGGFGECVVKFILEGHTRGVNWA----- 215

Query: 241 QAKKPYNTLAFSAHST-NLFAAAGTDSMVYLYDRRRASKP--LHMMPGHEDAVTSLEFHP 297
                      S H T  L  + G D  V ++ R  A+K   +    GH + V S+ FHP
Sbjct: 216 -----------SFHPTLPLIVSGGDDRQVKIW-RMSATKAWEVDTCRGHTNNVDSVIFHP 263

Query: 298 QEDGVLISAGSDRRTILWDL-AEIGAEQVPDDAD-----DGSPEVMMIHAGHRSSINDFS 351
            ++ ++IS G D+    WDL      +Q   + D        P + +  A H S +  F 
Sbjct: 264 HQN-LIISVGEDKTIRTWDLDKRTPVKQFKRENDRFWLIRAHPNINLFGAAHDSGVMVFK 322

Query: 352 MNPNIP 357
           ++   P
Sbjct: 323 LDRERP 328

>Kpol_2001.65 s2001 (178299..181919) [3621 bp, 1206 aa] {ON}
           (178299..181919) [3621 nt, 1207 aa]
          Length = 1206

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 56/251 (22%), Positives = 104/251 (41%), Gaps = 29/251 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           LL+ F+  +    G++F+P+ +  +L     S I LWD    +   +L   + H   V  
Sbjct: 3   LLTKFESKSTRAKGIAFHPS-RPWVLVALFSSTIQLWDYRMGT---LLHRYEDHEGPVRG 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q +F S  +D T+++      +  +  +     Y    F         +A  D
Sbjct: 59  IDFHP-TQPLFVSAGDDYTIKVWSLET-NKCLYTLDGHLDYVRTVFFHKELPWIISASDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE------ 319
             + +++ +   K +  + GH   V   +FHP ED +++SA  D    +WD+++      
Sbjct: 117 QTIRIWNWQN-RKEIACITGHNHFVMCAQFHPTED-LIVSASLDETVRVWDISKLREKHS 174

Query: 320 --------------IGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEE 365
                         I A+Q   D   G   V  I  GH   +N  S +P +P + +  ++
Sbjct: 175 APGRSAMPTSFEEKIAAQQNLLDGGFGDCTVKFILEGHTRGVNWASFHPTLPLIVSGGDD 234

Query: 366 ENIVQVWKPSS 376
              V++WK S+
Sbjct: 235 RQ-VKLWKMSA 244

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 56/235 (23%), Positives = 94/235 (40%), Gaps = 29/235 (12%)

Query: 132 TIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEP 191
           TI ++N  N  E   ++    HN       F+P E   ++S S D  + +WD++      
Sbjct: 118 TIRIWNWQNRKEIACITG---HNHFVMCAQFHPTED-LIVSASLDETVRVWDIS------ 167

Query: 192 ILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAF 251
                ++HS         +F++ I       +   L D    D  V+ +           
Sbjct: 168 --KLREKHSAPGRSAMPTSFEEKI------AAQQNLLDGGFGDCTVKFILEGHTRGVNWA 219

Query: 252 SAHST-NLFAAAGTDSMVYLYDRRRASKP--LHMMPGHEDAVTSLEFHPQEDGVLISAGS 308
           S H T  L  + G D  V L+ +  A+K   L    GH + V S+ FHP ++ +++S G 
Sbjct: 220 SFHPTLPLIVSGGDDRQVKLW-KMSATKAWELDSCRGHTNNVDSVIFHPTQN-LILSVGE 277

Query: 309 DRRTILWDL-AEIGAEQVPDDADD-----GSPEVMMIHAGHRSSINDFSMNPNIP 357
           D+   +WDL      +Q   + D        P + +  A H S I  F ++   P
Sbjct: 278 DKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPNINLFGAAHDSGIMIFKLDRERP 332

>NCAS0E03750 Chr5 complement(736672..740502) [3831 bp, 1276 aa] {ON}
           Anc_7.310
          Length = 1276

 Score = 53.5 bits (127), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 53/231 (22%), Positives = 101/231 (43%), Gaps = 48/231 (20%)

Query: 120 DDNLIA-TISGVGTIYLYNRA-NEVESGL--LSTFQFHNENGYGLSFNPNEKGKLLSGSD 175
           D+  IA  +   G I L+++  N+ +  L  L  F+ H      L FNP ++  L S  +
Sbjct: 75  DNKFIAGALDDNGKIELFSKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGN 134

Query: 176 DSNIVLWDVTGKSQEPILTFTD----------RHSDIVNDCKWHNFDQNIFGSVSEDSTL 225
           +  I++WD+        L+ TD             D +    W+    ++F S  + +T 
Sbjct: 135 NGEILIWDINK-----TLSSTDYSPSAPGIAMSTQDEIKSVSWNKSLAHVFASAGDTTTY 189

Query: 226 QLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNL-----------------FAAAGTDS-- 266
                    A++  ++AKK    L +++  T L                   A+G+DS  
Sbjct: 190 ---------ASIWDLKAKKEVIHLNYTSPKTGLKPNLAVVEWHPKVTTYVATASGSDSDP 240

Query: 267 MVYLYDRRRASKPLHMMPG-HEDAVTSLEFHPQEDGVLISAGSDRRTILWD 316
           ++ ++D R ++ P+  + G H   + SL++  +++ +L+S+G D    LWD
Sbjct: 241 VILIWDLRNSNMPMTTLEGPHTKGIMSLDWCTKDESLLLSSGRDGIVALWD 291

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 38/158 (24%), Positives = 67/158 (42%), Gaps = 15/158 (9%)

Query: 215 IFGSVSEDSTLQL----HDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYL 270
           I    S DSTL+L     D +     V  +     +  L +S  +  +  A   +  + L
Sbjct: 32  IAADFSNDSTLELWSLLSDPKKDPTPVASITTDARFKDLDWSFDNKFIAGALDDNGKIEL 91

Query: 271 Y-----DRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQV 325
           +     D + + K L     H  AV +L F+P++  VL SAG++   ++WD+ +  +   
Sbjct: 92  FSKEENDTKISLKSLGKFKKHTTAVNTLRFNPKQQNVLASAGNNGEILIWDINKTLS--- 148

Query: 326 PDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATA 363
              + D SP    I    +  I   S N ++  + A+A
Sbjct: 149 ---STDYSPSAPGIAMSTQDEIKSVSWNKSLAHVFASA 183

>KLTH0B03410g Chr2 complement(276115..277548) [1434 bp, 477 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 477

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 45/170 (26%), Positives = 82/170 (48%), Gaps = 12/170 (7%)

Query: 145 GLLSTFQFHNENGY-GLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIV 203
           GL+ TF  H +  + G+  + ++   + +G++   I LWD +       L++    +D V
Sbjct: 165 GLIKTF--HGDYAFLGIDHHRSKPYFVTAGAE---INLWDSSRSRPTANLSWG---ADNV 216

Query: 204 NDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAG 263
           +  K++  + +IF S   D+++ L+D R  ++  +K   +   N L ++      F  A 
Sbjct: 217 STVKFNQNETDIFASAGSDNSVVLYDLRT-NSPTQKFTQRMRTNALCWNPMEAYNFVVAS 275

Query: 264 TDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI 313
            D   Y YD R  S+ LH+   H  AV  ++F P  D ++   GS  +TI
Sbjct: 276 EDHNAYYYDMRNLSRALHVFKDHVSAVMDVDFSPTGDEIV--TGSYDKTI 323

 Score = 43.5 bits (101), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 79/183 (43%), Gaps = 23/183 (12%)

Query: 153 HNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKW---- 208
           H +  Y ++ N +   KL S S D  +  W+++  ++E I +F   +  +   C      
Sbjct: 66  HRDGVYTIAKNYHALNKLASASADGVVKYWNMS--TREEICSFKAHYGLVHGLCVTPQHL 123

Query: 209 -HNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKP------------YNTLAFSAHS 255
             N ++N   S  +D T++L      D +  K   ++             Y  L    H 
Sbjct: 124 SANKNENYMLSCGDDKTVKLWSVNTEDFSSSKNDEEQSSTDGLIKTFHGDYAFLGIDHHR 183

Query: 256 TN-LFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTIL 314
           +   F  AG +  + L+D  R S+P   +    D V++++F+  E  +  SAGSD   +L
Sbjct: 184 SKPYFVTAGAE--INLWDSSR-SRPTANLSWGADNVSTVKFNQNETDIFASAGSDNSVVL 240

Query: 315 WDL 317
           +DL
Sbjct: 241 YDL 243

>CAGL0H00781g Chr8 complement(77292..78833) [1542 bp, 513 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247c
          Length = 513

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 53/240 (22%), Positives = 99/240 (41%), Gaps = 38/240 (15%)

Query: 104 KFEHENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTF----QFHNENGYG 159
           K E +  ++  ++  Q  N  A    VG   +  + ++V   +L  F     FH      
Sbjct: 192 KLEEQLNLSLCKFHKQHPNNKAF---VGLSQIPTKTSDVNPSVLGEFPPITSFH------ 242

Query: 160 LSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSV 219
             +NP +   L+S S D+  ++WD+  +S   + T    H   V D ++      +F S 
Sbjct: 243 --WNPVDTNILISSSIDTTCIVWDL--QSSNYVKTQLIAHDSEVFDVRFLTQSTQLFASC 298

Query: 220 SEDSTLQLHDQRI--RDAAVEKVQAKKP-------------YNTLAF-----SAHSTNLF 259
             D ++++ D R       + +  A +P              N+ A      S H  N+ 
Sbjct: 299 GGDGSVRVFDLRCLAHSTIIYEPPASEPGTGNNSSRSDSTDENSHALLRLEPSPHDPNVL 358

Query: 260 AA-AGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA 318
           A  A   + + + D R    PL ++ GH  ++  +++HP +   LIS   D + + WD++
Sbjct: 359 ATFAIASNEILILDMRNPDSPLVVLNGHSASINQIKWHPTKKNTLISCSDDCQVLFWDIS 418

>KAFR0F01060 Chr6 complement(201465..203126) [1662 bp, 553 aa] {ON}
           Anc_6.276 YPL247C
          Length = 553

 Score = 53.1 bits (126), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/202 (23%), Positives = 90/202 (44%), Gaps = 24/202 (11%)

Query: 136 YNRANEVESG--LLSTFQFHNENGYGLSF--NPNEKGKLLSGSDDSNIVLWDVTGKSQEP 191
           YN+ + + +G  + ST Q   E     SF  N  +   L+S S D+  ++WD+  +S   
Sbjct: 258 YNKLHNITNGTSVTSTSQILGEFPPVTSFDWNQTDTNLLISSSIDTTCIVWDL--QSSNY 315

Query: 192 ILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYN---- 247
           + T    H   V D ++      +F S   D ++++ D  +R  A   +  + P N    
Sbjct: 316 VKTQLIAHDSEVYDVRFLTKSTQLFASCGGDGSVRVFD--LRSLAHSTIIYEPPTNPVSN 373

Query: 248 -----------TLAFSAHSTNLFAAAGTDS-MVYLYDRRRASKPLHMMPGHEDAVTSLEF 295
                       L  S    N+ A   ++S  + + D R +  P+ ++ GH+ A+  +++
Sbjct: 374 ADLSQQQNALLRLEPSPTDANVIATFVSESNKILILDMRNSESPVLVLEGHKSAINQIKW 433

Query: 296 HPQEDGVLISAGSDRRTILWDL 317
           HP +  +L+S   D + + WDL
Sbjct: 434 HPTKRYILLSCSDDCQVLYWDL 455

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/173 (21%), Positives = 74/173 (42%), Gaps = 5/173 (2%)

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHD-QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAA 261
           V    W+  D N+  S S D+T  + D Q       + +        + F   ST LFA+
Sbjct: 283 VTSFDWNQTDTNLLISSSIDTTCIVWDLQSSNYVKTQLIAHDSEVYDVRFLTKSTQLFAS 342

Query: 262 AGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLI--SAGSDRRTILWDLAE 319
            G D  V ++D R  +    +     + V++ +   Q++ +L    + +D   I   ++E
Sbjct: 343 CGGDGSVRVFDLRSLAHSTIIYEPPTNPVSNADLSQQQNALLRLEPSPTDANVIATFVSE 402

Query: 320 IGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVW 372
                + D  +  SP  +++  GH+S+IN    +P   ++  +  ++  V  W
Sbjct: 403 SNKILILDMRNSESP--VLVLEGHKSAINQIKWHPTKRYILLSCSDDCQVLYW 453

>Smik_4.90 Chr4 complement(171469..175074) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 105/247 (42%), Gaps = 25/247 (10%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           +L+ F+  +    G++F+P+ +  +L     S I LWD    +   +L   + H   V  
Sbjct: 3   MLTKFESKSTRAKGIAFHPS-RPWVLVALFSSTIQLWDYRMGT---LLHRFEDHEGPVRG 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q IF S  +D T+++      +  +  +     Y    F         +A  D
Sbjct: 59  LDFHP-TQPIFVSAGDDYTIKVWSLDT-NKCLYTLTGHLDYVRTVFFHRELPWIISASDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA------- 318
             + +++ +   K +  + GH   V   +FHP +D +++SA  D    +WD++       
Sbjct: 117 QTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDISGLRKRHS 174

Query: 319 ---------EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIV 369
                    ++ A+Q   D   G   V  I  GH   +N  S +P +P L  +A ++  V
Sbjct: 175 APGTNSFEEQMNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQV 233

Query: 370 QVWKPSS 376
           ++W+ S+
Sbjct: 234 KLWRMSA 240

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 67/317 (21%), Positives = 127/317 (40%), Gaps = 66/317 (20%)

Query: 99  VKIIKKFEHENEVTRARYMPQDDN----LIATISGVGTIYLYNRANEVESGLLSTFQFHN 154
           +K++ KFE ++  TRA+ +    +    L+A  S    ++ Y         LL  F+ H 
Sbjct: 1   MKMLTKFESKS--TRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGT-----LLHRFEDHE 53

Query: 155 ENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQN 214
               GL F+P +    +S  DD  I +W +   + + + T T  H D V    +H     
Sbjct: 54  GPVRGLDFHPTQP-IFVSAGDDYTIKVWSL--DTNKCLYTLTG-HLDYVRTVFFHRELPW 109

Query: 215 IFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAH---STNLFAAAGTDSMVYLY 271
           I  S S+D T+++ + + R    +++     +N     A    + +L  +A  D  + ++
Sbjct: 110 II-SASDDQTIRIWNWQNR----KEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIW 164

Query: 272 D----RRRASKP-------------------------LHMMPGHEDAVTSLEFHPQEDGV 302
           D    R+R S P                           ++ GH   V    FHP    +
Sbjct: 165 DISGLRKRHSAPGTNSFEEQMNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-L 223

Query: 303 LISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTAT 362
           ++SA  DR+  LW ++   A +V                GH ++++    +P+   + + 
Sbjct: 224 IVSASDDRQVKLWRMSATKAWEVD------------TCRGHTNNVDSVIFHPHQNLIISV 271

Query: 363 AEEENIVQVWKPSSKLP 379
            E++ + +VW    + P
Sbjct: 272 GEDKTL-RVWDLDKRTP 287

 Score = 38.1 bits (87), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 53/113 (46%), Gaps = 4/113 (3%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           ++S SDD  + LW ++      + T    H++ V+   +H   QN+  SV ED TL++ D
Sbjct: 224 IVSASDDRQVKLWRMSATKAWEVDT-CRGHTNNVDSVIFHP-HQNLIISVGEDKTLRVWD 281

Query: 230 QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA-GTDSMVYLYDRRRASKPLH 281
              R    +  +    +  +A   H  NLF AA  +  MV+  DR R    +H
Sbjct: 282 LDKRTPVKQFKRENDRFWLIAAHPH-INLFGAAHDSGIMVFKLDRERPCSFIH 333

>Suva_4.99 Chr4 complement(182425..186030) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 105/247 (42%), Gaps = 25/247 (10%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           +L+ F+  +    G++F+P+ +  +L     S I LWD    +   +L   + H   V  
Sbjct: 3   MLTKFESKSTRAKGIAFHPS-RPWVLVALFSSTIQLWDYRMGT---LLHRFEDHEGPVRG 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q IF S  +D T+++      +  +  +     Y    F         +A  D
Sbjct: 59  LDFHP-TQPIFVSAGDDYTIKVWSLDT-NKCLYTLSGHLDYVRTVFFHRELPWIISASDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA------- 318
             + +++ +   K +  + GH   V   +FHP +D +++SA  D    +WD++       
Sbjct: 117 QTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDISGLRKRHS 174

Query: 319 ---------EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIV 369
                    ++ A+Q   D   G   V  I  GH   +N  S +P +P L  +A ++  V
Sbjct: 175 APSNNSFEEQLNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQV 233

Query: 370 QVWKPSS 376
           ++W+ S+
Sbjct: 234 KLWRMSA 240

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 66/317 (20%), Positives = 128/317 (40%), Gaps = 66/317 (20%)

Query: 99  VKIIKKFEHENEVTRARYMPQDDN----LIATISGVGTIYLYNRANEVESGLLSTFQFHN 154
           +K++ KFE ++  TRA+ +    +    L+A  S    ++ Y         LL  F+ H 
Sbjct: 1   MKMLTKFESKS--TRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGT-----LLHRFEDHE 53

Query: 155 ENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQN 214
               GL F+P +    +S  DD  I +W +   + + + T +  H D V    +H     
Sbjct: 54  GPVRGLDFHPTQP-IFVSAGDDYTIKVWSL--DTNKCLYTLSG-HLDYVRTVFFHRELPW 109

Query: 215 IFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAH---STNLFAAAGTDSMVYLY 271
           I  S S+D T+++ + + R    +++     +N     A    + +L  +A  D  + ++
Sbjct: 110 II-SASDDQTIRIWNWQNR----KEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIW 164

Query: 272 D----RRRASKPLH-------------------------MMPGHEDAVTSLEFHPQEDGV 302
           D    R+R S P +                         ++ GH   V    FHP    +
Sbjct: 165 DISGLRKRHSAPSNNSFEEQLNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-L 223

Query: 303 LISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTAT 362
           ++SA  DR+  LW ++   A +V                GH ++++    +P+   + + 
Sbjct: 224 IVSASDDRQVKLWRMSATKAWEVD------------TCRGHTNNVDSVIFHPHQNLIISV 271

Query: 363 AEEENIVQVWKPSSKLP 379
            E++ + +VW    + P
Sbjct: 272 GEDKTL-RVWDLDKRTP 287

 Score = 38.1 bits (87), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 53/113 (46%), Gaps = 4/113 (3%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           ++S SDD  + LW ++      + T    H++ V+   +H   QN+  SV ED TL++ D
Sbjct: 224 IVSASDDRQVKLWRMSATKAWEVDT-CRGHTNNVDSVIFHP-HQNLIISVGEDKTLRVWD 281

Query: 230 QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA-GTDSMVYLYDRRRASKPLH 281
              R    +  +    +  +A   H  NLF AA  +  MV+  DR R    +H
Sbjct: 282 LDKRTPVKQFKRENDRFWLIAAHPH-INLFGAAHDSGIMVFKLDRERPCSVIH 333

>TPHA0E03080 Chr5 complement(646691..648157) [1467 bp, 488 aa] {ON}
           Anc_5.201 YLL011W
          Length = 488

 Score = 52.8 bits (125), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 45/169 (26%), Positives = 78/169 (46%), Gaps = 10/169 (5%)

Query: 145 GLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVN 204
           GLL T+ + +   +GL  + N    +  G+    I LWD      +PI   T   +D V 
Sbjct: 165 GLLKTY-YGDHAFFGLDHHRNNSTFVTGGA---QIQLWDAN--RSKPISNLT-WGADNVT 217

Query: 205 DCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGT 264
             K++  + +I  S   D+++ L+D R  ++  +K++     N + ++      F  A  
Sbjct: 218 SVKFNQTETDILASTGSDNSIVLYDLRT-NSPTQKIRQSMRTNAICWNPMEAFNFVIANE 276

Query: 265 DSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI 313
           D   Y YD R  S+ L++   H  AV  ++F P  D ++   GS  +TI
Sbjct: 277 DHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIV--TGSYDKTI 323

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 81/183 (44%), Gaps = 23/183 (12%)

Query: 153 HNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDC-----K 207
           H +  Y ++ N N+  KL S S D  +  ++++  ++E I +F   +  +   C      
Sbjct: 66  HRDGVYTIAKNYNQLNKLASSSADGVVKYFNMS--TREEICSFKAHYGLVTGLCVRPETS 123

Query: 208 WHNFDQNIFGSVSEDSTLQL-------HDQRIRDAAVEKVQA--KKPYNTLAFSA---HS 255
             N +++   S  +D T++L            +D  + K     K  Y   AF     H 
Sbjct: 124 ATNKNEHYMISCGDDKTVKLWSVDSNDFSNNKKDDTIHKGDGLLKTYYGDHAFFGLDHHR 183

Query: 256 TN-LFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTIL 314
            N  F   G  + + L+D  R SKP+  +    D VTS++F+  E  +L S GSD   +L
Sbjct: 184 NNSTFVTGG--AQIQLWDANR-SKPISNLTWGADNVTSVKFNQTETDILASTGSDNSIVL 240

Query: 315 WDL 317
           +DL
Sbjct: 241 YDL 243

>KLLA0F19734g Chr6 (1826828..1830229) [3402 bp, 1133 aa] {ON}
           similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1133

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 80/171 (46%), Gaps = 21/171 (12%)

Query: 163 NPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSED 222
           +P +   ++S S+   IV W+++  S + +      H   + D  +H     I  + S D
Sbjct: 78  HPAKHHWVISTSNQKAIV-WNLSRSSSKAVEHVLHGHFRAITDINFHPLQPEILATSSID 136

Query: 223 STLQLHDQRIRDAAVEKVQAKKPY----------NTLAFSAHSTNLFAAAGTDSMVYLYD 272
           +     D R           KKPY            + ++  ++N+ A + ++ +VY++D
Sbjct: 137 TYALAWDMR---------SPKKPYFRTSNWRSGAAQVKWNHKNSNVLATSHSN-IVYVWD 186

Query: 273 RRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAE 323
            R+ + PL ++ GH  +V S++F+P  +  ++S+G+D     WD  ++  E
Sbjct: 187 VRKGTSPLSVLEGHSGSVNSIDFNPFNETEIMSSGNDGTVKFWDYNKVEDE 237

>Skud_4.109 Chr4 complement(190191..193796) [3606 bp, 1201 aa] {ON}
           YDL145C (REAL)
          Length = 1201

 Score = 53.1 bits (126), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 55/247 (22%), Positives = 105/247 (42%), Gaps = 25/247 (10%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           +L+ F+  +    G++F+P+ +  +L     S I LWD    +   +L   + H   V  
Sbjct: 3   MLTKFESKSTRAKGIAFHPS-RPWVLVALFSSTIQLWDYRMGT---LLHRFEDHEGPVRG 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q IF S  +D T+++      +  +  +     Y    F         +A  D
Sbjct: 59  LDFHP-TQPIFVSAGDDYTIKVWSLDT-NKCLYTLSGHLDYVRTVFFHRELPWIISASDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA------- 318
             + +++ +   K +  + GH   V   +FHP +D +++SA  D    +WD++       
Sbjct: 117 QTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDISGLRKRHS 174

Query: 319 ---------EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIV 369
                    ++ A+Q   D   G   V  I  GH   +N  S +P +P L  +A ++  V
Sbjct: 175 APGTNSFEEQMNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSASDDRQV 233

Query: 370 QVWKPSS 376
           ++W+ S+
Sbjct: 234 KLWRMSA 240

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 66/317 (20%), Positives = 127/317 (40%), Gaps = 66/317 (20%)

Query: 99  VKIIKKFEHENEVTRARYMPQDDN----LIATISGVGTIYLYNRANEVESGLLSTFQFHN 154
           +K++ KFE ++  TRA+ +    +    L+A  S    ++ Y         LL  F+ H 
Sbjct: 1   MKMLTKFESKS--TRAKGIAFHPSRPWVLVALFSSTIQLWDYRMGT-----LLHRFEDHE 53

Query: 155 ENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQN 214
               GL F+P +    +S  DD  I +W +   + + + T +  H D V    +H     
Sbjct: 54  GPVRGLDFHPTQP-IFVSAGDDYTIKVWSL--DTNKCLYTLSG-HLDYVRTVFFHRELPW 109

Query: 215 IFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAH---STNLFAAAGTDSMVYLY 271
           I  S S+D T+++ + + R    +++     +N     A    + +L  +A  D  + ++
Sbjct: 110 II-SASDDQTIRIWNWQNR----KEIACLTGHNHFVMCAQFHPTDDLIVSASLDETIRIW 164

Query: 272 D----RRRASKP-------------------------LHMMPGHEDAVTSLEFHPQEDGV 302
           D    R+R S P                           ++ GH   V    FHP    +
Sbjct: 165 DISGLRKRHSAPGTNSFEEQMNAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-L 223

Query: 303 LISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTAT 362
           ++SA  DR+  LW ++   A +V                GH ++++    +P+   + + 
Sbjct: 224 IVSASDDRQVKLWRMSATKAWEVD------------TCRGHTNNVDSVIFHPHQNLIISV 271

Query: 363 AEEENIVQVWKPSSKLP 379
            E++ + +VW    + P
Sbjct: 272 GEDKTL-RVWDLDKRTP 287

 Score = 37.7 bits (86), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 53/113 (46%), Gaps = 4/113 (3%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           ++S SDD  + LW ++      + T    H++ V+   +H   QN+  SV ED TL++ D
Sbjct: 224 IVSASDDRQVKLWRMSATKAWEVDT-CRGHTNNVDSVIFHP-HQNLIISVGEDKTLRVWD 281

Query: 230 QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA-GTDSMVYLYDRRRASKPLH 281
              R    +  +    +  +A   H  NLF AA  +  MV+  DR R    +H
Sbjct: 282 LDKRTPVKQFKRENDRFWLIAAHPH-INLFGAAHDSGIMVFKLDRERPCSFIH 333

>CAGL0D05588g Chr4 (533235..534668) [1434 bp, 477 aa] {ON} highly
           similar to uniprot|P33750 Saccharomyces cerevisiae
           YLL011w SOF1
          Length = 477

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 54/194 (27%), Positives = 88/194 (45%), Gaps = 28/194 (14%)

Query: 153 HNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDC------ 206
           H +  Y L+ + N+  K+ SGS D  I  WD++  S+E I +F   +  I   C      
Sbjct: 66  HQDGVYVLAKHYNDLNKIASGSGDGVIKYWDMS--SREQIASFKAHYGTITGLCITPKVN 123

Query: 207 --KWHNFDQNIFGSVSEDSTLQL------------HDQRIR--DAAVEKVQAKKPYNTLA 250
                + +QN   S S+D T++L            +DQ I   +  ++    +  +  L 
Sbjct: 124 IDSASSGNQNFVLSSSDDKTVKLWSVNHEDFAHVDNDQVINTDNGLIKHYYGEHAFQGLD 183

Query: 251 FSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDR 310
            S  ++N F   G    + L+D  R SKPL  +    D + +++F+  +  VL SAGSD 
Sbjct: 184 HSRMTSN-FVTGG--PRINLWDINR-SKPLSDLSWGADNINTVKFNQNDANVLGSAGSDN 239

Query: 311 RTILWDLAEIGAEQ 324
             +L+DL    A Q
Sbjct: 240 SIVLYDLRTNSATQ 253

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 62/128 (48%), Gaps = 4/128 (3%)

Query: 179 IVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVE 238
           I LWD+        L++    +D +N  K++  D N+ GS   D+++ L+D R  ++A +
Sbjct: 198 INLWDINRSKPLSDLSWG---ADNINTVKFNQNDANVLGSAGSDNSIVLYDLRT-NSATQ 253

Query: 239 KVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQ 298
           K+      N++ ++      F  A  D   Y YD R  S+ L++   H  AV  ++  P 
Sbjct: 254 KIVQTMRVNSMCWNPMEAFNFVVASEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDISPT 313

Query: 299 EDGVLISA 306
            + V+ ++
Sbjct: 314 GEEVVTAS 321

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 37/85 (43%), Gaps = 4/85 (4%)

Query: 147 LSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDC 206
           LS   +  +N   + FN N+   L S   D++IVL+D+   S    +  T R    VN  
Sbjct: 209 LSDLSWGADNINTVKFNQNDANVLGSAGSDNSIVLYDLRTNSATQKIVQTMR----VNSM 264

Query: 207 KWHNFDQNIFGSVSEDSTLQLHDQR 231
            W+  +   F   SED     +D R
Sbjct: 265 CWNPMEAFNFVVASEDHNAYYYDMR 289

>SAKL0C13266g Chr3 complement(1171961..1173340) [1380 bp, 459 aa]
           {ON} highly similar to uniprot|Q75AV4 Ashbya gossypii
           ADL184W PSF2 Polyadenylation factor subunit 2 and
           similar to YNL317W uniprot|P42841 Saccharomyces
           cerevisiae YNL317W PFS2 Integral subunit of the pre-mRNA
           cleavage and polyadenylation factor (CPF) complex plays
           an essential role in mRNA 3'-end formation by bridging
           different processing factors and thereby promoting the
           assembly of the processing complex
          Length = 459

 Score = 52.4 bits (124), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 59/262 (22%), Positives = 116/262 (44%), Gaps = 15/262 (5%)

Query: 93  EVLKSNVKIIKKFEHEN-EVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQ 151
           ++ + N  ++K  +  + E  R       D+   T S    + ++N +N  +  +LS   
Sbjct: 148 KIWQPNFNMVKVLDQAHMECVRDVSFSGTDSKFVTCSDDNILKIWNFSNGQQERVLSG-- 205

Query: 152 FHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDIVNDCKWHN 210
            H+ +     ++P   G ++SGS D+ I LWD  +G+    IL F  +H+ I    K+  
Sbjct: 206 -HHWDVKSCDWHPT-MGLIVSGSKDNLIKLWDPRSGQCISTILGF--KHTII--KTKFQP 259

Query: 211 FDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYL 270
              N+   V++D + ++ D R     ++  + +  Y +L +   + ++F     D  +  
Sbjct: 260 TKGNLLAVVAKDKSCKIFDIRQNMKELKSFRDESDYMSLTWHPINESIFTVGCYDGSLKH 319

Query: 271 YDRRR---ASKPLHMMP-GHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVP 326
           +D  +   +S   H +P  H+  +TSL ++P    +L SA  DR    W  +        
Sbjct: 320 FDLLQDTGSSNSFHDIPYAHDKCITSLSYNPVGH-ILASASKDRTIRFWTRSRPMDPNAF 378

Query: 327 DDADDGSPEVMMIHAGHRSSIN 348
           DD    + +V   + G  ++IN
Sbjct: 379 DDPTYNNKKVNAWYFGINNNIN 400

>YJL112W Chr10 (205305..207449) [2145 bp, 714 aa] {ON}
           MDV1Peripheral protein of the cytosolic face of the
           mitochondrial outer membrane, required for mitochondrial
           fission; interacts with Fis1p and with the
           dynamin-related GTPase Dnm1p; contains WD repeats
          Length = 714

 Score = 52.8 bits (125), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 48/181 (26%), Positives = 80/181 (44%), Gaps = 36/181 (19%)

Query: 139 ANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDV-TGKSQEPI-LTFT 196
            N ++S  + TF+ H +    LS +P+    L+SGS D  I  WD+ +GK  + I L+F 
Sbjct: 487 TNHIDSPCVHTFEAHTDEVTALSLDPS---FLVSGSQDRTIRQWDLRSGKCLQTIDLSFA 543

Query: 197 DRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHST 256
           +  +   N              +S+ + L   ++R    A++   A              
Sbjct: 544 NVLTTSTN------------VDLSKSTLLTQRNERPSIGALQSFDAA------------- 578

Query: 257 NLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWD 316
              A    D +V L+D R + K +  + GH DA+TSL+F   +   L++   DR   +WD
Sbjct: 579 --LATGTKDGVVRLWDLR-SGKVIRTLKGHTDAITSLKF---DSACLVTGSYDRTVRIWD 632

Query: 317 L 317
           L
Sbjct: 633 L 633

>AAL157C Chr1 complement(70077..71516) [1440 bp, 479 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL011W
           (SOF1)
          Length = 479

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/154 (30%), Positives = 71/154 (46%), Gaps = 18/154 (11%)

Query: 163 NPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQN---IFGSV 219
           NPN     ++G   + I LWDV  K     L++       V++  +  F+QN   I  S 
Sbjct: 188 NPN----FVTGG--AQIQLWDVNRKKPLSNLSWG------VDNVSFVRFNQNEEDILAST 235

Query: 220 SEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKP 279
             D+++ L+D R  ++  +KV  +   N L ++      FA A  D   Y YD R  S+ 
Sbjct: 236 GSDNSIVLYDLRT-NSPTQKVVQRMRTNALCWNPMEPFNFAIANEDHNAYYYDMRNMSRA 294

Query: 280 LHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI 313
           LH+   H  AV  ++F P   G  I  GS  +TI
Sbjct: 295 LHVFKDHVSAVMDVDFSPT--GEEIVTGSYDKTI 326

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 57/236 (24%), Positives = 91/236 (38%), Gaps = 41/236 (17%)

Query: 153 HNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNF- 211
           H +  Y L+ N N   KL SGS D  +  W++   ++E + +F   +  +   C      
Sbjct: 66  HRDGCYVLAKNYNVLNKLASGSADGVVKYWNMA--TREELCSFRAHYGLVTGLCVTPTHL 123

Query: 212 ----DQNIFGSVSEDSTLQL------------HDQRIRDAAVEKVQAKKPYNTLAFSA-- 253
                 +   S  +D T++L             D +I     +    K  Y   AF +  
Sbjct: 124 SPTKKDSFMLSCGDDKTIKLWSVNSDDFNSIKDDTKIVSDTGDGALLKTFYGEHAFQSID 183

Query: 254 -HSTN-LFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRR 311
            H  N  F   G  + + L+D  R  KPL  +    D V+ + F+  E+ +L S GSD  
Sbjct: 184 HHRRNPNFVTGG--AQIQLWDVNR-KKPLSNLSWGVDNVSFVRFNQNEEDILASTGSDNS 240

Query: 312 TILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEEN 367
            +L+DL               SP   ++    R   N    NP  P+  A A E++
Sbjct: 241 IVLYDLRT------------NSPTQKVV---QRMRTNALCWNPMEPFNFAIANEDH 281

>ZYRO0B10450g Chr2 complement(825240..826688) [1449 bp, 482 aa] {ON}
           highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 482

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 42/169 (24%), Positives = 79/169 (46%), Gaps = 10/169 (5%)

Query: 145 GLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVN 204
           GLL TF + + +  G+  + +    +  G+    I LWD +       L++    +D + 
Sbjct: 164 GLLKTF-YGDHSFQGIDHHRSNSAFVTGGA---QIQLWDTSRSKSTSNLSWG---ADNIT 216

Query: 205 DCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGT 264
             K++  D NI  S   D+++ L+D R  ++  +K+  +   N+L ++      F     
Sbjct: 217 SVKFNQNDSNILASTGSDNSIVLYDLRT-NSPTQKIVQQMRTNSLCWNPMEPFNFVTGNE 275

Query: 265 DSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI 313
           D   Y YD R+ ++ L++   H  AV  ++F P  D ++   GS  +TI
Sbjct: 276 DHNAYYYDMRKMNRALNVFKDHVSAVMDVDFAPTGDEIV--TGSYDKTI 322

 Score = 42.4 bits (98), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/219 (23%), Positives = 88/219 (40%), Gaps = 46/219 (21%)

Query: 105 FEHENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNP 164
           + H + V        D N +AT SG G +  +N ++  E   L +F+ H     GL  +P
Sbjct: 64  YGHRDGVYAVAKHYHDLNKMATGSGDGVVKFWNMSSSEE---LCSFKAHYGIVTGLCVSP 120

Query: 165 NEKGK------LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGS 218
               K      +LS  DD  + LW V           TD ++D+ +D   +   + +  +
Sbjct: 121 VLASKNKNLQYMLSCGDDKTVKLWSVD----------TDDYADVKDDQNLNT--RGLLKT 168

Query: 219 VSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASK 278
              D + Q  D    ++A                      F   G  + + L+D  R+  
Sbjct: 169 FYGDHSFQGIDHHRSNSA----------------------FVTGG--AQIQLWDTSRSKS 204

Query: 279 PLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
             ++  G  D +TS++F+  +  +L S GSD   +L+DL
Sbjct: 205 TSNLSWG-ADNITSVKFNQNDSNILASTGSDNSIVLYDL 242

>KLLA0E08449g Chr5 (759718..760986) [1269 bp, 422 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 422

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 96/204 (47%), Gaps = 27/204 (13%)

Query: 151 QFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHN 210
           ++  EN + L   P  +  L++   D ++ L D         ++    H+  +ND K  N
Sbjct: 9   RYFEENNWCLKLQPLYQHGLMTSISDGSVHLLDW---GNLKTISSIQCHTTSINDMKVIN 65

Query: 211 FDQN---IFGSVSEDSTLQLHDQRIRDAAVEKVQAKK--PYNTLAFSAHSTNLFAAAGT- 264
            D +   +F + +ED  +++ D R R+  V  +Q  K  P+    FS  S +   A GT 
Sbjct: 66  SDFDTGAVFATAAEDG-VKVWDIRARNN-VASLQNDKASPF----FSLDSRHNMLACGTE 119

Query: 265 ----DSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
               D+ +++YD R  +KP+   +  H D +T ++FHP +  +L+S  +D    ++DL +
Sbjct: 120 LKDYDAELHIYDIRNWTKPVRSFVDSHHDDITDIKFHPCDSNLLMSGSTDGYVNIYDLTQ 179

Query: 320 IGAEQVPDDADDGSPEVMMIHAGH 343
                  DD +D   +V+   + H
Sbjct: 180 -------DDEEDALHQVINFASIH 196

>Smik_14.296 Chr14 complement(535060..536229) [1170 bp, 389 aa] {ON}
           YNL035C (REAL)
          Length = 389

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 50/177 (28%), Positives = 83/177 (46%), Gaps = 16/177 (9%)

Query: 152 FHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDIVNDCKWHN 210
           F     + L   P+ K  LL+G  +  I L D  T KS + I          +ND K  +
Sbjct: 11  FFGSENWCLKLQPSYKHGLLTGLSNGEIRLLDWATCKSLQNI----KASETAINDLKVID 66

Query: 211 FDQNIFGSVSEDS--TLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGT---- 264
            D +    VS  S   +++ D R  ++ +  +Q +   N+   S  S +   A GT    
Sbjct: 67  SDFSAGHLVSSASIDAVKVFDIRT-NSCIATIQNES--NSPFLSLDSRHGLLACGTELQG 123

Query: 265 -DSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
            D+ V++YD R+   PL  ++  H D VT ++FHP +  +L+S  +D  T ++DL +
Sbjct: 124 IDAAVHIYDIRKWDTPLRSLIDSHHDDVTCIKFHPSDVNILLSGSTDGYTNIYDLKQ 180

>KAFR0J00980 Chr10 (176984..178426) [1443 bp, 480 aa] {ON} Anc_5.201
           YLL011W
          Length = 480

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/182 (26%), Positives = 81/182 (44%), Gaps = 22/182 (12%)

Query: 153 HNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDC-----K 207
           H +  Y ++ N N   KL SGS D  I  W+++  ++E  ++F   +  +   C      
Sbjct: 66  HRDGVYTIAKNYNNLNKLASGSADGIIKYWNMS--TREEFVSFKAHYGLVTGLCVTPEHT 123

Query: 208 WHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQA--------KKPYNTLAFSA----HS 255
             N ++N   S  +D T++L      D +  K  A        K  Y   AF        
Sbjct: 124 SKNKNENFMLSCGDDKTVKLWSVNNDDFSNVKSDAELNTEGLLKTFYGEHAFQGIDHHRE 183

Query: 256 TNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILW 315
            + F   G  + ++L+D  R SKP+  +    D +TS++F+  E  +L S GSD   +L+
Sbjct: 184 ASTFVTGG--AQIHLWDSNR-SKPISNLSWGADNITSVKFNQNEVDILASTGSDNAIVLY 240

Query: 316 DL 317
           DL
Sbjct: 241 DL 242

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/169 (26%), Positives = 75/169 (44%), Gaps = 10/169 (5%)

Query: 145 GLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVN 204
           GLL TF  + E+ +    +  E    ++G   + I LWD      +PI   +   +D + 
Sbjct: 164 GLLKTF--YGEHAFQGIDHHREASTFVTGG--AQIHLWD--SNRSKPISNLS-WGADNIT 216

Query: 205 DCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGT 264
             K++  + +I  S   D+ + L+D R      + +Q  +  N + ++      F  A  
Sbjct: 217 SVKFNQNEVDILASTGSDNAIVLYDLRTNSPTQKIIQTMRT-NAICWNPMEAFNFVIANE 275

Query: 265 DSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI 313
           D   Y YD R  S+ LH+   H  AV  ++F P  D ++   GS  +TI
Sbjct: 276 DHNAYYYDMRNMSRALHVFKDHVSAVMDVDFSPTGDEIV--TGSYDKTI 322

>Kpol_2002.99 s2002 (237070..238533) [1464 bp, 487 aa] {ON}
           (237070..238533) [1464 nt, 488 aa]
          Length = 487

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 83/176 (47%), Gaps = 13/176 (7%)

Query: 145 GLLSTFQFHNENGY-GLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIV 203
           GL+ TF  + E+ + GL  + N    +  G+    I LWD +    +PI   T   +D V
Sbjct: 165 GLIKTF--YGEHAFQGLDHHRNNSTFVTGGA---QIQLWDSS--RSKPISNLT-WGADNV 216

Query: 204 NDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAG 263
            + K++  + +I  S   D+++ L+D R      + VQ+ +  N + ++      F  A 
Sbjct: 217 TNVKFNQTETDILASTGSDNSIVLYDLRTNSPTQKIVQSMRS-NAICWNPMEAFNFVIAN 275

Query: 264 TDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI-LWDLA 318
            D   Y YD R  S+ L++   H  AV  ++F P   G  +  GS  +TI ++D+ 
Sbjct: 276 EDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPT--GTELVTGSYDKTIRIYDIG 329

 Score = 43.9 bits (102), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 48/178 (26%), Positives = 80/178 (44%), Gaps = 23/178 (12%)

Query: 158 YGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDC---KWHNFDQN 214
           Y ++ N N   KL + S D  +  W+++  ++E + +F   +  +   C   + ++ D+N
Sbjct: 71  YCIAKNYNSLNKLAAASADGVVKYWNMS--TREELCSFKAHYGLVTGLCVSPEKYSSDKN 128

Query: 215 --IFGSVSEDSTLQLHDQRIRDAAV----EKVQAKKP-----YNTLAFSA---HSTN-LF 259
                S  +D T++L      D A     E V  K       Y   AF     H  N  F
Sbjct: 129 EHFMISCGDDKTIKLWSVNSEDFANVKDDESVNTKDGLIKTFYGEHAFQGLDHHRNNSTF 188

Query: 260 AAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
              G  + + L+D  R SKP+  +    D VT+++F+  E  +L S GSD   +L+DL
Sbjct: 189 VTGG--AQIQLWDSSR-SKPISNLTWGADNVTNVKFNQTETDILASTGSDNSIVLYDL 243

>KAFR0L01320 Chr12 complement(244228..247950) [3723 bp, 1240 aa]
           {ON} Anc_7.310 YDL195W
          Length = 1240

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 91/212 (42%), Gaps = 17/212 (8%)

Query: 120 DDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNI 179
           D+  IA     G I L+  +N+  + + +    H  +   L FN  ++  L+SGS+   I
Sbjct: 73  DNKTIAGALDNGIIELFYLSNDQLTSV-AKLTTHTSSVKTLKFNSKQENVLVSGSNKGEI 131

Query: 180 VLWDVTGKSQEPILTFTDRHS----DIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDA 235
            +WD     Q   +  T   +    + +    W+    ++F S        + D + +  
Sbjct: 132 FVWDTNKAKQTDYVPMTPGTAMTPLEEITSLSWNQSLAHVFASAGATVYASIWDLKAKKE 191

Query: 236 AVEKVQAKKPYNTLAFSA--------HSTNLFAAAGTDS--MVYLYDRRRASKPLHMM-P 284
            +  +    P   L            +ST +  A G D+   + ++D R A+ PL ++  
Sbjct: 192 VIH-LSYTSPATGLKSQLSVVEWHPNNSTRVATATGNDNDPSILVWDLRNANTPLQVLDQ 250

Query: 285 GHEDAVTSLEFHPQEDGVLISAGSDRRTILWD 316
           GH   + SL++  +++ +++S+G D   +LW+
Sbjct: 251 GHSKGIISLDWCHEDESLMLSSGRDNTVLLWN 282

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 34/153 (22%), Positives = 66/153 (43%), Gaps = 12/153 (7%)

Query: 174 SDDSNIVLWDV-TGKSQEPILTF-TDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQR 231
           S DS + LW + +  + +P+ +  TD      ND  W   ++ I G++        +   
Sbjct: 37  SSDSVLELWSLLSTDTVKPVASISTDTK---FNDLDWSYDNKTIAGALDNGIIELFYLSN 93

Query: 232 IRDAAVEKVQA-KKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKP--LHMMPGHE- 287
            +  +V K+        TL F++   N+  +      ++++D  +A +   + M PG   
Sbjct: 94  DQLTSVAKLTTHTSSVKTLKFNSKQENVLVSGSNKGEIFVWDTNKAKQTDYVPMTPGTAM 153

Query: 288 ---DAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
              + +TSL ++     V  SAG+     +WDL
Sbjct: 154 TPLEEITSLSWNQSLAHVFASAGATVYASIWDL 186

>SAKL0H09988g Chr8 complement(853060..855309) [2250 bp, 749 aa] {ON}
           similar to uniprot|P38129 Saccharomyces cerevisiae
           YBR198C TAF5 Subunit (90 kDa) of TFIID and SAGA
           complexes involved in RNA polymerase II transcription
           initiation and in chromatin modification
          Length = 749

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 100/251 (39%), Gaps = 32/251 (12%)

Query: 133 IYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPI 192
           I L N  +   S  + TF   N +   L F+ ++     +G  DS I LW + G   +  
Sbjct: 400 IKLDNLQSAAPSVCMYTFHNTNRDMTCLEFS-DDATLAAAGFQDSYIKLWSLDGTPLDSK 458

Query: 193 LTFTDR----------HSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQA 242
           L    R          HS  V    +   D     S SED T++L       + V     
Sbjct: 459 LPSKQREKINNTTLIGHSGTVYSTSFSP-DNKYLLSASEDKTVRLWSMDTYSSLVSYKGH 517

Query: 243 KKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGV 302
             P   ++FS    + FA A  D    L+       PL +  GH + V  + FHP  +G 
Sbjct: 518 NHPVWDVSFSPLG-HYFATASHDQTARLWSCDHI-YPLRIFAGHLNDVDCVSFHP--NGT 573

Query: 303 LISAGS-DRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTA 361
            +  GS D+   +WD+              G+ + + +  GH + +   +++P+  WL +
Sbjct: 574 YVFTGSTDKTCRMWDI--------------GTGDSVRLFLGHTAPVISTAVSPDGRWL-S 618

Query: 362 TAEEENIVQVW 372
           T  E+ I+ VW
Sbjct: 619 TGSEDGIINVW 629

 Score = 38.9 bits (89), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 95/219 (43%), Gaps = 15/219 (6%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNE 166
           H   V    + P D+  + + S   T+ L++   +  S L+S ++ HN   + +SF+P  
Sbjct: 475 HSGTVYSTSFSP-DNKYLLSASEDKTVRLWSM--DTYSSLVS-YKGHNHPVWDVSFSP-L 529

Query: 167 KGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDC-KWHNFDQNIFGSVSEDSTL 225
                + S D    LW        P+  F    +D+  DC  +H     +F + S D T 
Sbjct: 530 GHYFATASHDQTARLWSC--DHIYPLRIFAGHLNDV--DCVSFHPNGTYVF-TGSTDKTC 584

Query: 226 QLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPG 285
           ++ D    D+    +    P  + A S     L +    D ++ ++D     K L  M G
Sbjct: 585 RMWDIGTGDSVRLFLGHTAPVISTAVSPDGRWL-STGSEDGIINVWDIG-TGKRLKQMRG 642

Query: 286 H-EDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAE 323
           H ++AV SL +  +E  VL+S G+D    +WDL    AE
Sbjct: 643 HGKNAVYSLSYS-KEGTVLVSGGADHSVRVWDLKRSTAE 680

>KNAG0E02310 Chr5 (463866..464402,464772..465194) [960 bp, 319 aa]
           {ON} Anc_2.431 YMR116C
          Length = 319

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 60/242 (24%), Positives = 106/242 (43%), Gaps = 28/242 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +  +   L+S S D  ++ W +TG  Q+   P+ +F   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKFGVPVRSFKG-HSHI 67

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V D      D     S S D TL+L D    +     V  K    ++A    ++ + + +
Sbjct: 68  VQDVT-LTPDGAYALSASWDKTLRLWDVATGETYQRFVGHKGDVMSVAIDRKASMIISGS 126

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQE----DGV-LISAGSDRRTILWDL 317
             D  + ++  +   + L  + GH D V+ +   P E    D V +ISAG+D+    W+L
Sbjct: 127 -RDKSIKVWTIK--GQCLATLLGHNDWVSQVRVAPTEKENDDTVTVISAGNDKMVKAWNL 183

Query: 318 AEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSK 377
            +    Q+  D             GH +++N  + +P+   L A+A++   + +W   +K
Sbjct: 184 NQF---QIEAD-----------FVGHNANVNTITASPDGT-LIASADKSGEIMLWNLHNK 228

Query: 378 LP 379
            P
Sbjct: 229 TP 230

>TPHA0D03590 Chr4 (752790..754586) [1797 bp, 598 aa] {ON} Anc_6.276
           YPL247C
          Length = 598

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 74/331 (22%), Positives = 126/331 (38%), Gaps = 67/331 (20%)

Query: 22  SNVPLMYDFVSETNLTWPSLTLEWLPGSRSSNRQEMILGTHTSDEEQNYLKIAAIYLPDE 81
           SN  L ++ V+E N+T+P   ++WLP   +  +        TS E    L+I ++     
Sbjct: 190 SNDLLTWEKVAECNVTYPVSNIQWLPSVPNPRK------LATSSE---CLRIWSL----- 235

Query: 82  VVPDAEPKEEEEVLKSNVK-------IIKKFEHENEVTRARYMPQDDNLIATISGVGTIY 134
              D    +   V  +N+          K    +  ++  +Y  Q       I    T  
Sbjct: 236 ---DDNSMDNSSVFNNNISNNSRHNTYKKSLTEQVNLSLCKYNEQHQ-----IINNSTNS 287

Query: 135 LYNRANEVESGLLS-TFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPIL 193
           + N++N    G L     FH        +N  +   L+S S D+  ++WD+  +S   + 
Sbjct: 288 VSNKSNARLLGQLPPVTSFH--------WNSIDTNLLISSSIDTTCIVWDL--QSSNYVK 337

Query: 194 TFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQR------IRDAAVEKVQAKKPYN 247
           T    H   V D K+      +F S   D ++++ D R      I       +Q    +N
Sbjct: 338 TQLIAHDSEVFDVKFLIQSTQLFASCGGDGSIRVFDLRALQHSTIIYETANDLQGNNTFN 397

Query: 248 T--------------------LAFSAHSTNLFAAAGTDS-MVYLYDRRRASKPLHMMPGH 286
                                L  S    NL A  G D   + + D R    P+ ++ GH
Sbjct: 398 NDVTTKIDNSSANSLSHALLRLEPSPTDPNLIATFGLDKKAILILDMRNPGVPVLVLSGH 457

Query: 287 EDAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
             +V  +++HP +  VL+S G D + + WDL
Sbjct: 458 SPSVNQIKWHPSKPYVLLSCGDDCQVLYWDL 488

>NCAS0B03690 Chr2 complement(657488..660925) [3438 bp, 1145 aa] {ON}
           Anc_8.288
          Length = 1145

 Score = 52.4 bits (124), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/195 (21%), Positives = 90/195 (46%), Gaps = 11/195 (5%)

Query: 180 VLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEK 239
           ++W++   S + I      HS  + D  ++  + +I  + S D+ +   D R        
Sbjct: 97  LIWNLARTSSDAIDHVLHGHSRAITDINFNPENPDILATCSVDTYVHAWDMRSPHRPFYT 156

Query: 240 VQA-KKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQ 298
             A +   + + ++   +N+ A+A ++  +Y++D R  S PLH + GH+ +V S++F+  
Sbjct: 157 TSAWRSGASQVKWNYKDSNILASAHSND-IYIWDLRMGSTPLHKLVGHDSSVNSIDFNRF 215

Query: 299 EDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNP---- 354
           +   ++S+ +D     WD+++ G++          P   +    +    N F + P    
Sbjct: 216 KSSEIMSSSNDGTVKFWDISK-GSDNCTSTVSTDFP---IWRGRYLPFGNGFCIMPQEGG 271

Query: 355 -NIPWLTATAEEENI 368
            N  +L+   E+EN+
Sbjct: 272 GNAVYLSTLKEQENL 286

>KLLA0C08547g Chr3 (749737..751284) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability,
          Length = 515

 Score = 52.0 bits (123), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/312 (23%), Positives = 119/312 (38%), Gaps = 71/312 (22%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSF---- 162
           H N V    + P D  LIAT S   TI L+  +     G     + H++    LS+    
Sbjct: 185 HHNWVLCCSWSP-DGELIATGSMDNTIRLWESSKGKPYG--DALRGHSKWITSLSWEPIH 241

Query: 163 --NPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVS 220
              P +K +L + S D  I +WD T   +  +LT    H+  V+  KW    +N+  S S
Sbjct: 242 LVKPGDKPRLATASKDGTIKIWDTT--RRVCLLTLCG-HTSSVSCVKWGG--KNVLYSGS 296

Query: 221 EDSTLQLHDQRIRDAAV------------------------------------EKVQAK- 243
            D T++  D  +    +                                    E+ Q K 
Sbjct: 297 HDKTIRCWDMNLNGKCINILKSHAHWVNHLSLSTDYALRLGAFDHKGETPASPEEAQQKA 356

Query: 244 -KPYNTLA-FSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDG 301
            K Y  +A        L   A  D  +YL++  +++KP+  M GH+  V  + F P  DG
Sbjct: 357 LKNYEKVAKRKGDFEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSP--DG 414

Query: 302 -VLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLT 360
             ++SA  D    LW            D  DG  + +    GH +S+   + + +   L 
Sbjct: 415 RYIVSASFDNSIKLW------------DGRDG--KFLSTFRGHVASVYQVAWSSDCR-LL 459

Query: 361 ATAEEENIVQVW 372
            +  ++  ++VW
Sbjct: 460 VSCSKDTTLKVW 471

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/185 (21%), Positives = 74/185 (40%), Gaps = 30/185 (16%)

Query: 148 STFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCK 207
           S    H       +F PN   ++++G+ D+   +WD    +Q  + T    H+ ++  C 
Sbjct: 137 SAIAGHGSTILCSAFAPNTSSRMVTGAGDNTACIWDC--DTQTRMCTLQGHHNWVLC-CS 193

Query: 208 WHNFDQNIFGSVSEDSTLQL---------------HDQRIRDAAVEKVQAKKPYNTLAFS 252
           W + D  +  + S D+T++L               H + I   + E +   KP +     
Sbjct: 194 W-SPDGELIATGSMDNTIRLWESSKGKPYGDALRGHSKWITSLSWEPIHLVKPGD----- 247

Query: 253 AHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRT 312
                  A A  D  + ++D  R    L  + GH  +V+ +++  +   VL S   D+  
Sbjct: 248 ---KPRLATASKDGTIKIWDTTRRV-CLLTLCGHTSSVSCVKWGGKN--VLYSGSHDKTI 301

Query: 313 ILWDL 317
             WD+
Sbjct: 302 RCWDM 306

>TBLA0F02230 Chr6 (551746..555396) [3651 bp, 1216 aa] {ON} Anc_7.322
           YDL145C
          Length = 1216

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 54/248 (21%), Positives = 104/248 (41%), Gaps = 26/248 (10%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           +L+ F+  +    G++F+P+    L++    S I LWD    +   +L   + H   V  
Sbjct: 3   MLTKFESKSTRAKGIAFHPSRPWALVALFS-STIQLWDYRMGT---LLHRFEDHEGPVRS 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q +F S  +D T+++      +  +  +     Y    F  H      +A  D
Sbjct: 59  VDFHP-TQPLFVSAGDDCTIKVWSLET-NKCLYTLTGHLDYVRTVFFHHELPWIISASDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA------- 318
             + +++ +   K +  + GH   V   +FHP ED +++SA  D    +WD++       
Sbjct: 117 QTIRIWNWQN-RKEIANLIGHNHFVMCAQFHPTED-LVVSASLDETVRVWDISGLRKKHS 174

Query: 319 ----------EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENI 368
                     ++  +Q   D   G   V  I  GH   +N  S +P +P L  +  ++  
Sbjct: 175 APAQSASFEEQMSTQQNILDGGFGDCVVKFILEGHTRGVNWVSFHPTLP-LIVSGSDDRQ 233

Query: 369 VQVWKPSS 376
           V++W+ S+
Sbjct: 234 VKLWRMSA 241

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 43/177 (24%), Positives = 77/177 (43%), Gaps = 35/177 (19%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           ++SGSDD  + LW ++      + T    H++ V+   +H   QN+  SV ED TL++ D
Sbjct: 225 IVSGSDDRQVKLWRMSATKAWEVDT-CRGHTNNVDSVIFHP-HQNLIISVGEDKTLRVWD 282

Query: 230 QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA-GTDSMVYLYDRRR------------- 275
              R   V++ + +     L  +  + NLF AA  +  M++  DR R             
Sbjct: 283 LDKR-TPVKQFKRENDRFWLIAAHPNINLFGAAHDSGVMIFKLDRERPPATIHQNQLFFI 341

Query: 276 -ASKPLHMMPGHED-----------------AVTSLEFHPQEDGVLISAGSDRRTIL 314
             SK +     H++                 A  S+ ++P +  VL++ G+DR  ++
Sbjct: 342 NKSKQVQTFDYHKNVASLPYVSLKNIGQTWNAFRSVSYNPSQHSVLVNEGNDRFALV 398

 Score = 39.3 bits (90), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 55/235 (23%), Positives = 93/235 (39%), Gaps = 32/235 (13%)

Query: 132 TIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEP 191
           TI ++N  N  E   ++    HN       F+P E   ++S S D  + +WD++G     
Sbjct: 118 TIRIWNWQNRKE---IANLIGHNHFVMCAQFHPTED-LVVSASLDETVRVWDISG----- 168

Query: 192 ILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQ-LHDQRIRDAAVEKVQAKKPYNTLA 250
                 +HS         +F++ +       ST Q + D    D  V+ +          
Sbjct: 169 ---LRKKHSAPAQSA---SFEEQM-------STQQNILDGGFGDCVVKFILEGHTRGVNW 215

Query: 251 FSAHSTNLFAAAGTDSMVYLYDRRRASKP--LHMMPGHEDAVTSLEFHPQEDGVLISAGS 308
            S H T     +G+D       R  A+K   +    GH + V S+ FHP ++ ++IS G 
Sbjct: 216 VSFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQN-LIISVGE 274

Query: 309 DRRTILWDL-AEIGAEQVPDDADD-----GSPEVMMIHAGHRSSINDFSMNPNIP 357
           D+   +WDL      +Q   + D        P + +  A H S +  F ++   P
Sbjct: 275 DKTLRVWDLDKRTPVKQFKRENDRFWLIAAHPNINLFGAAHDSGVMIFKLDRERP 329

>SAKL0G12892g Chr7 complement(1102157..1103587) [1431 bp, 476 aa]
           {ON} highly similar to uniprot|P33750 Saccharomyces
           cerevisiae YLL011W
          Length = 476

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 79/169 (46%), Gaps = 10/169 (5%)

Query: 145 GLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVN 204
           GLL TF  H E  +    +   K   ++G   + I LWD TG+S+ P+   +   +D V 
Sbjct: 165 GLLKTF--HGEYAFQSIDHHRTKSTFVTGG--AQIELWD-TGRSK-PVSNLS-WGADNVT 217

Query: 205 DCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGT 264
             K++  + +I  S   D+++ L+D R      + VQ  +  N + ++      F  A  
Sbjct: 218 SVKFNQNETDILASTGSDNSVVLYDLRTNSPTQKIVQTMRT-NAICWNPMEAFNFVIANE 276

Query: 265 DSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI 313
           D   Y YD R  S+ L++   H  AV  ++F P  D ++   GS  +T+
Sbjct: 277 DHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIV--TGSYDKTV 323

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 53/203 (26%), Positives = 79/203 (38%), Gaps = 47/203 (23%)

Query: 122 NLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGK------LLSGSD 175
           N +AT SG G +  +N +   E   L +F+ H     GL   P    K      +LS  D
Sbjct: 81  NKLATASGDGVVKYWNMSTREE---LCSFKAHYGLVTGLCVTPQHLSKNKNENYMLSCGD 137

Query: 176 DSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDA 235
           D  I LW V                           + + F S  ++  L   D  ++  
Sbjct: 138 DKMIKLWSV---------------------------NSDDFSSTRDNDELNTGDGLLKTF 170

Query: 236 AVEKVQAKKPYNTLAFSAHST-NLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLE 294
             E       Y   +   H T + F   G  + + L+D  R SKP+  +    D VTS++
Sbjct: 171 HGE-------YAFQSIDHHRTKSTFVTGG--AQIELWDTGR-SKPVSNLSWGADNVTSVK 220

Query: 295 FHPQEDGVLISAGSDRRTILWDL 317
           F+  E  +L S GSD   +L+DL
Sbjct: 221 FNQNETDILASTGSDNSVVLYDL 243

>Kwal_56.24478 s56 complement(1010876..1014766) [3891 bp, 1296 aa]
           {ON} YDL195W (SEC31) - Component (p150) of COPII coat of
           secretory pathway vesicles [contig 161] FULL
          Length = 1296

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 95/224 (42%), Gaps = 48/224 (21%)

Query: 101 IIKKFEHENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTF-----QFHNE 155
           I K  +H   V   R+  +  N++ +    G IY+++ AN++E+   + F         +
Sbjct: 97  IAKLAQHSTPVKTVRFNAKQHNVLCSGGSKGEIYIWD-ANKIETPGYAPFVPGTAMTPMD 155

Query: 156 NGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNI 215
             Y L++N N+     S        +WD+  K +   L+ T                 +I
Sbjct: 156 EIYSLAWNQNQGHVFASAGSSGFASIWDLKAKKEVIHLSHTS----------------SI 199

Query: 216 FGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDS--MVYLYDR 273
            G  ++ S ++ H                P N       ST +  A+G+DS   + ++D 
Sbjct: 200 TGQKNQLSIVEWH----------------PNN-------STRIATASGSDSDPSILVWDL 236

Query: 274 RRASKPLHMMP-GHEDAVTSLEFHPQEDGVLISAGSDRRTILWD 316
           R A+ PL  +  GH   V SL++  Q++ +L+S+G D   +LW+
Sbjct: 237 RNANVPLQTLSQGHTKGVLSLDWCKQDETLLLSSGRDNSCVLWN 280

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 61/150 (40%), Gaps = 22/150 (14%)

Query: 204 NDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAG 263
           ND  W ++D ++     ++  ++        +  +  Q   P  T+ F+A   N+  + G
Sbjct: 66  NDLDW-SYDNSVLTGALDNGVVEFFSPSEYKSIAKLAQHSTPVKTVRFNAKQHNVLCSGG 124

Query: 264 TDSMVYLYDRRRASKPLH--MMPGHE----DAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
           +   +Y++D  +   P +   +PG      D + SL ++  +  V  SAGS     +WDL
Sbjct: 125 SKGEIYIWDANKIETPGYAPFVPGTAMTPMDEIYSLAWNQNQGHVFASAGSSGFASIWDL 184

Query: 318 AEIGAEQVPDDADDGSPEVMMIHAGHRSSI 347
                            +  +IH  H SSI
Sbjct: 185 KA---------------KKEVIHLSHTSSI 199

>SAKL0F10384g Chr6 complement(799553..803338) [3786 bp, 1261 aa]
           {ON} similar to uniprot|P38968 Saccharomyces cerevisiae
           YDL195W SEC31 involved in protein transport from
           endoplasmic reticulum to Golgi Component (p150) of COPII
           coat of secretory pathway vesicles
          Length = 1261

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 74/171 (43%), Gaps = 14/171 (8%)

Query: 160 LSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHS----DIVNDCKWHNFDQNI 215
           L FN  +   L SG     I +WD+   +    + F+   +    D V    W+    ++
Sbjct: 110 LKFNAKQDNVLCSGDSRGEIFIWDINKITSSGYVPFSPGVAMTPIDEVYSLAWNQSLAHV 169

Query: 216 FGSVSEDSTLQLHDQRIRDAAVE------KVQAKKPYNTLAF-SAHSTNLFAAAGTDS-- 266
           F S        + D + +   +          AK   + + +  ++ST +  A G D+  
Sbjct: 170 FASAGSSGYTSIWDLKAKKEVLHLSYTSPSTGAKNHLSVVEWHPSNSTKIATATGNDNDP 229

Query: 267 MVYLYDRRRASKPLHMMP-GHEDAVTSLEFHPQEDGVLISAGSDRRTILWD 316
           ++ ++D R A  PL  M  GH   + SL++  Q++ +L+S+G D    LW+
Sbjct: 230 VILVWDLRNAKAPLQAMSQGHSKGILSLDWCKQDENLLLSSGRDNTCALWN 280

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 36/151 (23%), Positives = 66/151 (43%), Gaps = 10/151 (6%)

Query: 174 SDDSNIVLWDV-TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRI 232
           S +S + LW + +   ++P  + T   S   ND  W   D +I     ++  ++    + 
Sbjct: 37  SSESTLELWSLLSADVEKPQGSIT--ASAKFNDLDWSP-DNSILAGALDNGIVEFFSPKE 93

Query: 233 RDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRR--ASKPLHMMPGHE--- 287
             +  +  +   P NTL F+A   N+  +  +   ++++D  +  +S  +   PG     
Sbjct: 94  LKSVAKISKHTTPVNTLKFNAKQDNVLCSGDSRGEIFIWDINKITSSGYVPFSPGVAMTP 153

Query: 288 -DAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
            D V SL ++     V  SAGS   T +WDL
Sbjct: 154 IDEVYSLAWNQSLAHVFASAGSSGYTSIWDL 184

 Score = 34.3 bits (77), Expect = 0.58,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 52/105 (49%), Gaps = 8/105 (7%)

Query: 220 SEDSTLQLHDQRIRDAAVEKVQ----AKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRR 275
           S +STL+L    +  A VEK Q    A   +N L +S  ++ + A A  + +V  +  + 
Sbjct: 37  SSESTLELWS--LLSADVEKPQGSITASAKFNDLDWSPDNS-ILAGALDNGIVEFFSPKE 93

Query: 276 ASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEI 320
             K +  +  H   V +L+F+ ++D VL S  S     +WD+ +I
Sbjct: 94  L-KSVAKISKHTTPVNTLKFNAKQDNVLCSGDSRGEIFIWDINKI 137

>Ecym_2498 Chr2 complement(974601..976229) [1629 bp, 542 aa] {ON}
           similar to Ashbya gossypii AER263C
          Length = 542

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/182 (24%), Positives = 83/182 (45%), Gaps = 16/182 (8%)

Query: 148 STFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCK 207
           S    H+      +F P+   ++++GS D+N  +WD    +Q PI T    H++ V    
Sbjct: 164 SAIAGHSSTILCSTFAPHTSSRMVTGSGDNNARIWDC--DTQTPIYTLKG-HTNWVLCVA 220

Query: 208 WHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNL--------F 259
           W + D  +  + S D+T++L D +  D+  + ++    + T + S    +L         
Sbjct: 221 W-SADGEVIATGSMDNTIRLWDAQTGDSKGDALRGHSKWIT-SMSWEPIHLVTPGNKPRI 278

Query: 260 AAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
           A+A  D  + ++D  R    L  + GH  +V+ +++  Q  GV+ +   DR    WD+  
Sbjct: 279 ASASKDGTIKVWDTVRRQCIL-TLSGHTSSVSCIKWGGQ--GVIYTGSHDRTIRCWDMNA 335

Query: 320 IG 321
            G
Sbjct: 336 GG 337

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 61/262 (23%), Positives = 105/262 (40%), Gaps = 42/262 (16%)

Query: 118 PQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDS 177
           P +   IA+ S  GTI +++    V    + T   H  +   + +    +G + +GS D 
Sbjct: 272 PGNKPRIASASKDGTIKVWD---TVRRQCILTLSGHTSSVSCIKWGG--QGVIYTGSHDR 326

Query: 178 NIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLH---DQRIRD 234
            I  WD+    +   +     H+  VN             S+S D  L++        R 
Sbjct: 327 TIRCWDMNAGGK--CINILKSHAHWVNHL-----------SLSTDYALKVGAFDHTYSRP 373

Query: 235 AAVEKVQ--AKKPYNTLA-FSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVT 291
           A  E+ Q  A K Y  +A  +     L A A  D  +YL++  + +KPL  M GH+  V 
Sbjct: 374 ATAEEAQKRALKNYEKVAKRNGVLEELIATASDDFTMYLWNPLKGTKPLTRMTGHQKLVN 433

Query: 292 SLEFHPQEDG-VLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDF 350
            + F P  DG  ++SA  D    LW              +  S + +    GH +S+   
Sbjct: 434 HVAFSP--DGRYIVSASFDNSIKLW--------------EGSSGKFISTFRGHVASVYQV 477

Query: 351 SMNPNIPWLTATAEEENIVQVW 372
           + + +   L  +  ++  ++VW
Sbjct: 478 AWSSDCR-LLVSCSKDTTLKVW 498

>SAKL0H06666g Chr8 complement(586110..587435) [1326 bp, 441 aa] {ON}
           highly similar to uniprot|Q75BY3 Ashbya gossypii ACR137W
           PRP46 Pre-mRNA-splicing factor PRP46 and similar to
           YPL151C uniprot|Q12417 Saccharomyces cerevisiae YPL151C
           PRP46 Splicing factor that is found in the Cef1p
           subcomplex of the spliceosome
          Length = 441

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 53/218 (24%), Positives = 94/218 (43%), Gaps = 39/218 (17%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDV-TGKSQEPILTFTDRHSDIVN 204
           L+     HN     ++ +P +     +GS+D+ I +WD+ TGK +   LT +     + +
Sbjct: 121 LMRVINGHNGWVRTVAVDPIDNEWFATGSNDTTIKIWDLATGKLK---LTLSGHIMTVKD 177

Query: 205 DC--KWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHST------ 256
            C  K H +      S SED  ++  D       +EK +  + Y+      H+       
Sbjct: 178 ICISKRHPY----MFSASEDKLVKCWD-------LEKNRVIRDYHGHLSGVHTVDIHPTL 226

Query: 257 NLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWD 316
           NL A AG DS+V L+D  R   P+  M GH+  +  ++  P  D  ++S  +D    LWD
Sbjct: 227 NLIATAGRDSVVRLWD-IRTKLPVMTMAGHKSPINRVKCLP-VDPQVVSCSADATVRLWD 284

Query: 317 LAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNP 354
           +               + + + +   H+ S+ D  ++P
Sbjct: 285 IT--------------AGKTLKVLTHHKRSVRDIGIHP 308

 Score = 36.2 bits (82), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 53/124 (42%), Gaps = 23/124 (18%)

Query: 259 FAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSL---EFHPQEDGVLISAGSDRRTILW 315
           FA    D+ + ++D       L  + GH   V  +   + HP     + SA  D+    W
Sbjct: 145 FATGSNDTTIKIWDLATGKLKL-TLSGHIMTVKDICISKRHP----YMFSASEDKLVKCW 199

Query: 316 DLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPS 375
           DL +                V+  + GH S ++   ++P +  L ATA  +++V++W   
Sbjct: 200 DLEK--------------NRVIRDYHGHLSGVHTVDIHPTLN-LIATAGRDSVVRLWDIR 244

Query: 376 SKLP 379
           +KLP
Sbjct: 245 TKLP 248

>Kwal_23.6324 s23 complement(1531252..1532796) [1545 bp, 514 aa]
           {ON} YCR072C - Protein required for cell viability
           [contig 17] FULL
          Length = 514

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 69/256 (26%), Positives = 105/256 (41%), Gaps = 56/256 (21%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNP-- 164
           H N V    + P D  LIAT S   TI L++ +N+ ES      + H +    L++ P  
Sbjct: 184 HFNWVLCVAWCP-DGELIATGSMDNTIRLWD-SNKGES-YGEALRGHAKWITSLTWEPMH 240

Query: 165 ----NEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVS 220
                ++ +L S S D  I +WD T   +  +LT +  H++ V+  KW    + I  S S
Sbjct: 241 LVKAGDQPRLASASKDGTIKIWDTT--RRVCVLTLSG-HTNSVSCVKWGG--RGILYSGS 295

Query: 221 EDSTLQLHDQR--------------------------IRDAAVE------------KVQA 242
            D T++  D                            +R  A +            + +A
Sbjct: 296 HDKTIRAWDMAAGGKCINILKSHAHWINHLSLNTDYALRVGAFDHTGEKPSSPEEARAKA 355

Query: 243 KKPYNTLAF-SAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDG 301
            K Y  +A  +     L   A  D  +YL+D  +ASKP+  M GH+  V  + F P  DG
Sbjct: 356 LKNYEKIAKKNGQLEELMVTASDDFTMYLWDPLKASKPITRMTGHQKLVNHVAFSP--DG 413

Query: 302 -VLISAGSDRRTILWD 316
             ++SA  D    LWD
Sbjct: 414 RYIVSASFDNSIKLWD 429

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 47/213 (22%), Positives = 86/213 (40%), Gaps = 27/213 (12%)

Query: 148 STFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCK 207
           S    H       +F P+  G++++GS D+   +WD    +  P+ T    H + V    
Sbjct: 136 SAIAGHGSTILCSAFAPHTSGRMVTGSGDNTARIWDC--NTNTPMYTLKG-HFNWVLCVA 192

Query: 208 WHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTL-------AFSAHSTNLFA 260
           W   D  +  + S D+T++L D    ++  E ++    + T           A      A
Sbjct: 193 WCP-DGELIATGSMDNTIRLWDSNKGESYGEALRGHAKWITSLTWEPMHLVKAGDQPRLA 251

Query: 261 AAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEI 320
           +A  D  + ++D  R    L  + GH ++V+ +++  +  G+L S   D+    WD+A  
Sbjct: 252 SASKDGTIKIWDTTRRVCVL-TLSGHTNSVSCVKWGGR--GILYSGSHDKTIRAWDMAAG 308

Query: 321 GAEQVPDDADDGSPEVMMIHAGHRSSINDFSMN 353
           G             + + I   H   IN  S+N
Sbjct: 309 G-------------KCINILKSHAHWINHLSLN 328

>KLTH0A06754g Chr1 complement(560921..562465) [1545 bp, 514 aa] {ON}
           highly similar to uniprot|P25382 Saccharomyces
           cerevisiae YCR072C Protein required for cell viability
          Length = 514

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 63/268 (23%), Positives = 111/268 (41%), Gaps = 44/268 (16%)

Query: 118 PQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDS 177
           P D   +A+ S  GTI +++ A  V    L T   H  +   + +    +G L SGS D 
Sbjct: 244 PGDKPRLASASKDGTIKIWDTARRV---CLFTLSGHTNSVSCVKWG--GRGVLYSGSHDK 298

Query: 178 NIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQL----HDQRIR 233
            I  WD+    +   +     H+  +N             S+S D  L++    H  + +
Sbjct: 299 TIRAWDMNAGGK--CINILKSHAHWINHL-----------SLSTDYALRVGAFDHTGK-K 344

Query: 234 DAAVEKVQAKKPYNTLAFSAHSTNL---FAAAGTDSMVYLYDRRRASKPLHMMPGHEDAV 290
            ++ E+ +AK   N    +  +  L      A  D  +YL+D  +++KP+  M GH+  V
Sbjct: 345 PSSPEEARAKALENYEKIAKKNGKLEELMVTASDDFTMYLWDPIKSTKPITRMTGHQKLV 404

Query: 291 TSLEFHPQEDG-VLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSIND 349
             + F P  DG  ++SA  D    LW            D  DG+   +    GH +S+  
Sbjct: 405 NHVAFSP--DGRYIVSASFDNSIKLW------------DGRDGT--FIATFRGHVASVYQ 448

Query: 350 FSMNPNIPWLTATAEEENIVQVWKPSSK 377
            + + +   L  +  ++  ++VW   +K
Sbjct: 449 VAWSSDCR-LLVSCSKDTTLKVWDVRTK 475

 Score = 36.6 bits (83), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 56/268 (20%), Positives = 106/268 (39%), Gaps = 56/268 (20%)

Query: 80  DEVVP-------DAEPKEEEEV--LKSNVKIIKKFEHENEVTRARYMPQDD--NLIATIS 128
           DE VP       DAE  + E++  +K N+         N + +  Y   +D   ++ T  
Sbjct: 72  DEPVPYTFSCMVDAEKGKPEQLVDIKDNI--------YNSILKPGYKTTEDFITIVYTPR 123

Query: 129 GVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKS 188
            V  +    R++   +G       H       +F P+   ++++G+ D+   +WD    +
Sbjct: 124 AVFKVRPVTRSSSAIAG-------HGSTILCSAFAPHTSSRMVTGAGDNTARIWDCN--T 174

Query: 189 QEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQL---------------HDQRIR 233
             P+ T    H + V    W + D  +  + S D+T++L               H + I 
Sbjct: 175 NTPMQTLKG-HFNWVLCVAW-SPDGELIATGSMDNTIRLWQSEKGENFGDALRGHSKWIT 232

Query: 234 DAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSL 293
             + E +   KP +            A+A  D  + ++D  R    L  + GH ++V+ +
Sbjct: 233 SLSWEPIHLVKPGD--------KPRLASASKDGTIKIWDTARRV-CLFTLSGHTNSVSCV 283

Query: 294 EFHPQEDGVLISAGSDRRTILWDLAEIG 321
           ++  +  GVL S   D+    WD+   G
Sbjct: 284 KWGGR--GVLYSGSHDKTIRAWDMNAGG 309

>AER255C Chr5 complement(1107932..1109335) [1404 bp, 467 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR364C
           (CDC40)
          Length = 467

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/161 (25%), Positives = 77/161 (47%), Gaps = 6/161 (3%)

Query: 160 LSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSV 219
           ++F+P  K +LL G  DS I  +D+    ++ ++   D H   +N  ++   D + F S 
Sbjct: 265 MTFHPQNKEQLLVGFSDSKIRHFDLRVDKKDGVIQIYDHHLAAINALRYFP-DGSKFISS 323

Query: 220 SEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAH-STNLFAAAGTDSMVYLYDRRRASK 278
           S+D ++++ + +I +  ++++     Y       H   N FAA   D+ +Y+Y  +   K
Sbjct: 324 SDDKSIRIWENQI-NIPIKQISDTDQYPAPWIQLHPEHNQFAAQSMDNSIYVYSMKPKYK 382

Query: 279 --PLHMMPGHEDAVTSLEFHPQEDGVLISAG-SDRRTILWD 316
             P     GH+ A  +  F    DG  ++AG +  R  +WD
Sbjct: 383 RHPRKAFRGHKSAGYNSMFDIAPDGRYVAAGDTSGRLFIWD 423

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 47/221 (21%), Positives = 88/221 (39%), Gaps = 17/221 (7%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           +L  +  H+     L F        LSG +D  + +WD+    +  +L     H   ++ 
Sbjct: 166 ILHVYDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDMY--HERLLLRDYCGHRKAISA 223

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             + + D   F S S D T+++ D    D  + ++  K   N + F   +        +D
Sbjct: 224 TSFSH-DNVQFASSSYDKTVKIWDTETGD-IINRLSFKATPNCMTFHPQNKEQLLVGFSD 281

Query: 266 SMVYLYDRRRASKP--LHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWD-LAEIGA 322
           S +  +D R   K   + +   H  A+ +L + P +    IS+  D+   +W+    I  
Sbjct: 282 SKIRHFDLRVDKKDGVIQIYDHHLAAINALRYFP-DGSKFISSSDDKSIRIWENQINIPI 340

Query: 323 EQVPDDADDGSPEVMMIHAGHR--------SSINDFSMNPN 355
           +Q+ D     +P + + H  H         +SI  +SM P 
Sbjct: 341 KQISDTDQYPAPWIQL-HPEHNQFAAQSMDNSIYVYSMKPK 380

 Score = 35.0 bits (79), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 23/94 (24%), Positives = 47/94 (50%), Gaps = 16/94 (17%)

Query: 280 LHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMI 339
           LH+  GH+   T+LEF  +   + +S G+D    +WD+     E++          ++  
Sbjct: 167 LHVYDGHDRGTTALEFLRKTGHLFLSGGNDGVLKIWDMYH---ERL----------LLRD 213

Query: 340 HAGHRSSINDFSM-NPNIPWLTATAEEENIVQVW 372
           + GHR +I+  S  + N+ +  A++  +  V++W
Sbjct: 214 YCGHRKAISATSFSHDNVQF--ASSSYDKTVKIW 245

>TBLA0C05010 Chr3 complement(1217846..1219564) [1719 bp, 572 aa]
           {ON} Anc_7.356 YLR196W
          Length = 572

 Score = 51.6 bits (122), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/170 (28%), Positives = 73/170 (42%), Gaps = 11/170 (6%)

Query: 153 HNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFD 212
           H +    L+ N   +  L S S DS + LWD+   +    L     H   V+  +WH  D
Sbjct: 292 HTDAVLSLAHNQLFRAILASTSADSTVKLWDLNSGTAARSLNQV-HHGSRVSSSQWHQTD 350

Query: 213 QNIFGSVSEDSTLQLHDQRIRD----AAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSM- 267
            +I  +   DS + L D RI D    +    V + +   T +F    T L   AGTD+  
Sbjct: 351 GSILLTAGYDSKIALTDVRISDEKNMSKYWNVMSGEEIETASFINDYTVL---AGTDNGN 407

Query: 268 VYLYDRRRA-SKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI-LW 315
           VY +D R   SKPL  +  H+  +  L       G+L++     + I LW
Sbjct: 408 VYSFDVRSVESKPLWTLKAHDAGIAGLSVPKNIPGMLLTGAMGEKVIKLW 457

>TBLA0C01840 Chr3 (435021..436292) [1272 bp, 423 aa] {ON} Anc_8.672
           YPL151C
          Length = 423

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 101/234 (43%), Gaps = 35/234 (14%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           L+   + HN     +  +P +     +GS+D+ I +WD+     +  L+    H+  V D
Sbjct: 103 LMRVIKGHNGWVRCVQIDPVDNEWFATGSNDTTIKIWDLASGKLKITLS---GHAMTVRD 159

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHST------NLF 259
               N    +F S SED   +  D       +EK  A + Y+      H+       +L 
Sbjct: 160 IAISNRHPYLF-SASEDKLAKCWD-------LEKNTAIRDYHGHLSGVHTVDIHPTLDLI 211

Query: 260 AAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
           A AG DS+V L+D  R+  P+  + GH+  +  +   P    V IS+  D    LWD+  
Sbjct: 212 ATAGRDSVVKLWD-IRSRVPVVTLIGHKSPINKVHCLPVNPQV-ISSSVDATIRLWDIVA 269

Query: 320 IGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
             A +V            + H  H+ SI D + +P+  +  ATA  ++I + WK
Sbjct: 270 GKASKV------------LTH--HKRSIRDIAFHPS-EFSMATACTDDI-RSWK 307

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 56/127 (44%), Gaps = 25/127 (19%)

Query: 259 FAAAGTDSMVYLYDRRRASKPLHM-MPGHEDAVTSLEF---HPQEDGVLISAGSDRRTIL 314
           FA    D+ + ++D   AS  L + + GH   V  +     HP     L SA  D+    
Sbjct: 127 FATGSNDTTIKIWDL--ASGKLKITLSGHAMTVRDIAISNRHP----YLFSASEDKLAKC 180

Query: 315 WDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKP 374
           WDL +  A              +  + GH S ++   ++P +  L ATA  +++V++W  
Sbjct: 181 WDLEKNTA--------------IRDYHGHLSGVHTVDIHPTLD-LIATAGRDSVVKLWDI 225

Query: 375 SSKLPRI 381
            S++P +
Sbjct: 226 RSRVPVV 232

 Score = 31.6 bits (70), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 19/95 (20%), Positives = 43/95 (45%), Gaps = 15/95 (15%)

Query: 278 KPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVM 337
           K + ++ GH   V  ++  P ++    +  +D    +WDLA              S ++ 
Sbjct: 102 KLMRVIKGHNGWVRCVQIDPVDNEWFATGSNDTTIKIWDLA--------------SGKLK 147

Query: 338 MIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVW 372
           +  +GH  ++ D +++   P+L  +A E+ + + W
Sbjct: 148 ITLSGHAMTVRDIAISNRHPYL-FSASEDKLAKCW 181

 Score = 30.8 bits (68), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 49/229 (21%), Positives = 89/229 (38%), Gaps = 21/229 (9%)

Query: 95  LKSNVKIIKKFEHENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHN 154
           L+ N  I     H + V      P  D LIAT      + L++  + V    L   +   
Sbjct: 183 LEKNTAIRDYHGHLSGVHTVDIHPTLD-LIATAGRDSVVKLWDIRSRVPVVTLIGHKSPI 241

Query: 155 ENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQN 214
              + L  NP    +++S S D+ I LWD+       +LT    H   + D  +H  + +
Sbjct: 242 NKVHCLPVNP----QVISSSVDATIRLWDIVAGKASKVLT---HHKRSIRDIAFHPSEFS 294

Query: 215 IFGSVSEDSTLQLHDQRIRDAA-VEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDR 273
           +  + ++D    +   ++ + + +   +A K       S +  N+  A G +  +  YD 
Sbjct: 295 MATACTDD----IRSWKLPEGSLLTNFEASKVGIINCLSINQDNVLFAGGDNGALSFYDY 350

Query: 274 RRASK-------PLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILW 315
           +   K        L   P  E ++ +  F  Q    LI+  SD+   +W
Sbjct: 351 KSGHKYQSLETQALPESPDAERSILASTF-DQTGLRLITCESDKTIKMW 398

>ZYRO0D08206g Chr4 (711937..713484) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 60/255 (23%), Positives = 100/255 (39%), Gaps = 32/255 (12%)

Query: 120 DDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNI 179
           D   +A+ S  GTI +++ +       L T   H  +   + +    +G L +GS D  I
Sbjct: 247 DKPRLASASKDGTIKIWDASRRT---CLYTLSGHTNSVSCVKWG--GQGLLYTGSHDKTI 301

Query: 180 VLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEK 239
            +WD+  K+    +     H+  VN            G    D       Q  RD A   
Sbjct: 302 RVWDI--KAGGKCINILKSHAHWVNHLSLSTDYAIRVGPFGPDGKASPSPQEARDIA--- 356

Query: 240 VQAKKPYNTLAF-SAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQ 298
              KK Y  +   S     L   A  D  ++L++  +++KPL  M GH+  V  + F P 
Sbjct: 357 ---KKNYEKVVRKSGQVEELMVTASDDFTMFLWNPLKSAKPLARMTGHQKLVNHVAFSP- 412

Query: 299 EDG-VLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIP 357
            DG  ++SA  D    LW            D  DG  + +    GH +S+   + + +  
Sbjct: 413 -DGRYIVSASFDNSIKLW------------DGRDG--KFIATFRGHVASVYQVAWSSDCR 457

Query: 358 WLTATAEEENIVQVW 372
            L  +  ++  ++VW
Sbjct: 458 -LLVSCSKDTTLKVW 471

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/168 (21%), Positives = 79/168 (47%), Gaps = 14/168 (8%)

Query: 161 SFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVS 220
           +F P+   ++++G+ D+   +WD    +Q P L+    HS+ V    W + D  +  + S
Sbjct: 150 AFAPDTSSRMVTGAGDNTARIWDCA--TQTP-LSVLKGHSNWVLCVAW-SPDGELIATGS 205

Query: 221 EDSTLQLHDQRIRDAAVEKVQAKKPYNTL-------AFSAHSTNLFAAAGTDSMVYLYDR 273
            D+T++L + +      + ++    + T          +A      A+A  D  + ++D 
Sbjct: 206 MDNTIRLWESKAGKPWGDAMKGHSKWITSLTWEPLHLVAAGDKPRLASASKDGTIKIWDA 265

Query: 274 RRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIG 321
            R +  L+ + GH ++V+ +++  Q  G+L +   D+   +WD+   G
Sbjct: 266 SRRT-CLYTLSGHTNSVSCVKWGGQ--GLLYTGSHDKTIRVWDIKAGG 310

>NDAI0J01850 Chr10 (461283..463010) [1728 bp, 575 aa] {ON} Anc_4.122
          Length = 575

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 68/144 (47%), Gaps = 11/144 (7%)

Query: 199 HSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQA-KKPYNTLAFSAHSTN 257
           H D  +   W+N   +I  S S D T+   D R+ +   E+++   +    L ++    N
Sbjct: 348 HVDRTSCLSWNN---HILSSGSRDHTILHRDVRMAEPFFERIKTHSQEVCGLKWNVDE-N 403

Query: 258 LFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGS--DRRTILW 315
             A+ G D+MVY+YD   +S P+  +  H+ AV ++ + P + G L + G   DR+  +W
Sbjct: 404 KLASGGNDNMVYVYD-GTSSSPVFKITEHKAAVKAMAWSPHKRGTLATGGGTVDRKLKIW 462

Query: 316 DLAEIGAEQVPDDADDGSPEVMMI 339
           +   I       D D GS    M+
Sbjct: 463 N---INTSTKTSDIDTGSQVCNMV 483

>KNAG0A03080 Chr1 complement(380346..381686) [1341 bp, 446 aa] {ON} 
          Length = 446

 Score = 51.2 bits (121), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/234 (23%), Positives = 96/234 (41%), Gaps = 36/234 (15%)

Query: 175 DDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRD 234
           +DS + + D  GK  E + T     + + +  ++  FD   FGS S+D+T++  D R  D
Sbjct: 207 EDSILKIVDNAGKPGEVLRTMHVPGTTVTHTVRF--FDNYTFGSCSDDNTIRFWDIRTAD 264

Query: 235 AAVEKVQAKKPYNTLAFSAH--STNLFAAAGTDSMVYLYDRRR---ASKPL-HMMPGHE- 287
             +  +   K     AF A   +  LF    +  ++ L+D R    A+  L H   GH+ 
Sbjct: 265 KPIFSLSEPKNGKLTAFDASQITNELFVTGTSTGVIKLWDIRSVEFATTDLTHRQNGHDP 324

Query: 288 -------------DAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDG-- 332
                        D+V  ++F P       + G       WD+    ++   DDA     
Sbjct: 325 IQTELVNLYHSGGDSVADVQFSPTSSSEFATVGGSGNVYHWDMEFFFSQNDDDDAGATAK 384

Query: 333 --SPE------VMMIHAGH----RSSINDFSMNPNIPWLTATAEEENIVQVWKP 374
             +PE      +   H G+    R+  N  + +P I  L  T ++ +++ V+KP
Sbjct: 385 LPAPEELQGQCLKFFHIGNNQQKRNVKNSVAWHPTIDDLVCTVDDTSLISVYKP 438

>CAGL0I03718g Chr9 complement(317565..321170) [3606 bp, 1201 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145c RET1 Coatomer alpha subunit
          Length = 1201

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 104/247 (42%), Gaps = 25/247 (10%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           LL+ F+  +    G++F+P+    L++    S I LWD    +   +L   + H   V  
Sbjct: 3   LLTKFESKSTRAKGIAFHPSRPWALVALFS-STIQLWDYRMGT---LLHRFEGHEGPVRA 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q IF S  +D+++++      +  +  +     Y    F         +A  D
Sbjct: 59  VDFHP-TQPIFVSAGDDASIKVWSLET-NRCLYTLTGHLDYVRTVFFHSELPWVISASDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA------- 318
             V +++ +   K L  + GH   V   +FH  ED +++SA  D    +WD++       
Sbjct: 117 QTVRIWNWQN-RKELACLTGHNHFVMCAQFHQTED-LVVSASLDETVRVWDISGLRKKHS 174

Query: 319 ---------EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIV 369
                     + ++Q   D   G  +V  I  GH   +N  S +P +P L  T  ++  V
Sbjct: 175 APGVTSYEDSLASQQNLLDGAFGDCKVKFILEGHTRGVNWASFHPTLP-LIVTGGDDRQV 233

Query: 370 QVWKPSS 376
           ++W+ SS
Sbjct: 234 KLWRMSS 240

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 54/107 (50%), Gaps = 4/107 (3%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           +++G DD  + LW ++      + T     +++  DC   + DQN+  SV+ED TL++ D
Sbjct: 224 IVTGGDDRQVKLWRMSSNKAWEVDTCRGHTNNV--DCVVFHPDQNLILSVAEDKTLRIWD 281

Query: 230 QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA-GTDSMVYLYDRRR 275
              R   V++ + +     L  S  + +LF AA  +  M++  DR R
Sbjct: 282 LDKR-TPVKQFKRENDRFWLIRSHPNMSLFGAAHDSGIMIFKLDRER 327

>YDL145C Chr4 complement(194571..198176) [3606 bp, 1201 aa] {ON}
           COP1Alpha subunit of COPI vesicle coatomer complex,
           which surrounds transport vesicles in the early
           secretory pathway
          Length = 1201

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/247 (21%), Positives = 104/247 (42%), Gaps = 25/247 (10%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           +L+ F+  +    G++F+P+ +  +L     S I LWD    +   +L   + H   V  
Sbjct: 3   MLTKFESKSTRAKGIAFHPS-RPWVLVALFSSTIQLWDYRMGT---LLHRFEDHEGPVRG 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q IF S  +D T+++      +  +  +     Y    F         +A  D
Sbjct: 59  LDFHP-TQPIFVSAGDDYTIKVWSLDT-NKCLYTLTGHLDYVRTVFFHRELPWIISASDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA------- 318
             + +++ +   K +  + GH   V   +FHP +D +++SA  D    +WD++       
Sbjct: 117 QTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPTDD-LIVSASLDETIRIWDISGLRKRHS 174

Query: 319 ---------EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIV 369
                    ++ A+Q   D   G   V  I  GH   +N  S +P +P L  +  ++  V
Sbjct: 175 APGTSSFEEQMSAQQNLLDGSLGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQV 233

Query: 370 QVWKPSS 376
           ++W+ S+
Sbjct: 234 KLWRMSA 240

 Score = 43.5 bits (101), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 92/234 (39%), Gaps = 31/234 (13%)

Query: 132 TIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEP 191
           TI ++N  N  E   L+    HN       F+P +   ++S S D  I +WD++G     
Sbjct: 118 TIRIWNWQNRKEIACLTG---HNHFVMCAQFHPTDD-LIVSASLDETIRIWDISG----- 168

Query: 192 ILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAF 251
                 RHS         +F++ +       +   L D  + D  V+ +           
Sbjct: 169 ---LRKRHSAPGTS----SFEEQM------SAQQNLLDGSLGDCVVKFILEGHTRGVNWA 215

Query: 252 SAHSTNLFAAAGTDSMVYLYDRRRASKP--LHMMPGHEDAVTSLEFHPQEDGVLISAGSD 309
           S H T     +G+D       R  A+K   +    GH + V S+ FHP ++ ++IS G D
Sbjct: 216 SFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPHQN-LIISVGED 274

Query: 310 RRTILWDL-AEIGAEQVPDDADD-----GSPEVMMIHAGHRSSINDFSMNPNIP 357
           +   +WDL      +Q   + D        P + +  A H S I  F ++   P
Sbjct: 275 KTLRVWDLDKRTPVKQFKRENDRFWLIAAHPHINLFGAAHDSGIMVFKLDRERP 328

 Score = 40.0 bits (92), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 54/113 (47%), Gaps = 4/113 (3%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           ++SGSDD  + LW ++      + T    H++ V+   +H   QN+  SV ED TL++ D
Sbjct: 224 IVSGSDDRQVKLWRMSATKAWEVDT-CRGHTNNVDSVIFHP-HQNLIISVGEDKTLRVWD 281

Query: 230 QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA-GTDSMVYLYDRRRASKPLH 281
              R    +  +    +  +A   H  NLF AA  +  MV+  DR R    +H
Sbjct: 282 LDKRTPVKQFKRENDRFWLIAAHPH-INLFGAAHDSGIMVFKLDRERPCSFIH 333

>SAKL0E07766g Chr5 (628373..629569) [1197 bp, 398 aa] {ON} similar
           to uniprot|P53962 Saccharomyces cerevisiae YNL035C
           Hypothetical ORF
          Length = 398

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 86/180 (47%), Gaps = 15/180 (8%)

Query: 147 LSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDIVND 205
           L T  F  EN + L   P     LL+   + +I L D  TG   E I  F   HS  +++
Sbjct: 6   LHTASFGCEN-WCLQLQPLYNRGLLTSLSNGHIHLVDWCTG---EIIHEFA-AHSASISN 60

Query: 206 CKWHN---FDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAA- 261
            K  N    + ++F S S+DS +++ D R   + V  +   K    L+  +    L    
Sbjct: 61  LKVLNNEFTNSDLFASASKDS-VKIFDVRTS-SCVATLHNDKSAPFLSLDSRHDMLACGT 118

Query: 262 --AGTDSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA 318
             +G D+ +++YD ++ SKPL   +  H D +T  +FHP + GVL+S  +D    ++DL 
Sbjct: 119 ELSGVDAELHIYDIKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLT 178

 Score = 32.0 bits (71), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 23/87 (26%), Positives = 43/87 (49%), Gaps = 11/87 (12%)

Query: 127 ISGV-GTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVT 185
           +SGV   +++Y+   ++   L S    H+++     F+P + G L+SGS D  + ++D+T
Sbjct: 120 LSGVDAELHIYD-IKKLSKPLRSFVDSHHDDITDTKFHPGDPGVLMSGSTDGYVNIYDLT 178

Query: 186 GKSQE----PILTFTDRHSDIVNDCKW 208
              +E     ++ F   HS     C W
Sbjct: 179 NSDEEDALHQVINFASVHS-----CGW 200

>TDEL0F02230 Chr6 (407699..409369) [1671 bp, 556 aa] {ON} Anc_4.122
           YGL003C
          Length = 556

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 61/122 (50%), Gaps = 8/122 (6%)

Query: 199 HSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQA-KKPYNTLAFSAHSTN 257
           H D V    W+N   +I  S S D  +   D R+ D+  E+++   +    L ++  S N
Sbjct: 333 HKDRVACLSWNN---HILTSGSRDRRILHRDVRVPDSFFERIETHSQEVCGLKWNPES-N 388

Query: 258 LFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAG--SDRRTILW 315
             A+ G D+MVY+YD    S P+     H  AV +L + P + G+L S G  +DR+   W
Sbjct: 389 KLASGGNDNMVYVYDGTSRS-PVLKFEEHTAAVKALAWSPHKRGILASGGGTADRKLKTW 447

Query: 316 DL 317
           ++
Sbjct: 448 NV 449

>NDAI0G00630 Chr7 complement(137826..139019) [1194 bp, 397 aa] {ON}
           Anc_2.283 YNL035C
          Length = 397

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/202 (27%), Positives = 95/202 (47%), Gaps = 24/202 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEK--GKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDI- 202
           LL++  F   N +   F P +K  G LLS S+     L   T +S++ I     R S++ 
Sbjct: 8   LLNSHSF-GSNNWCFKFQPLDKANGLLLSLSNGEIHCLDFGTCQSKQSI-----RVSNLS 61

Query: 203 VNDCKWHNFD---QNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLF 259
           +ND K  N D    ++F + + +S +++ D    +  +  +   K    L+  +    L 
Sbjct: 62  INDLKILNSDFHCGSLFSTATAES-VKIFDINSNNGPIATLHNDKNVPFLSLDSRHGLLA 120

Query: 260 AAA---GTDSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILW 315
                 G D+ + +YD R+   PL  ++  H D VT+L+FHP +  VL+S  +D  T ++
Sbjct: 121 MGTELQGVDAQINIYDIRKWDTPLRSLIDSHHDDVTALKFHPSDPTVLLSGSTDGYTNVY 180

Query: 316 DLAEIGAEQVPDDADDGSPEVM 337
           DL +        D DD   +VM
Sbjct: 181 DLTQ-------QDEDDALHQVM 195

>KNAG0B02720 Chr2 complement(523885..527499) [3615 bp, 1204 aa] {ON}
           Anc_7.322 YDL145C
          Length = 1204

 Score = 51.6 bits (122), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/246 (22%), Positives = 103/246 (41%), Gaps = 24/246 (9%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           +L+ F+  +    G++F+P+ +  +L     S I LWD    +   +L   + H   V  
Sbjct: 3   MLTKFESKSTRAKGIAFHPS-RPWVLVALFSSTIQLWDYRMGT---LLHRFEGHEGPVRG 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q IF S  +DST++L      +  +        Y    F         +A  D
Sbjct: 59  IDFHP-TQPIFASSGDDSTIKLWSLDT-NKCLYTFTGHLDYIRTVFFHKELPWIISASDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGA--- 322
             + +++ +   K L  + GH   V   +FHP ED +++SA  D    +WD++ +     
Sbjct: 117 QTIRIWNWQN-RKELACITGHNHFVMCAQFHPTED-LVVSASLDETVRVWDISALRKKHS 174

Query: 323 ------------EQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQ 370
                       +Q   D+  G   V  I  GH   +N  + +P +P L  +  ++  V+
Sbjct: 175 APVDRLEEMMIQQQNLLDSGFGDYVVKFILEGHTRGVNWATFHPTLP-LIVSGSDDRQVK 233

Query: 371 VWKPSS 376
           +W+ S+
Sbjct: 234 LWRMSA 239

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 62/269 (23%), Positives = 106/269 (39%), Gaps = 38/269 (14%)

Query: 100 KIIKKFEHENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYG 159
           K +  F    +  R  +  ++   I + S   TI ++N  N  E   L+    HN     
Sbjct: 86  KCLYTFTGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKE---LACITGHNHFVMC 142

Query: 160 LSFNPNEKGKLLSGSDDSNIVLWDVTG---KSQEPILTFTDRHSDIVNDCKWHNFDQNIF 216
             F+P E   ++S S D  + +WD++    K   P+    DR  +++   +  N   + F
Sbjct: 143 AQFHPTED-LVVSASLDETVRVWDISALRKKHSAPV----DRLEEMM--IQQQNLLDSGF 195

Query: 217 GSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRA 276
           G       L+ H + +  A                + H T     +G+D       R  A
Sbjct: 196 GDYVVKFILEGHTRGVNWA----------------TFHPTLPLIVSGSDDRQVKLWRMSA 239

Query: 277 SKP--LHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL-AEIGAEQVPDDADD-- 331
           +K   +    GH + V  + FHP ++ ++ISAG D+   +WDL   +  +Q   D D   
Sbjct: 240 TKAWEVDTCRGHSNNVDCVIFHPHQN-LIISAGEDKTLRVWDLDKRMPVKQFKRDDDRFW 298

Query: 332 ---GSPEVMMIHAGHRSSINDFSMNPNIP 357
                P + +  A H S I  F ++   P
Sbjct: 299 LIAAHPHINLFGAAHDSGIMIFKLDRERP 327

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 51/119 (42%), Gaps = 17/119 (14%)

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQV 325
           S + L+D R  +  LH   GHE  V  ++FHP +  +  S+G D    LW L        
Sbjct: 33  STIQLWDYRMGT-LLHRFEGHEGPVRGIDFHPTQP-IFASSGDDSTIKLWSL-------- 82

Query: 326 PDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENI-VQVWKPSSKLPRIGG 383
                  + + +    GH   I     +  +PW+ + ++++ I +  W+   +L  I G
Sbjct: 83  ------DTNKCLYTFTGHLDYIRTVFFHKELPWIISASDDQTIRIWNWQNRKELACITG 135

>Smik_6.451 Chr6 (740074..741645) [1572 bp, 523 aa] {ON} YPL247C
           (REAL)
          Length = 523

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 38/170 (22%), Positives = 73/170 (42%), Gaps = 26/170 (15%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           ++S S D+  ++WD+  +S   + T    H   V D ++      +F S   D ++++ D
Sbjct: 259 IISSSIDTTCIVWDL--QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFD 316

Query: 230 QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYL------------------- 270
             +R  A   +  + P ++       T   A+ G+D+++ L                   
Sbjct: 317 --LRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFAAESNK 374

Query: 271 ---YDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
               D R    P+  + GH  +V  +++HP +  VL+S G D + + WDL
Sbjct: 375 IIILDMRNPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDDCQVLYWDL 424

 Score = 34.3 bits (77), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 45/198 (22%), Positives = 75/198 (37%), Gaps = 35/198 (17%)

Query: 208 WHNFDQNIFGSVSEDSTLQLHD-QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDS 266
           W+  D N+  S S D+T  + D Q       + +        + F   ST LFA+ G D 
Sbjct: 251 WNMVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDG 310

Query: 267 MVYLYDRRRASK-------PLHMMPG-----------HEDAVTSLEFHPQEDGVLIS-AG 307
            V ++D R  +        P    PG             DA+  LE  P +  VL + A 
Sbjct: 311 SVRVFDLRSLAHSTIIYEPPASSAPGLNADTTTPASKGSDALLRLEPSPYDPNVLATFAA 370

Query: 308 SDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHA-GHRSSINDFSMNPNIPWLTATAEEE 366
              + I+ D+               +PE  +++  GH SS+N+   +P    +  +  ++
Sbjct: 371 ESNKIIILDMR--------------NPESPILNLEGHSSSVNEIKWHPTKRNVLLSCGDD 416

Query: 367 NIVQVWKPSSKLPRIGGT 384
             V  W  ++    I G 
Sbjct: 417 CQVLYWDLNNSFMEINGA 434

>Smik_10.126 Chr10 (196821..198959) [2139 bp, 712 aa] {ON} YJL112W
           (REAL)
          Length = 712

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/237 (24%), Positives = 100/237 (42%), Gaps = 43/237 (18%)

Query: 142 VESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDV-TGKSQEPI-LTFTDRH 199
           ++S  + TF+ H +    LS +P+    L+SGS D  I  WD+ +GK  + I L+F +  
Sbjct: 488 IDSPCVYTFEAHTDEVTALSLDPS---FLVSGSQDRTIRQWDLRSGKCMQTIDLSFANVL 544

Query: 200 SDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLF 259
           +   N              +S+ + L    +R    A++   A                 
Sbjct: 545 TAATN------------VDLSKSTLLTQRSERPSIGALQSFDAA---------------L 577

Query: 260 AAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWD--- 316
           A    D +V L+D R + K +  + GH DA+TSL+F  +    L++   DR   +WD   
Sbjct: 578 ATGTKDGIVRLWDLR-SGKVIRTLKGHTDAITSLKFGSE---CLVTGSYDRTVRVWDLRT 633

Query: 317 --LAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQV 371
             L++  A   P  + D   E   +   + +++  +  N +  W  +  E+ N V V
Sbjct: 634 GLLSKFHAYSEPILSLDLCQENAAVIVANETAVQIYDSNKDESW--SCVEQGNEVNV 688

>KNAG0I01050 Chr9 complement(200338..203817) [3480 bp, 1159 aa] {ON}
           Anc_8.288 YDR128W
          Length = 1159

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 33/142 (23%), Positives = 68/142 (47%), Gaps = 4/142 (2%)

Query: 180 VLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEK 239
           ++W++   S   I      HS  + D  +++   +I  + S D+ +   D R        
Sbjct: 95  IIWNLNKPSSNAIEYALHGHSRAITDINFNSQHPDILATCSIDTYVHAWDMRSPHRPFYT 154

Query: 240 VQA-KKPYNTLAFSAHSTNLFAAA-GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHP 297
             + +   + + ++   +N+ A++ G D  V+++D R  S PLH + GH   V S++F  
Sbjct: 155 TSSWRSSASQVKWNFKDSNILASSHGND--VFIWDLRHGSTPLHKLTGHNSGVNSIDFSR 212

Query: 298 QEDGVLISAGSDRRTILWDLAE 319
            E+  ++S+ +D     WDL++
Sbjct: 213 FEENKIMSSSNDGTVKFWDLSK 234

>Suva_16.510 Chr16 (874866..876263) [1398 bp, 465 aa] {ON} YPR178W
           (REAL)
          Length = 465

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 52/207 (25%), Positives = 92/207 (44%), Gaps = 11/207 (5%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYLYNRANE-VESGLLSTFQFHNENGYGLSFNPN 165
           H  ++   ++ P+ +N I + +  G I  +   NE  +  LL +   H      L ++P+
Sbjct: 217 HVGKIGAVQWHPESNNQIISCAEDGLIKNFQYLNEEGDLRLLGSLVGHERRVSDLKYHPS 276

Query: 166 EKGKLL-SGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDST 224
             GK + S S D    LWD +   +   L   + H+  V  C     D ++  S   DS 
Sbjct: 277 --GKFIGSASHDMTWRLWDASTYQE---LLLQEGHAKGVF-CLSFQCDGSLVCSGGMDSL 330

Query: 225 LQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYD-RRRASKPLHMM 283
             + D R  +  +      KP  T+ +S +   + A  G D ++ ++D R+R    +H +
Sbjct: 331 AMIWDIRSGNKVMSLTGHSKPVYTVDWSPNGYQV-ATGGGDGLINVWDIRQRDGGQVHQI 389

Query: 284 PGHEDAVTSLEFHPQEDG-VLISAGSD 309
             H + VT ++F   ++G  LIS G D
Sbjct: 390 LAHRNIVTKVQFSKDDNGKKLISCGYD 416

>TPHA0M01830 Chr13 complement(378923..380470) [1548 bp, 515 aa] {ON}
           Anc_6.340 YCR072C
          Length = 515

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 75/317 (23%), Positives = 122/317 (38%), Gaps = 71/317 (22%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNP-- 164
           H N V    + P D  LIAT S   TI L+   N    G     + H +    LS+ P  
Sbjct: 185 HTNWVLCVAWSP-DGELIATGSMDNTIRLWEGKNGKPFG--EAMRGHQKWITSLSWEPLH 241

Query: 165 ----NEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVS 220
                E+ KL + S D  I +WD TG+     L     H + V+  KW    +N+  S S
Sbjct: 242 LVKAGERPKLATSSKDGTIKVWD-TGR--RVCLYTLSGHVNSVSCVKWGG--KNLLYSGS 296

Query: 221 EDSTLQLHDQRIRDAAVE--------------------------------------KVQA 242
            D T+++ D  +    +                                       + +A
Sbjct: 297 HDKTVRVWDMNLGGKCINILKSHAHWVNHLSLSTDYALRVGPFDHTGIMPATPEEARAKA 356

Query: 243 KKPYNTLAFSAHS-TNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDG 301
            K Y  +A    S   L   A  D  ++L++  +++KP+  M GH+  V  + F P  DG
Sbjct: 357 LKNYEKVAKRNGSDEELMVTASDDFTMFLWNPSKSTKPISRMTGHQKLVNHVAFSP--DG 414

Query: 302 -VLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLT 360
             ++SA  D    LW            D+ DG  + +    GH +S+   + + +   L 
Sbjct: 415 RYIVSASFDNSIKLW------------DSRDG--KFITTFRGHVASVYQVAWSSDCR-LL 459

Query: 361 ATAEEENIVQVWKPSSK 377
           A+  ++  ++VW   +K
Sbjct: 460 ASCSKDTSLKVWDIRTK 476

 Score = 39.7 bits (91), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 35/165 (21%), Positives = 80/165 (48%), Gaps = 16/165 (9%)

Query: 161 SFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVS 220
           SF P+   ++++G+ D+   +WD    +Q P++T +  H++ V    W + D  +  + S
Sbjct: 150 SFAPHTSSRMVTGAGDNTARIWDC--DTQTPMVTLSG-HTNWVLCVAW-SPDGELIATGS 205

Query: 221 EDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNL--------FAAAGTDSMVYLYD 272
            D+T++L + +      E ++  + + T + S    +L         A +  D  + ++D
Sbjct: 206 MDNTIRLWEGKNGKPFGEAMRGHQKWIT-SLSWEPLHLVKAGERPKLATSSKDGTIKVWD 264

Query: 273 RRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
             R    L+ + GH ++V+ +++  +   +L S   D+   +WD+
Sbjct: 265 TGRRV-CLYTLSGHVNSVSCVKWGGKN--LLYSGSHDKTVRVWDM 306

>KAFR0A00510 Chr1 (93452..93988,94240..94662) [960 bp, 319 aa] {ON}
           Anc_2.431 YMR116C
          Length = 319

 Score = 50.4 bits (119), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 57/242 (23%), Positives = 104/242 (42%), Gaps = 28/242 (11%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +  +   L+S S D  ++ W +TG  Q+   P+ +F   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQKVGVPVRSFKG-HSHI 67

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V D      D     S S D TL+L +    +     V  K    ++A    ++ + + +
Sbjct: 68  VQDVT-LTPDGAYALSASWDKTLRLWEVATGETFQRFVGHKSDVMSVAIDRKASMIISGS 126

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQ-----EDGVLISAGSDRRTILWDL 317
             D  + ++  +   + L  + GH D V+ +   P      E   +ISAG+D+    W+L
Sbjct: 127 -RDKSIKVWTIK--GQCLATLLGHNDWVSQVRVAPNDKDDDETVTVISAGNDKMVKAWNL 183

Query: 318 AEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSSK 377
            +    Q+  D             GH  ++N  + +P+   L A+A ++  + +W  + K
Sbjct: 184 NQF---QIEAD-----------FVGHNGNVNTITASPDGS-LIASAGKDGEIMLWNLADK 228

Query: 378 LP 379
           +P
Sbjct: 229 VP 230

>AEL246C Chr5 complement(172849..175296) [2448 bp, 815 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR198C
           (TAF5)
          Length = 815

 Score = 51.2 bits (121), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 93/237 (39%), Gaps = 30/237 (12%)

Query: 147 LSTFQFHNENGYGLSFNPNEKGKLLS-GSDDSNIVLWDVTGKSQEPILTFTDR------- 198
           +  + FHN N        ++  +L++ G  DS I LW + G   E  L    +       
Sbjct: 478 VCMYTFHNTNREMTCLRFSDDSRLVAAGFQDSYIKLWSLDGTPLESQLPSKAKDASNTVT 537

Query: 199 ---HSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHS 255
              HS  V    + + D     S SED T++L         V       P   + FS   
Sbjct: 538 LIGHSGPVYSVSF-SPDNRYLVSASEDKTVRLWSLDTYTCLVSYKGHNHPVWDVKFSPLG 596

Query: 256 TNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILW 315
            + FA    D    L+       PL +  GH + V  + FHP    VL +  SD+   +W
Sbjct: 597 -HYFATGSHDQTARLWSCDHI-YPLRIFAGHLNDVDCVTFHPNGTYVL-TGSSDKTCRMW 653

Query: 316 DLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVW 372
           D+      Q  D         + +  GH +S+   +++P+  WLT T  E+ ++ VW
Sbjct: 654 DI------QTGDS--------VRLFLGHTASVVSVAVSPDGRWLT-TGSEDGVIIVW 695

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 43/179 (24%), Positives = 77/179 (43%), Gaps = 9/179 (5%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
            L +++ HN   + + F+P       +GS D    LW        P+  F    +D+  D
Sbjct: 576 CLVSYKGHNHPVWDVKFSPLGH-YFATGSHDQTARLWSC--DHIYPLRIFAGHLNDV--D 630

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
           C   + +     + S D T ++ D +  D+    +       ++A S     L      D
Sbjct: 631 CVTFHPNGTYVLTGSSDKTCRMWDIQTGDSVRLFLGHTASVVSVAVSPDGRWL-TTGSED 689

Query: 266 SMVYLYDRRRASKPLHMMPGH-EDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAE 323
            ++ ++D     K +  M GH + AV SL F+ +E  +L+S G+D+   +WDL +   E
Sbjct: 690 GVIIVWDIG-TGKRIKQMRGHGKSAVYSLSFN-KEGNILVSGGADQSVRVWDLKKFTNE 746

>Ecym_8061 Chr8 complement(131761..135447) [3687 bp, 1228 aa] {ON}
           similar to Ashbya gossypii ADR090W
          Length = 1228

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/175 (22%), Positives = 76/175 (43%), Gaps = 16/175 (9%)

Query: 160 LSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHS----DIVNDCKWHNFDQNI 215
           L FN  +   L+SG     I +WD    + +    F    +    + V    W+    ++
Sbjct: 110 LRFNAKQSNVLVSGGSQGEIYVWDTNKIATQGYSPFGPGVAMTPIEEVQSLAWNQTLAHV 169

Query: 216 FGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLA--------FSAHSTNLFAAAGTDS- 266
           F S        + D + +   +  +    P + L           ++ST +  A G D+ 
Sbjct: 170 FASAGSSGFASIWDLKAKKEVIH-LSYTSPTSGLKNQLSVVEWHPSNSTKVATATGNDNE 228

Query: 267 -MVYLYDRRRASKPLHMMP-GHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
            ++ ++D R ++ PL ++  GH   + SL++  Q+D ++IS+G D   ILW+  E
Sbjct: 229 PVILVWDLRNSNAPLKVLSQGHSKGILSLDWCQQDDKLMISSGRDNTCILWNPEE 283

 Score = 38.1 bits (87), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 49/106 (46%), Gaps = 4/106 (3%)

Query: 220 SEDSTLQLHDQRIRDAAVEK--VQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS 277
           S  STL+L     RDA   +  + A   +N L +S   + L  A   D+ V  + +    
Sbjct: 37  SSASTLELWSVLSRDARTPQGMIVADAKFNDLEWSKDGSIL--AGALDNGVVEFFKPEEL 94

Query: 278 KPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAE 323
           + +  +  H  AV +L F+ ++  VL+S GS     +WD  +I  +
Sbjct: 95  RSVAKVKKHTTAVQTLRFNAKQSNVLVSGGSQGEIYVWDTNKIATQ 140

>Ecym_2523 Chr2 complement(1021566..1023506) [1941 bp, 646 aa] {ON}
           similar to Ashbya gossypii AGL234W
          Length = 646

 Score = 50.8 bits (120), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 64/253 (25%), Positives = 109/253 (43%), Gaps = 45/253 (17%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDV-TGKSQEPILTFTDRHSDIVN 204
           +L T Q H ++ Y L + P    KL+SGS D  + +WD+ TG+      + T    D V 
Sbjct: 403 ILMTLQGHEQDIYSLDYFP-AGDKLVSGSGDRTVRIWDLRTGQ-----CSLTLSIEDGVT 456

Query: 205 DCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNT--------LAFSAHST 256
                  D     + S D T+++ D       VE++ ++   +T        + F+    
Sbjct: 457 TVAVSPGDGKYIAAGSLDRTVRVWDSET-GFLVERLDSENELSTGHKDSVYSVVFTRDGR 515

Query: 257 NLFAAAGTDSMVYLYDRRRA-SKPLHMM-----PGHEDAVTSLEFHPQEDGVLISAGSDR 310
           ++ + +  D  V L+D R    +  H        GH+D V S+    Q+D  ++S   DR
Sbjct: 516 SVVSGS-LDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVAT-TQDDEYILSGSKDR 573

Query: 311 RTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSS------INDFSMNPNIPWLTATAE 364
             + WD A             G+P +M+   GHR+S      +N F + P+I  + AT  
Sbjct: 574 GVLFWDTAS------------GNPLLML--QGHRNSVISVAVVNGFPLGPDI-GVFATGS 618

Query: 365 EENIVQVWKPSSK 377
            +   ++WK + K
Sbjct: 619 GDCKARIWKYTKK 631

>NCAS0G03870 Chr7 (717809..718978) [1170 bp, 389 aa] {ON} Anc_2.283
          Length = 389

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 8/110 (7%)

Query: 215 IFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA----GTDSMVYL 270
           +F + + +S         ++ A    Q   P+ +L  S H   L A      G D+ +Y+
Sbjct: 77  LFTTATSNSVKIFDIHSTKEVATIHSQGNVPFPSLD-SRHG--LLACGTELKGVDAAIYI 133

Query: 271 YDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
           YD R+  +P+  ++  H D VT L++HP +  +L+S  +D  T ++DL+E
Sbjct: 134 YDIRKWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDGYTNVYDLSE 183

 Score = 34.3 bits (77), Expect = 0.45,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 33/66 (50%), Gaps = 5/66 (7%)

Query: 168 GKLLSGSD----DSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDS 223
           G L  G++    D+ I ++D+  K  +P+ +  D H D V   KWH  D NI  S S D 
Sbjct: 116 GLLACGTELKGVDAAIYIYDIR-KWDQPVRSLVDSHHDDVTCLKWHPNDPNILLSGSTDG 174

Query: 224 TLQLHD 229
              ++D
Sbjct: 175 YTNVYD 180

>NCAS0F03340 Chr6 complement(675569..676915) [1347 bp, 448 aa] {ON}
           Anc_5.429 YDR364C
          Length = 448

 Score = 50.4 bits (119), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 81/187 (43%), Gaps = 8/187 (4%)

Query: 153 HNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFD 212
           H      L+F PN    LLSG +D+ + +WD   K    +L     HS  +N   + N D
Sbjct: 154 HTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYHKRN--LLRDYKGHSKAINSLDF-NDD 210

Query: 213 QNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYD 272
              F S S D T+++ D   +     K+  K   N + F   +++ F     +S +Y YD
Sbjct: 211 GTNFISSSFDHTIKIWDTE-QGKVKTKLHFKSTPNDVKFRPFNSSEFIVGFANSKIYHYD 269

Query: 273 RRRASKP--LHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWD-LAEIGAEQVPDDA 329
            R +     + +   H  ++ +L+F P +    IS+  D+   +WD    +  +Q+ D  
Sbjct: 270 TRISENDGRVQVYDHHMSSILALKFFP-DGSKFISSSEDKTVRIWDNQVNVPIKQISDTT 328

Query: 330 DDGSPEV 336
               P +
Sbjct: 329 QYSMPSI 335

 Score = 35.4 bits (80), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 38/92 (41%), Gaps = 14/92 (15%)

Query: 281 HMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIH 340
           + M GH +  TSL F P    +L+S G+D    +WD                   ++  +
Sbjct: 149 YAMDGHTNGTTSLTFLPNSGNLLLSGGNDNIVKVWDFYH-------------KRNLLRDY 195

Query: 341 AGHRSSINDFSMNPNIPWLTATAEEENIVQVW 372
            GH  +IN    N +     +++ +  I ++W
Sbjct: 196 KGHSKAINSLDFNDDGTNFISSSFDHTI-KIW 226

>AGL234W Chr7 (257969..259858) [1890 bp, 629 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR084C (TUP1)
          Length = 629

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 63/253 (24%), Positives = 108/253 (42%), Gaps = 45/253 (17%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDV-TGKSQEPILTFTDRHSDIVN 204
           +L T Q H ++ Y L + P    KL+SGS D  + +WD+ TG+      + T    D V 
Sbjct: 386 ILMTLQGHEQDIYSLDYFPAGD-KLVSGSGDRTVRIWDLRTGQ-----CSLTLSIEDGVT 439

Query: 205 DCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNT--------LAFSAHST 256
                  D     + S D T+++ D       VE++ ++   +T        + F+    
Sbjct: 440 TVAVSPGDGKYIAAGSLDRTVRVWDSET-GFLVERLDSENELSTGHKDSVYSVVFTRDGQ 498

Query: 257 NLFAAAGTDSMVYLYDRRRA-SKPLHMM-----PGHEDAVTSLEFHPQEDGVLISAGSDR 310
            + + +  D  V L+D R    +  H        GH+D V S+    Q+D  ++S   DR
Sbjct: 499 GVISGS-LDRSVKLWDLRGLNGQKSHATCEVTYTGHKDFVLSVAT-TQDDEYILSGSKDR 556

Query: 311 RTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSS------INDFSMNPNIPWLTATAE 364
             + WD A             G+P +M+   GHR+S      +N F + P++  + AT  
Sbjct: 557 GVLFWDTAS------------GNPLLML--QGHRNSVISVAVVNGFPLGPDV-GVFATGS 601

Query: 365 EENIVQVWKPSSK 377
            +   ++WK + K
Sbjct: 602 GDCKARIWKYTKK 614

>Kwal_55.22076 s55 (1098857..1102717) [3861 bp, 1286 aa] {ON}
           YOL138C - Hypothetical ORF [contig 124] FULL
          Length = 1286

 Score = 50.8 bits (120), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 67/268 (25%), Positives = 106/268 (39%), Gaps = 54/268 (20%)

Query: 122 NLIATISGVGT---IYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSN 178
           N IA I G  T   IY  N+AN +E  L +    H  +   + FN  +   L+SGS D  
Sbjct: 179 NYIA-ICGTSTSVSIYDINKANTLEGPLTTILSKHTRSINSVDFNMAQSSLLISGSQDGC 237

Query: 179 IVLWDV---TGKSQEPILTFTDRHSDIVNDCKW---HNFDQNIFGSVSEDSTLQLHDQRI 232
           I +WD+    G+  +  LT  +  SD V D KW   ++F                     
Sbjct: 238 IKVWDLRSSQGRKNKSDLTI-NSGSDSVRDVKWMPTYDFSP------------------- 277

Query: 233 RDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTS 292
                   + + P N         + FA+     ++  YD R+ S+    +  H      
Sbjct: 278 --------EEQGPSN-------RGHRFASIHDSGLLLTYDLRQPSQAEKRINAHSGPGLC 322

Query: 293 LEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSI--NDF 350
           L +HP  D  +++ G D +  LW+    G+  +   +  GS      +A   SS+    F
Sbjct: 323 LCWHPTAD-YIMTGGRDGKCCLWN---TGSRHMHPPSFSGSHHGTSFNASAASSLLTPGF 378

Query: 351 SMNPNIPWLTATAEEENIVQVWKPSSKL 378
           S+N +    T+T   E ++    P SKL
Sbjct: 379 SINSSA---TSTNAPEVVINTAHPLSKL 403

 Score = 35.0 bits (79), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 5/72 (6%)

Query: 250 AFSAHSTNLFAAAGTDSMVYLYDRRRASK---PLH-MMPGHEDAVTSLEFHPQEDGVLIS 305
            F+ H  N  A  GT + V +YD  +A+    PL  ++  H  ++ S++F+  +  +LIS
Sbjct: 173 GFNNHK-NYIAICGTSTSVSIYDINKANTLEGPLTTILSKHTRSINSVDFNMAQSSLLIS 231

Query: 306 AGSDRRTILWDL 317
              D    +WDL
Sbjct: 232 GSQDGCIKVWDL 243

>NCAS0A13940 Chr1 (2740150..2743767) [3618 bp, 1205 aa] {ON}
           Anc_7.322
          Length = 1205

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 54/247 (21%), Positives = 105/247 (42%), Gaps = 25/247 (10%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           +L+ F+  +    G++F+P+ +  +L     S I LWD    +   +L   + H   V  
Sbjct: 3   MLTKFESKSTRAKGIAFHPS-RPWVLVALFSSTIQLWDYRMGT---LLHRFEDHEGPVRS 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q IF S  +D T+++      +  +  +     Y    F         +A  D
Sbjct: 59  VDFHP-TQPIFVSGGDDYTIKVWSLET-NKCLYTLNGHLDYIRTVFFHKELPWIISASDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA------- 318
             + +++ +   K +  + GH   V   +FHP +D +++SA  D    +WD++       
Sbjct: 117 QTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPTDD-LVVSASLDETIRVWDISGLRKKHS 174

Query: 319 ---------EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIV 369
                    ++ A+Q   D   G   V  I  GH   +N  S +P +P + + +++   V
Sbjct: 175 APGTSTFDDQMAAQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLPMIVSGSDDRQ-V 233

Query: 370 QVWKPSS 376
           ++WK +S
Sbjct: 234 KLWKYNS 240

>AER263C Chr5 complement(1118228..1119769) [1542 bp, 513 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCR072C
          Length = 513

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 116/299 (38%), Gaps = 70/299 (23%)

Query: 120 DDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSF------NPNEKGKLLSG 173
           D  +IAT S   TI L++  +E    L    + H +    LS+       P EK +L S 
Sbjct: 195 DGEVIATGSMDATIRLWD--SEKGQSLGDALRGHTKWITSLSWEPIHLVKPGEKPRLASA 252

Query: 174 SDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQR-- 231
           S D  I +WD T   +  I T +  H+  V+  KW    +N+  S S D T++  D    
Sbjct: 253 SKDGTIKIWDTT--RRVCIYTLSG-HTSSVSCIKWGG--RNVLYSASHDRTVRCWDMAAG 307

Query: 232 ----------------------------------IRDAAVEKVQAK--KPYNTLAFSAHS 255
                                              + A+ E  QA+  + Y  +A    +
Sbjct: 308 GKCINILKSHAHWVNHLSLSTDYALRMGPFDHTGTKPASPEDAQARALRNYEKVAKKNGT 367

Query: 256 TNLFAAAGTDSM-VYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDG-VLISAGSDRRTI 313
                  G+D   +YL++  + SKP+  M GH+  V  + F P  DG  ++SA  D    
Sbjct: 368 MEELMVTGSDDFTMYLWNPLKGSKPILRMTGHQKLVNHVAFSP--DGRYIVSASFDNSIK 425

Query: 314 LWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVW 372
           LW            D  DG  + +    GH +S+   + + +   L  +  ++  ++VW
Sbjct: 426 LW------------DGRDG--KFIATFRGHVASVYQVAWSSDCR-LLVSCSKDTTLKVW 469

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 81/182 (44%), Gaps = 16/182 (8%)

Query: 148 STFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCK 207
           S    H       +F P+   ++++G+ D+   +WD    +Q P+ T    HS+ V    
Sbjct: 135 SAIAGHGATILCSAFAPHTSSRMVTGAGDNTARIWDC--DTQTPLCTLKG-HSNWVLCVA 191

Query: 208 WHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNL--------F 259
           W + D  +  + S D+T++L D     +  + ++    + T + S    +L         
Sbjct: 192 W-SADGEVIATGSMDATIRLWDSEKGQSLGDALRGHTKWIT-SLSWEPIHLVKPGEKPRL 249

Query: 260 AAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
           A+A  D  + ++D  R    ++ + GH  +V+ +++  +   VL SA  DR    WD+A 
Sbjct: 250 ASASKDGTIKIWDTTR-RVCIYTLSGHTSSVSCIKWGGRN--VLYSASHDRTVRCWDMAA 306

Query: 320 IG 321
            G
Sbjct: 307 GG 308

>KLTH0G10296g Chr7 complement(869990..871270) [1281 bp, 426 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035C Hypothetical ORF
          Length = 426

 Score = 50.1 bits (118), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 52/191 (27%), Positives = 91/191 (47%), Gaps = 19/191 (9%)

Query: 147 LSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDIVND 205
           L + +F   N + L   P     LL+   +  + L D  T KS   I T    H+  VND
Sbjct: 25  LESIEF-GPNNWCLKLQPIYNSGLLTSLSNGRVELIDWATHKSILQIQT----HATSVND 79

Query: 206 CKWHNFDQ---NIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAA- 261
               N D+   ++  + +ED+ ++++D +  D  V  ++  K    L+  +    L    
Sbjct: 80  MVIINNDRMNGSLIATAAEDA-VKIYDLKSNDC-VATLKNGKSAPFLSLDSRHGLLGCGT 137

Query: 262 --AGTDSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA 318
             +G D+ +++YD R   +PL  ++  H D +TS++FHP +  VL+S  +D    ++DL 
Sbjct: 138 ELSGVDAELHVYDIRSWQQPLRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDL- 196

Query: 319 EIGAEQVPDDA 329
               +Q  DDA
Sbjct: 197 ---TQQEEDDA 204

 Score = 31.2 bits (69), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 34/67 (50%), Gaps = 9/67 (13%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE----PILTFTDRHSD 201
           L S    H+++   + F+P++   LLSGS D  + ++D+T + ++     ++ F   HS 
Sbjct: 158 LRSLVDSHHDDITSIKFHPSDPNVLLSGSTDGYVNIYDLTQQEEDDALHQVINFASIHS- 216

Query: 202 IVNDCKW 208
               C W
Sbjct: 217 ----CGW 219

>ADR090W Chr4 (868742..872443) [3702 bp, 1233 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL195W (SEC31)
          Length = 1233

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 42/182 (23%), Positives = 76/182 (41%), Gaps = 16/182 (8%)

Query: 153 HNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHS----DIVNDCKW 208
           H      + FN  +    +SG     I +WD    S      F    +    D V    W
Sbjct: 102 HTTGVRAVRFNAKQANVAVSGGSQGEIFVWDTNKISAAGYSPFGPGTAMTPIDEVQSLAW 161

Query: 209 HNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPY----NTLAF----SAHSTNLFA 260
           +    ++F S        + D + +   +  +    P+    N LA      ++ST +  
Sbjct: 162 NQSLAHVFASAGSSGFASIWDLKAKKEVIH-LSYTSPHSGLKNQLAVVEWHPSNSTRVAT 220

Query: 261 AAGTDS--MVYLYDRRRASKPLHMMP-GHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
           A G D+  ++ ++D R A+ PL +M  GH   + SL++   ++ +++S+G D   ILW+ 
Sbjct: 221 ATGNDNEPVILVWDLRNANMPLQVMSQGHSKGILSLDWCKHDEKLMLSSGRDNTCILWNP 280

Query: 318 AE 319
            E
Sbjct: 281 EE 282

>KLTH0G13068g Chr7 complement(1118964..1122269) [3306 bp, 1101 aa]
           {ON} similar to uniprot|Q03897 Saccharomyces cerevisiae
           YDR128W Hypothetical ORF
          Length = 1101

 Score = 50.4 bits (119), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 35/161 (21%), Positives = 79/161 (49%), Gaps = 11/161 (6%)

Query: 163 NPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSED 222
           +P++   ++S S+   +V W+++  S   +      HS  + D  +H  +  I  + S D
Sbjct: 78  HPSKPSWVVSTSNQKALV-WNLSRSSSNAVEHVLHGHSRAITDINFHPTNPEILATCSID 136

Query: 223 STLQLHDQR-----IRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRAS 277
           + +   D R        A+V    A +    + ++  + N+ A+A ++  ++++D R+  
Sbjct: 137 AYVHAWDMRSSRRAFYSASVWSAGAAQ----VKWNFKNPNVMASAHSND-IFIWDLRKGC 191

Query: 278 KPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA 318
            PLH++ GH ++V S++F    +  ++S+ +D     WD +
Sbjct: 192 MPLHILKGHANSVNSIDFSRFNETEIMSSSNDGTVKFWDYS 232

>CAGL0G01628g Chr7 complement(151262..152392) [1131 bp, 376 aa] {ON}
           similar to uniprot|P53962 Saccharomyces cerevisiae
           YNL035c
          Length = 376

 Score = 49.7 bits (117), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 61/111 (54%), Gaps = 6/111 (5%)

Query: 213 QNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAF-SAHSTNLFAA--AGTDSMVY 269
           +N+F + S  + +++ D R  +  V  ++ +   N L+  S H    + +   G D+ ++
Sbjct: 65  ENLFAA-SNGNKVKVFDLR-ENKEVATLEQENGANVLSLGSGHGMLAYGSEQQGVDAHLH 122

Query: 270 LYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
           L+D R  SKP+   +  H+D +TS+ FHP +  VL+S  +D  T ++DL E
Sbjct: 123 LFDIRNWSKPVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYDLLE 173

 Score = 32.7 bits (73), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 56/118 (47%), Gaps = 13/118 (11%)

Query: 122 NLIATISGVGTIYLYNRANEV------ESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSD 175
           N ++ + G   ++  +  N+V      E+  ++T +   ENG  +    +  G L  GS+
Sbjct: 56  NALSRVDGQENLFAASNGNKVKVFDLRENKEVATLE--QENGANVLSLGSGHGMLAYGSE 113

Query: 176 ----DSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
               D+++ L+D+   S+ P+ +F D H D +    +H  D N+  S S D    ++D
Sbjct: 114 QQGVDAHLHLFDIRNWSK-PVRSFVDSHQDDITSIAFHPADANVLLSGSTDGYTNVYD 170

>TBLA0H00230 Chr8 complement(31016..35017) [4002 bp, 1333 aa] {ON}
           Anc_3.22 YOL138C
          Length = 1333

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 49/234 (20%), Positives = 94/234 (40%), Gaps = 34/234 (14%)

Query: 89  KEEEEVLKSNVKIIKKFEHENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLS 148
           +  + ++K N ++  K     +V    Y  ++   +++ S V +IY  NR+    + L+S
Sbjct: 164 QSSQGIIKRNKQV--KLSTIADVKTGYYNYKNYVAVSSNSTVISIYDINRSKSTNNPLVS 221

Query: 149 TFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKW 208
           +FQ H  +     FN      ++SG  D  I +WD+   +           SD V D KW
Sbjct: 222 SFQQHTRSINSFDFNMVHTNLIISGGQDGCIKIWDLRSNNPNRCDVSISTSSDSVRDVKW 281

Query: 209 ---HNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
              HNF     G +              +A+ E        N++ +       FA+    
Sbjct: 282 MPYHNFSSTPTGGL--------------EASSE--------NSMGYK------FASIHDS 313

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
            ++  +D R+ ++    +  H      L +HP  +  + + G D +  +W+L +
Sbjct: 314 GLLLKFDIRQPNQVEQKINAHTGPGLCLNWHPNLN-YITTGGRDGKLCVWNLGD 366

>KLLA0E12277g Chr5 (1086778..1087329,1087730..1088158) [981 bp, 326
           aa] {ON} highly similar to uniprot|P38011 Saccharomyces
           cerevisiae YMR116C ASC1 WD repeat protein (G-beta like
           protein) involved in translation regulation required for
           repression of Gcn4p activity in the absence of
           amino-acid starvation core component of the ribosome
           ortholog of mammalian RACK1
          Length = 326

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 64/244 (26%), Positives = 105/244 (43%), Gaps = 30/244 (12%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     LS +  +   L+SGS D  ++ W +T   Q+   P+ ++   HS I
Sbjct: 10  LRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKG-HSHI 68

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V D    + D N   S S D TL+L +    ++    V       ++A  A+S+ + +A+
Sbjct: 69  VQDVV-VSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISAS 127

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQ--EDG-------VLISAGSDRRTI 313
             D  + +++        +++ GH D VT +   P+  EDG         +SAG D+   
Sbjct: 128 -RDKTIRVWN--TVGDCAYVLLGHTDWVTKVRVAPKNLEDGEVDDGRITFVSAGMDKIVR 184

Query: 314 LWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
            W L E          D    E   I  GH + IN    +P+   L A+A ++  + VW 
Sbjct: 185 SWSLNE----------DSYRIEADFI--GHNNYINVVQPSPDGS-LAASAGKDGQIYVWN 231

Query: 374 PSSK 377
              K
Sbjct: 232 LKHK 235

>SAKL0A02970g Chr1 complement(275095..276342) [1248 bp, 415 aa] {ON}
           similar to uniprot|Q12523 Saccharomyces cerevisiae
           YPL247C Hypothetical ORF
          Length = 415

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 53/248 (21%), Positives = 99/248 (39%), Gaps = 45/248 (18%)

Query: 111 VTRARYMPQDDNLIATISGVGTIYLYNRANEVESGL-LSTFQFHNE-NGYGLS------- 161
           VTR +++P+    +AT S   ++ +++  + ++  L LS  ++  + NG   S       
Sbjct: 111 VTRCQWLPKGGGKLATCSD--SLRIWSVGDSLQEQLNLSLCKYSKQSNGSTASAALGSLP 168

Query: 162 ------FNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNI 215
                 +N  +   ++S S D+   +WD+  +S   + T    H   V D K+      +
Sbjct: 169 PVTSFDWNSVDTNLIISSSIDTTCTVWDL--QSSNYVKTQLIAHDSEVYDVKFLTNSTQL 226

Query: 216 FGSVSEDSTLQLHDQRI--RDAAVEKVQAKKPYNTLAFSAHST----------------- 256
           F S   D ++++ D R       + +  A     T+  S                     
Sbjct: 227 FASCGGDGSVRVFDLRCLAHSTIIYEPLAGLTSGTVKSSGEGNVGGNEDGTNHTALLRLE 286

Query: 257 ------NLFAAAGTDS-MVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSD 309
                 N+ A    DS  V + D R    P+  + GH  AV  + +HP +  VL++ G D
Sbjct: 287 PSPFDPNVVATFTQDSNAVLILDMRYPGSPILTLEGHSSAVNQMRWHPTQRNVLLTCGDD 346

Query: 310 RRTILWDL 317
            + + WD+
Sbjct: 347 CQVLYWDI 354

 Score = 32.7 bits (73), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 36/159 (22%), Positives = 63/159 (39%), Gaps = 23/159 (14%)

Query: 93  EVLKSNVKIIKKFEHENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVES-------- 144
           ++  SN    +   H++EV   +++     L A+  G G++ +++      S        
Sbjct: 196 DLQSSNYVKTQLIAHDSEVYDVKFLTNSTQLFASCGGDGSVRVFDLRCLAHSTIIYEPLA 255

Query: 145 GLLS-TFQFHNENGYG-------------LSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE 190
           GL S T +   E   G             L  +P +   + + + DSN VL         
Sbjct: 256 GLTSGTVKSSGEGNVGGNEDGTNHTALLRLEPSPFDPNVVATFTQDSNAVLILDMRYPGS 315

Query: 191 PILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           PILT  + HS  VN  +WH   +N+  +  +D  +   D
Sbjct: 316 PILTL-EGHSSAVNQMRWHPTQRNVLLTCGDDCQVLYWD 353

>AFL157C Chr6 complement(140404..141720) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL247C
          Length = 438

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 56/262 (21%), Positives = 96/262 (36%), Gaps = 60/262 (22%)

Query: 162 FNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSE 221
           +N  +   +L  S D+   +WD+  ++   + T    H   V D K+     N+F S   
Sbjct: 172 WNALDTNLILFSSIDTTCTVWDL--QASNYVKTQLIAHDSEVFDAKFLTQSSNLFASCGG 229

Query: 222 DSTLQLHDQRIRDAAV------EKVQAKKPYNTLA--FSAHST----------------- 256
           D ++++ D R    +       ++VQ + P  T     +AH                   
Sbjct: 230 DGSVRVFDLRCLAHSTIIYEPQQQVQGQTPSQTQVHTLAAHEQDGQLQKNSQSSALSSSA 289

Query: 257 ----------------------NLFAAAGTDS-MVYLYDRRRASKPLHMMPGHEDAVTSL 293
                                 N+ A    DS +V + D R    P+ ++ GH   V  L
Sbjct: 290 SSSLGALDNCALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGSPMLLLEGHAAPVNQL 349

Query: 294 EFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMN 353
           ++HP +  VL + G D + + WDL E+ +          + +V       R S       
Sbjct: 350 KWHPSKPNVLATCGDDCQILYWDLLELLS----------ASQVWTGLTQQRWSTTSTVRT 399

Query: 354 PNIPWLTATAEEENIVQVWKPS 375
              P ++ TA+ E    VW+PS
Sbjct: 400 LETPQMSYTAQYEVNNFVWRPS 421

>TDEL0G02140 Chr7 complement(420388..421566) [1179 bp, 392 aa] {ON}
           Anc_2.283 YNL035C
          Length = 392

 Score = 49.3 bits (116), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 63/126 (50%), Gaps = 13/126 (10%)

Query: 210 NFDQNIFGSVSEDSTLQLHDQRIRDA-AVEKVQAKKPYNTL----AFSAHSTNLFAAAGT 264
           NF++    +V+ + ++ + D R RD  A  K     P+ +L       A  T L   +G 
Sbjct: 68  NFNEGSSYAVASNDSVNILDVRSRDKLASLKNDKNAPFLSLDSRHGMLACGTEL---SGV 124

Query: 265 DSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAE 323
           D+ +++YD R  S P+   +  H D VT + FHP +  VL+S  +D  T ++DL     +
Sbjct: 125 DAELHIYDVRNWSTPIRSFVDSHHDDVTDIRFHPSDRNVLLSGSTDGYTNVYDL----KQ 180

Query: 324 QVPDDA 329
           Q  DDA
Sbjct: 181 QEEDDA 186

>KNAG0H02040 Chr8 (366384..367583) [1200 bp, 399 aa] {ON} Anc_2.283
           YNL035C
          Length = 399

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 84/181 (46%), Gaps = 15/181 (8%)

Query: 147 LSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDI---- 202
           + ++ F +EN +     P  K  +L+   +  + L D   KS + I  F    + I    
Sbjct: 7   IGSYFFGSEN-WCFQIQPLYKAGILTSLSNGEVHLMD--WKSNKSINKFKSDETAINALQ 63

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           + +  WHN  + I  S+     ++L D R  +A +  +  +     L+  +    +    
Sbjct: 64  IVNTDWHNETRFITASMH---AVKLFDVR-SNACIGTIHNEVGAPFLSLDSRYDKIACGT 119

Query: 263 ---GTDSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA 318
              G D+ ++++D R+   P   ++  H D +TS++FHP +  VL+S  +D  T ++DL+
Sbjct: 120 ELKGVDAQLHIFDLRKLDNPWKSLVDSHHDDITSIKFHPSDCNVLLSGSTDGYTNIYDLS 179

Query: 319 E 319
           +
Sbjct: 180 Q 180

>Kwal_27.12053 s27 (1065073..1067340) [2268 bp, 755 aa] {ON} YBR198C
           (TAF5) - Probable transcription-associated factor
           protein, probable -transducin type [contig 24] FULL
          Length = 755

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 99/238 (41%), Gaps = 32/238 (13%)

Query: 147 LSTFQFHNENGYGLSFNPNEKGKLLS-GSDDSNIVLWDVTGK-------SQEPILTFTDR 198
           +  + FHN N    S   ++  +L + G  DS I +W + G+       S++   T  + 
Sbjct: 418 VCMYTFHNTNSEMTSLEFSDDVRLAAAGFQDSIIKIWSLDGEPLKNKLPSKQGERTNNET 477

Query: 199 ---HSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHS 255
              HS  V    +   D     S SED T++L       + V       P   +AFS   
Sbjct: 478 LVGHSGTVYSTSFSP-DNRYLLSASEDKTVRLWSTDTYTSLVNYKGHNHPIWDVAFSPLG 536

Query: 256 TNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI-L 314
            + FA A  D    L+       PL +  GH + V ++ FHP  +G  +  GS  +T  +
Sbjct: 537 -HYFATASHDQTARLWSCDHI-YPLRIFAGHLNDVDTVSFHP--NGTYVFTGSSDKTCRM 592

Query: 315 WDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVW 372
           WD+               S + + +  GH + +   +++P+  WL +T  E+ ++ VW
Sbjct: 593 WDIT--------------SGDSVRLFLGHTAPVTSTAVSPDGRWL-STGSEDGVINVW 635

 Score = 35.0 bits (79), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 46/178 (25%), Positives = 77/178 (43%), Gaps = 9/178 (5%)

Query: 147 LSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDC 206
           L  ++ HN   + ++F+P       + S D    LW        P+  F   H + V+  
Sbjct: 517 LVNYKGHNHPIWDVAFSPLGH-YFATASHDQTARLWSC--DHIYPLRIFAG-HLNDVDTV 572

Query: 207 KWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDS 266
            +H     +F + S D T ++ D    D+    +    P  + A S     L +    D 
Sbjct: 573 SFHPNGTYVF-TGSSDKTCRMWDITSGDSVRLFLGHTAPVTSTAVSPDGRWL-STGSEDG 630

Query: 267 MVYLYDRRRASKPLHMMPGH-EDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAE 323
           ++ ++D     K L  M GH ++AV SL +  +E  VLIS G+D    +WD+ +  AE
Sbjct: 631 VINVWDIG-TGKRLKQMRGHGKNAVYSLSYS-KEGHVLISGGADHSVRVWDVKKSTAE 686

>NCAS0D02730 Chr4 (523453..524880) [1428 bp, 475 aa] {ON} Anc_5.201
          Length = 475

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/185 (27%), Positives = 83/185 (44%), Gaps = 27/185 (14%)

Query: 153 HNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDC------ 206
           H +  Y ++ N     KL +GS D  +  W+++  ++E + +F   +  I   C      
Sbjct: 66  HRDGVYVIAKNYKNLNKLATGSADGVVKYWNMS--TREELCSFKAHYGLITGLCVTPEHL 123

Query: 207 -KWHNFDQNIFGSVSEDSTLQLHDQRIRDAA----VEKVQA-----KKPYNTLAFSA--- 253
            K  N  +N   S S+D T++L      D A     E +       K  Y+  AF     
Sbjct: 124 SKQKN--ENFMLSCSDDKTVKLWSVNSEDYANLKNAEDINTASGLLKTYYSDFAFQGIDH 181

Query: 254 -HSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRT 312
             S + F   G  + + L+D  R SKPL  +    D +++++F+  E  +L SAGSD   
Sbjct: 182 HRSKSNFVTGG--AKIQLWDSNR-SKPLTDLSWGADNISTVKFNQNETDILASAGSDNSL 238

Query: 313 ILWDL 317
           +L+DL
Sbjct: 239 VLYDL 243

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/170 (25%), Positives = 78/170 (45%), Gaps = 10/170 (5%)

Query: 144 SGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIV 203
           SGLL T+  +++  +    +   K   ++G   + I LWD    ++   LT     +D +
Sbjct: 164 SGLLKTY--YSDFAFQGIDHHRSKSNFVTGG--AKIQLWD---SNRSKPLTDLSWGADNI 216

Query: 204 NDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAG 263
           +  K++  + +I  S   D++L L+D R      + VQ  +  N + ++      F  A 
Sbjct: 217 STVKFNQNETDILASAGSDNSLVLYDLRTNSPTQKIVQTMRT-NAICWNPMEAFNFVVAN 275

Query: 264 TDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI 313
            D   Y YD R  S+ L++   H  AV  ++F P  D ++   GS  +TI
Sbjct: 276 EDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFSPTGDEIV--TGSYDKTI 323

>TDEL0A07550 Chr1 complement(1314676..1316223) [1548 bp, 515 aa]
           {ON} Anc_6.340 YCR072C
          Length = 515

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/202 (25%), Positives = 81/202 (40%), Gaps = 19/202 (9%)

Query: 118 PQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDS 177
           P D   +A+ S  GTI +++ +  V    + T   H  +   + +    +G L SGS D 
Sbjct: 245 PGDKPRLASASKDGTIKIWDTSRRV---CIYTLSGHTNSVSCVKWG--GQGLLYSGSHDK 299

Query: 178 NIVLWD--VTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDA 235
            + +WD  V GK     +     H+  VN            G     +T     +  R  
Sbjct: 300 TVRVWDMNVGGK----CINILKSHAHWVNHLSLSTEYALRVGPFDHTATKFTSAEEARKK 355

Query: 236 AVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEF 295
           A+E  +     N       +  L   A  D  ++L+D  ++ KPL  + GH+  V  + F
Sbjct: 356 ALENYEKIAKRN-----GKAEELIVTASDDFTMFLWDPTKSGKPLARLTGHQKLVNHVAF 410

Query: 296 HPQEDG-VLISAGSDRRTILWD 316
            P  DG  ++SA  D    LWD
Sbjct: 411 SP--DGRFIVSASFDNSIKLWD 430

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/172 (21%), Positives = 79/172 (45%), Gaps = 17/172 (9%)

Query: 162 FNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSE 221
           F P+   ++++G+ D+   +WD    +Q P+ T +  H + V    W + D     + S 
Sbjct: 151 FAPHTSSRMVTGAGDNTARVWDC--DTQTPMATLSG-HQNWVLCVAW-SPDGETIATGSM 206

Query: 222 DSTLQLHDQRIRDAAVEKVQAKKPYNT--------LAFSAHSTNLFAAAGTDSMVYLYDR 273
           D T++L D +      + ++  + + T        L        L A+A  D  + ++D 
Sbjct: 207 DCTVRLWDSKAGQPLGDALKGHQKWITSLVWEPLHLVKPGDKPRL-ASASKDGTIKIWDT 265

Query: 274 RRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQV 325
            R    ++ + GH ++V+ +++  Q  G+L S   D+   +WD+  +G + +
Sbjct: 266 SRRV-CIYTLSGHTNSVSCVKWGGQ--GLLYSGSHDKTVRVWDM-NVGGKCI 313

>KAFR0A06480 Chr1 complement(1312834..1314540) [1707 bp, 568 aa]
           {ON} Anc_4.122 YGL003C
          Length = 568

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 62/222 (27%), Positives = 103/222 (46%), Gaps = 22/222 (9%)

Query: 122 NLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIV- 180
           +L+A   G  +I+L N +N     L  T     EN Y  S N    G  L+    + IV 
Sbjct: 276 DLLAVALG-KSIFLTNNSNGEVIHLCDT-----ENEY-TSLNWVGSGSHLAVGQSNGIVE 328

Query: 181 LWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKV 240
           ++DV  K  + I T    HSD V    W+++   I  S S D  +   D R  D   EK+
Sbjct: 329 IFDVNKK--KCIRTMLG-HSDRVACLSWNSY---ILTSGSRDHNILHRDVRSPDPFFEKI 382

Query: 241 QA-KKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQE 299
           ++  +    L ++    N   + G D++V +YDR  ++KP   M  H+ AV +L++   +
Sbjct: 383 ESHSQEVCGLKWNVDE-NKLVSGGNDNIVNVYDRT-STKPFMTMTEHKAAVKALDWSSHK 440

Query: 300 DGVLISAG--SDRRTILWDLAEIGAEQVPDDADDGSPEVMMI 339
            G+L + G  +DR   +W++  +      +D D GS    ++
Sbjct: 441 RGILATGGGTADRHLKIWNVNNMTK---LNDVDTGSQVCNLV 479

>YPL151C Chr16 complement(266180..267535) [1356 bp, 451 aa] {ON}
           PRP46Member of the NineTeen Complex (NTC) that contains
           Prp19p and stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs
          Length = 451

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 51/203 (25%), Positives = 92/203 (45%), Gaps = 35/203 (17%)

Query: 160 LSFNPNEKGKLLSGSDDSNIVLWDV-TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGS 218
           ++ +P +    ++GS+D+ + +WD+ TGK    + T    H   V D    +    +F S
Sbjct: 145 VAIDPVDNEWFITGSNDTTMKVWDLATGK----LKTTLAGHVMTVRDVAVSDRHPYLF-S 199

Query: 219 VSEDSTLQLHDQRIRDAAVEKVQAKKPY-----NTLAFSAHST-NLFAAAGTDSMVYLYD 272
           VSED T++  D       +EK Q  + Y          S H T +L A AG DS++ L+D
Sbjct: 200 VSEDKTVKCWD-------LEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWD 252

Query: 273 RRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDG 332
             R   P+  + GH+  +  ++  P  D  ++S+ +D    LWD+               
Sbjct: 253 -MRTRIPVITLVGHKGPINQVQCTPV-DPQVVSSSTDATVRLWDVV-------------- 296

Query: 333 SPEVMMIHAGHRSSINDFSMNPN 355
           + + M +   H+ S+   +++P 
Sbjct: 297 AGKTMKVLTHHKRSVRATALHPK 319

 Score = 33.9 bits (76), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 27/127 (21%), Positives = 57/127 (44%), Gaps = 25/127 (19%)

Query: 259 FAAAGTDSMVYLYD----RRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTIL 314
           F     D+ + ++D    + + +   H+M   + AV+  + HP     L S   D+    
Sbjct: 155 FITGSNDTTMKVWDLATGKLKTTLAGHVMTVRDVAVS--DRHP----YLFSVSEDKTVKC 208

Query: 315 WDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKP 374
           WDL +               +++  + GH S +   S++P +  L ATA  ++++++W  
Sbjct: 209 WDLEK--------------NQIIRDYYGHLSGVRTVSIHPTLD-LIATAGRDSVIKLWDM 253

Query: 375 SSKLPRI 381
            +++P I
Sbjct: 254 RTRIPVI 260

>ZYRO0F07282g Chr6 (590095..591378) [1284 bp, 427 aa] {ON} similar
           to uniprot|Q12417 Saccharomyces cerevisiae YPL151C PRP46
           Splicing factor that is found in the Cef1p subcomplex of
           the spliceosome
          Length = 427

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 52/203 (25%), Positives = 91/203 (44%), Gaps = 35/203 (17%)

Query: 160 LSFNPNEKGKLLSGSDDSNIVLWDV-TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGS 218
           L  +P +     +GS+D+ + +WD+ +GK +   LT    H   V D         +F S
Sbjct: 121 LKVDPVDNEWFATGSNDTTVKIWDLASGKLK---LTLAG-HVMTVRDVAISQRHPYLF-S 175

Query: 219 VSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHST------NLFAAAGTDSMVYLYD 272
            SED  ++  D       +EK Q  + Y+      H+       +L A+AG D +V L+D
Sbjct: 176 ASEDKMVKCWD-------LEKNQIIRDYHGHLSGVHTVDIHPTLDLIASAGRDGVVKLWD 228

Query: 273 RRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDG 332
            R  +  + ++ GH+  +T +   P    V +S+ +D    LWD+              G
Sbjct: 229 IRSRTAVMTLI-GHKSPITKVHCLPVNPQV-VSSSTDATVRLWDVTA------------G 274

Query: 333 SPEVMMIHAGHRSSINDFSMNPN 355
               ++ H  H+ S+ DFS++P+
Sbjct: 275 KSYKILTH--HKRSVRDFSLHPS 295

 Score = 34.7 bits (78), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 46/203 (22%), Positives = 85/203 (41%), Gaps = 22/203 (10%)

Query: 122 NLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVL 181
           +LIA+    G + L++  +      L   +      + L  NP    +++S S D+ + L
Sbjct: 213 DLIASAGRDGVVKLWDIRSRTAVMTLIGHKSPITKVHCLPVNP----QVVSSSTDATVRL 268

Query: 182 WDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQ 241
           WDVT      ILT    H   V D   H  + ++  + ++D    +   ++ + A+    
Sbjct: 269 WDVTAGKSYKILT---HHKRSVRDFSLHPSEFSMVSACTDD----IRSWKLPEGALLTNF 321

Query: 242 AKKPYNTL-AFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHM----MPG---HEDAVTSL 293
           A +    +   S +  ++  A G D M+  YD +   K   M    +PG    E A+ + 
Sbjct: 322 ASESTGIINTLSVNQDDVLFAGGDDGMLSFYDYKSGHKYQTMATQEVPGSLESERAILTS 381

Query: 294 EFHPQEDGV-LISAGSDRRTILW 315
            F     G+ LI+  +D+   +W
Sbjct: 382 AF--DRTGLRLITGEADKSIKVW 402

 Score = 33.5 bits (75), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 22/95 (23%), Positives = 44/95 (46%), Gaps = 15/95 (15%)

Query: 278 KPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVM 337
           K + ++ GH   V  L+  P ++    +  +D    +WDLA              S ++ 
Sbjct: 106 KLIRVINGHVGWVRCLKVDPVDNEWFATGSNDTTVKIWDLA--------------SGKLK 151

Query: 338 MIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVW 372
           +  AGH  ++ D +++   P+L  +A E+ +V+ W
Sbjct: 152 LTLAGHVMTVRDVAISQRHPYL-FSASEDKMVKCW 185

>Ecym_8072 Chr8 (157039..160644) [3606 bp, 1201 aa] {ON} similar to
           Ashbya gossypii ADR077C
          Length = 1201

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 70/297 (23%), Positives = 120/297 (40%), Gaps = 77/297 (25%)

Query: 99  VKIIKKFEHENEVTRARYMPQDDN----LIATISGVGTIYLYNRANEVESGLLSTFQFHN 154
           +K++ KFE ++  TRA+ +    +    L+A  S   TI L++    V   LL  F+ H 
Sbjct: 1   MKMLTKFESKS--TRAKAIAFHPSRPWVLVALFSS--TIQLWDYRMGV---LLHRFEDHE 53

Query: 155 ENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQN 214
               G+ F+P +    +SG DD  + +W +   S++ + T    H D V    +HN    
Sbjct: 54  GPVRGVDFHPTQP-LFVSGGDDYTVKVWSL--DSRKCLFTLHG-HLDYVRTVFFHNELPW 109

Query: 215 IFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRR 274
           I  S S+D T+++ + + R                                         
Sbjct: 110 II-SASDDQTIRIWNWQNR----------------------------------------- 127

Query: 275 RASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA---------------E 319
              K +  + GH   V   +FHP ED ++ISA  D    +WD++               E
Sbjct: 128 ---KEIACLTGHNHFVMCAQFHPNED-LVISASLDETVRVWDISGLRKRHSAPGSQNFDE 183

Query: 320 IGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKPSS 376
           + ++Q   D   G   V  I  GH   +N  S +P +P L  +  ++  V++W+ S+
Sbjct: 184 VISQQNLFDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQVKLWRMSA 239

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 92/234 (39%), Gaps = 32/234 (13%)

Query: 132 TIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEP 191
           TI ++N  N  E   L+    HN       F+PNE   ++S S D  + +WD++G     
Sbjct: 118 TIRIWNWQNRKEIACLTG---HNHFVMCAQFHPNED-LVISASLDETVRVWDISG----- 168

Query: 192 ILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAF 251
                 RHS   +     NFD+ I       S   L D    D  V+ +           
Sbjct: 169 ---LRKRHSAPGS----QNFDEVI-------SQQNLFDGGFGDCVVKFILEGHTRGVNWA 214

Query: 252 SAHSTNLFAAAGTDSMVYLYDRRRASKP--LHMMPGHEDAVTSLEFHPQEDGVLISAGSD 309
           S H T     +G+D       R  A+K   +    GH + V S+ FHP ++ ++IS G D
Sbjct: 215 SFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHSNNVDSVIFHPYQN-LIISVGED 273

Query: 310 RRTILWDL-AEIGAEQVPDDAD-----DGSPEVMMIHAGHRSSINDFSMNPNIP 357
               +WDL      +Q   + D        P + +  A H S I  F ++   P
Sbjct: 274 STIRVWDLDRRTPVKQFKREQDRFWLVRAHPNINLFGAAHDSGIMIFKLDRERP 327

>SAKL0A01276g Chr1 (124778..126325) [1548 bp, 515 aa] {ON} highly
           similar to uniprot|P25382 Saccharomyces cerevisiae
           YCR072C Protein required for cell viability
          Length = 515

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 73/319 (22%), Positives = 122/319 (38%), Gaps = 75/319 (23%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYLY--NRANEVESGLLSTFQFHNENGYGLSF-- 162
           H N V    + P D  LIAT S   TI L+  N+   V   L    + H +    LS+  
Sbjct: 185 HFNWVLCVSWSP-DGELIATGSMDNTIRLWEGNKGQPVGDAL----RGHGKWITSLSWEP 239

Query: 163 ----NPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGS 218
                P +K +L S S D  I +WD T   +   L     H+  V+  KW    Q +  S
Sbjct: 240 IHLVKPGQKPRLASASKDGTIKIWDTT---RRVCLITLSGHTSSVSCIKWGG--QGVLYS 294

Query: 219 VSEDSTLQLHDQRIRDAAVEKVQAKKPY-NTLAFSA----------HSTN---------- 257
            S D T++  D  +    +  +++   + N L+ S           H++           
Sbjct: 295 GSHDKTIRAWDMNLGGKCINILKSHAHWVNHLSLSTDYALRIGAFDHTSEKPSTPEEAQK 354

Query: 258 ------------------LFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQE 299
                             L   A  D  +YL++  +++KP+  M GH+  V  + F P  
Sbjct: 355 RALKNYEKIAKRNGEVEELMVTASDDFTMYLWNPLKSTKPITRMTGHQKLVNHVAFSP-- 412

Query: 300 DGV-LISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPW 358
           DG  ++SA  D    LW            +  DG  + +    GH +S+   + + +   
Sbjct: 413 DGRHIVSASFDNSIKLW------------NGRDG--KFISTFRGHVASVYQVAWSSDCR- 457

Query: 359 LTATAEEENIVQVWKPSSK 377
           L  +  ++  ++VW   +K
Sbjct: 458 LLVSCSKDTTLKVWDVKTK 476

 Score = 39.3 bits (90), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 41/185 (22%), Positives = 74/185 (40%), Gaps = 30/185 (16%)

Query: 148 STFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCK 207
           S    H       +F P+   ++++G+ D+   +WD    +Q P+ T    H + V    
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMITGAGDNTARIWDCN--TQTPMSTLKG-HFNWVLCVS 193

Query: 208 WHNFDQNIFGSVSEDSTLQL---------------HDQRIRDAAVEKVQAKKPYNTLAFS 252
           W + D  +  + S D+T++L               H + I   + E +   KP       
Sbjct: 194 W-SPDGELIATGSMDNTIRLWEGNKGQPVGDALRGHGKWITSLSWEPIHLVKP------- 245

Query: 253 AHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRT 312
                  A+A  D  + ++D  R    L  + GH  +V+ +++  Q  GVL S   D+  
Sbjct: 246 -GQKPRLASASKDGTIKIWDTTRRV-CLITLSGHTSSVSCIKWGGQ--GVLYSGSHDKTI 301

Query: 313 ILWDL 317
             WD+
Sbjct: 302 RAWDM 306

>Smik_6.348 Chr6 (556719..558074) [1356 bp, 451 aa] {ON} YPL151C
           (REAL)
          Length = 451

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 50/193 (25%), Positives = 87/193 (45%), Gaps = 35/193 (18%)

Query: 170 LLSGSDDSNIVLWDV-TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLH 228
            ++GS+D+ + +WD+ TGK    + T    H   V D    +    +F SVSED T++  
Sbjct: 155 FITGSNDTTMKVWDLATGK----LRTTLAGHVMTVRDIAISDRHPYLF-SVSEDKTVKCW 209

Query: 229 DQRIRDAAVEKVQAKKPY-----NTLAFSAHST-NLFAAAGTDSMVYLYDRRRASKPLHM 282
           D       +EK Q  + Y          S H T +L A AG DS++ L+D  R   P+  
Sbjct: 210 D-------LEKNQIIRDYYGHLSGVRTVSIHPTLDLIATAGRDSVIKLWD-IRTRVPVIT 261

Query: 283 MPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAG 342
           + GH+  +  ++  P  D  ++S+ +D    LWD+               + + M +   
Sbjct: 262 LVGHKGPINQVQCTPV-DPQIVSSSTDATVRLWDVV--------------AGKAMKVLTH 306

Query: 343 HRSSINDFSMNPN 355
           H+ S+   +++P 
Sbjct: 307 HKRSVRATALHPK 319

 Score = 35.0 bits (79), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 27/127 (21%), Positives = 57/127 (44%), Gaps = 25/127 (19%)

Query: 259 FAAAGTDSMVYLYD----RRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTIL 314
           F     D+ + ++D    + R +   H+M   + A++  + HP     L S   D+    
Sbjct: 155 FITGSNDTTMKVWDLATGKLRTTLAGHVMTVRDIAIS--DRHP----YLFSVSEDKTVKC 208

Query: 315 WDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWKP 374
           WDL +               +++  + GH S +   S++P +  L ATA  ++++++W  
Sbjct: 209 WDLEK--------------NQIIRDYYGHLSGVRTVSIHPTLD-LIATAGRDSVIKLWDI 253

Query: 375 SSKLPRI 381
            +++P I
Sbjct: 254 RTRVPVI 260

>KLLA0F04884g Chr6 complement(478044..481682) [3639 bp, 1212 aa]
           {ON} highly similar to uniprot|P53622 Saccharomyces
           cerevisiae YDL145C COP1 Alpha subunit of COPI vesicle
           coatomer complex which surrounds transport vesicles in
           the early secretory pathway
          Length = 1212

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 53/247 (21%), Positives = 103/247 (41%), Gaps = 25/247 (10%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           +L+ F+  +    G++F+P+ +  +L     S I LWD        +L   + H   V  
Sbjct: 3   MLTKFESKSTRAKGIAFHPS-RPWVLVALFSSTIQLWDY---RMGVLLHRFEDHEGPVRG 58

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +H   Q +F S  +D T+++      +  +  +     Y    F  H      ++  D
Sbjct: 59  IDFHP-TQPLFVSAGDDYTIKVWSLE-SNKCLFTLDGHLDYVRTVFFHHELPWIISSSDD 116

Query: 266 SMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA------- 318
             + +++ +   K +  + GH   V   +FHP ED +++SA  D    +WD++       
Sbjct: 117 QTIRIWNWQN-RKEIACLTGHNHFVMCAQFHPVED-LVVSASLDETVRVWDISGLRKRHS 174

Query: 319 ---------EIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIV 369
                    ++  +Q   D   G   V  I  GH   +N  S +P +P L  +  ++  V
Sbjct: 175 APGTQSFEEQMRQQQNLLDGGFGDCVVKFILEGHTRGVNWASFHPTLP-LIVSGSDDRQV 233

Query: 370 QVWKPSS 376
           ++W+ S+
Sbjct: 234 KLWRMSA 240

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/234 (23%), Positives = 91/234 (38%), Gaps = 31/234 (13%)

Query: 132 TIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEP 191
           TI ++N  N  E   L+    HN       F+P E   ++S S D  + +WD++G  +  
Sbjct: 118 TIRIWNWQNRKEIACLTG---HNHFVMCAQFHPVED-LVVSASLDETVRVWDISGLRKRH 173

Query: 192 ILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAF 251
               T    + +   +  N     FG       L+ H + +  A                
Sbjct: 174 SAPGTQSFEEQMR--QQQNLLDGGFGDCVVKFILEGHTRGVNWA---------------- 215

Query: 252 SAHSTNLFAAAGTDSMVYLYDRRRASKP--LHMMPGHEDAVTSLEFHPQEDGVLISAGSD 309
           S H T     +G+D       R  A+K   +    GH + V S+ FHPQ++ ++IS G D
Sbjct: 216 SFHPTLPLIVSGSDDRQVKLWRMSATKAWEVDTCRGHTNNVDSVIFHPQQN-LIISVGED 274

Query: 310 RRTILWDL-AEIGAEQVPDDAD-----DGSPEVMMIHAGHRSSINDFSMNPNIP 357
           +   +WDL      +Q   + D        P + +  A H S I  F ++   P
Sbjct: 275 KTVRVWDLDKRTPIKQFKRENDRFWLVRAHPNLNLFGAAHDSGIMIFKLDRERP 328

>NDAI0I00460 Chr9 (91809..94562) [2754 bp, 917 aa] {ON} Anc_6.325
          Length = 917

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/168 (27%), Positives = 79/168 (47%), Gaps = 8/168 (4%)

Query: 151 QFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHN 210
           Q H ++   L+++P +  ++++ +DD  I +WDV   S   + TFT+ H+  V   ++  
Sbjct: 338 QGHFDSTNSLTYSP-DGSRVVTAADDGKIKVWDVV--SGFCLATFTE-HTSSVTQVQFAK 393

Query: 211 FDQNIFGSVSEDSTLQLHDQ-RIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVY 269
             Q +F S S D T++  D  R R+        +  +N LA    S  +  A   DS   
Sbjct: 394 KGQVLFSS-SLDGTVRAWDLIRYRNFRTFTAAERIQFNCLAVDP-SGEVVCAGSIDSFDI 451

Query: 270 LYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
                +  + L  + GHE  V+ L F  QE+ VL SA  D+   +W +
Sbjct: 452 HVWSVQTGQLLDTLSGHEGPVSCLSF-SQENSVLASASWDKTVRIWSI 498

>TDEL0A06180 Chr1 (1082208..1083512) [1305 bp, 434 aa] {ON}
           Anc_8.672 YPL151C
          Length = 434

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/200 (26%), Positives = 90/200 (45%), Gaps = 35/200 (17%)

Query: 163 NPNEKGKLLSGSDDSNIVLWDV-TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSE 221
           +P +     +GS+D++I +WD+ +GK +   LT +  H   V D         +F S SE
Sbjct: 131 DPVDNAWYATGSNDTSIKVWDLASGKLK---LTLSG-HIMTVRDLAISERHPYMF-SASE 185

Query: 222 DSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHST------NLFAAAGTDSMVYLYDRRR 275
           D T++  D       +EK    + Y+      H+       +L  +AG DS+V L+D  R
Sbjct: 186 DKTIKCWD-------LEKNMVIRNYHGHLSGVHTVSLHPTLDLVVSAGRDSVVKLWD-MR 237

Query: 276 ASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPE 335
              P+  + GH+  +  +   P  D  +IS  +D    LWD+              G   
Sbjct: 238 TRVPVMNLIGHKSPINKVRCLPV-DPQIISCSTDANIRLWDITA------------GKSA 284

Query: 336 VMMIHAGHRSSINDFSMNPN 355
            ++ H  H+ S+ DF+++P+
Sbjct: 285 KILTH--HKRSVRDFALHPS 302

 Score = 35.8 bits (81), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 36/152 (23%), Positives = 63/152 (41%), Gaps = 12/152 (7%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDI--VNDCKWHNFDQNIFGSVSEDSTLQL 227
           + S S+D  I  WD+     E  +   + H  +  V+    H    ++  S   DS ++L
Sbjct: 180 MFSASEDKTIKCWDL-----EKNMVIRNYHGHLSGVHTVSLHP-TLDLVVSAGRDSVVKL 233

Query: 228 HDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHE 287
            D R R   +  +  K P N +        + + + TD+ + L+D   A K   ++  H+
Sbjct: 234 WDMRTRVPVMNLIGHKSPINKVRCLPVDPQIISCS-TDANIRLWD-ITAGKSAKILTHHK 291

Query: 288 DAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
            +V     HP E  +  +   D R+  W L E
Sbjct: 292 RSVRDFALHPSEFSMASACTDDIRS--WKLPE 321

 Score = 30.4 bits (67), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 19/95 (20%), Positives = 44/95 (46%), Gaps = 15/95 (15%)

Query: 278 KPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVM 337
           K + ++ GH   V  +E  P ++    +  +D    +WDLA              S ++ 
Sbjct: 113 KLIRVINGHIGWVRCVEVDPVDNAWYATGSNDTSIKVWDLA--------------SGKLK 158

Query: 338 MIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVW 372
           +  +GH  ++ D +++   P++ + +E++ I + W
Sbjct: 159 LTLSGHIMTVRDLAISERHPYMFSASEDKTI-KCW 192

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 61/143 (42%), Gaps = 21/143 (14%)

Query: 169 KLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLH 228
           +++S S D+NI LWD+T      ILT    H   V D   H  + ++  + ++D    + 
Sbjct: 263 QIISCSTDANIRLWDITAGKSAKILT---HHKRSVRDFALHPSEFSMASACTDD----IR 315

Query: 229 DQRIRDAA-VEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMM---- 283
             ++ +   +   Q+       + S +  ++  A G D  +  YD +   K   ++    
Sbjct: 316 SWKLPEGILLTNFQSTSTGIINSLSINHDDVLFAGGDDGTLSFYDYKSGHKYQSLLTTEI 375

Query: 284 PGHEDAVTSLEFHPQEDGVLISA 306
           PG      SLE    E G+L S+
Sbjct: 376 PG------SLE---SERGILCSS 389

>TDEL0E04280 Chr5 complement(799966..801411) [1446 bp, 481 aa] {ON}
           Anc_5.201 YLL011W
          Length = 481

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 56/252 (22%), Positives = 98/252 (38%), Gaps = 63/252 (25%)

Query: 119 QDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPN------EKGKLLS 172
            D N +A+ SG G I  +N ++  E   + +F+ H     GL  +P       ++  +LS
Sbjct: 78  HDLNKVASGSGDGVIKYWNMSSRDE---ICSFKAHYGLITGLCVSPQRSPLNRDQHFMLS 134

Query: 173 GSDDSNIVLWDVTG------------KSQEPIL-TFTDRHS------------------- 200
             DD  + LW + G             SQ+ +L TF   H+                   
Sbjct: 135 CGDDKTVKLWSMNGDDFANVKDDQNLNSQDGLLKTFYGEHAFQGIDHHKVKTTFVTGGPT 194

Query: 201 -------------------DIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQ 241
                              D +   K++  + +I  S   D+++ L+D R  ++  +K+ 
Sbjct: 195 IQLWDTARSKPLSNLSWGADNITSVKFNQTETDILASTGSDNSIVLYDVRT-NSPTQKIV 253

Query: 242 AKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDG 301
            +   N + ++      F  A  D   Y YD R  S+ L++   H  AV  ++F P  D 
Sbjct: 254 QRLRTNAICWNPMEAFNFVTANEDHNAYYYDMRNMSRALNVFKDHVSAVMDVDFAPTGDE 313

Query: 302 VLISAGSDRRTI 313
           ++   GS  +TI
Sbjct: 314 IV--TGSYDKTI 323

 Score = 45.4 bits (106), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/184 (24%), Positives = 81/184 (44%), Gaps = 25/184 (13%)

Query: 153 HNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDC-----K 207
           H +  Y ++ + ++  K+ SGS D  I  W+++  S++ I +F   +  I   C      
Sbjct: 66  HRDGVYVIAKDYHDLNKVASGSGDGVIKYWNMS--SRDEICSFKAHYGLITGLCVSPQRS 123

Query: 208 WHNFDQNIFGSVSEDSTLQL------------HDQRI--RDAAVEKVQAKKPYNTLAFSA 253
             N DQ+   S  +D T++L             DQ +  +D  ++    +  +  +    
Sbjct: 124 PLNRDQHFMLSCGDDKTVKLWSMNGDDFANVKDDQNLNSQDGLLKTFYGEHAFQGIDHHK 183

Query: 254 HSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTI 313
             T       T   + L+D  R SKPL  +    D +TS++F+  E  +L S GSD   +
Sbjct: 184 VKTTFVTGGPT---IQLWDTAR-SKPLSNLSWGADNITSVKFNQTETDILASTGSDNSIV 239

Query: 314 LWDL 317
           L+D+
Sbjct: 240 LYDV 243

>Skud_16.32 Chr16 complement(56168..57736) [1569 bp, 522 aa] {ON}
           YPL247C (REAL)
          Length = 522

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 51/248 (20%), Positives = 95/248 (38%), Gaps = 47/248 (18%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           ++S S D+  ++WD+  +S   + T    H   V D ++      +F S   D ++++ D
Sbjct: 259 IISSSIDTTCIVWDL--QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFD 316

Query: 230 QRI-------------------RDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDS-MVY 269
            R                      A    ++       L  S +  N+ A    DS  + 
Sbjct: 317 LRSLAHSTIIYEPPSSPASGPNAGATTPSLKGSDALLRLEPSPYDPNVLATFAADSNKII 376

Query: 270 LYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDA 329
           + D R    P+  + GH  +V  +++HP +  VL+S   D + + WDL     E    D+
Sbjct: 377 ILDMRNPESPILNLEGHTCSVNEIKWHPTKRNVLLSCSDDCQALYWDLNNSFMEINGSDS 436

Query: 330 ----------DDGSPEVMMIHAGHRSSINDFSMN-------------PNIPWLTATAEEE 366
                     +D   + +M   G +++  +  +N             PN+ ++  T E  
Sbjct: 437 KSPTASGASLEDSDGDTVMADGGAKANQQEDPLNSNNDKQVCRTLDTPNMMYVNKTQEIN 496

Query: 367 NIVQVWKP 374
           NI   W+P
Sbjct: 497 NI--AWRP 502

>Suva_16.60 Chr16 complement(91552..93132) [1581 bp, 526 aa] {ON}
           YPL247C (REAL)
          Length = 526

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 74/191 (38%), Gaps = 28/191 (14%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           ++S S D+  ++WD+  +S   + T    H   V D ++      +F S   D ++++ D
Sbjct: 259 IISSSIDTTCIVWDL--QSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDGSVRVFD 316

Query: 230 QR-------------------IRDAAVEKVQAKKPYNTLAF--SAHSTNLFAAAGTDS-M 267
            R                      A      +   Y  L    S +  N+ A    DS  
Sbjct: 317 LRSLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYDPNVLATFAADSNK 376

Query: 268 VYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL----AEIGAE 323
           + + D R    P+  + GH  +V  +++HP +  VL+S   D + + WDL     EI   
Sbjct: 377 IIILDMRNPESPILTLEGHSSSVNEIKWHPTKRNVLLSCSDDCQVLYWDLNNSFMEINGG 436

Query: 324 QVPDDADDGSP 334
            V      G+P
Sbjct: 437 SVKSPGASGTP 447

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 20/73 (27%), Positives = 36/73 (49%), Gaps = 1/73 (1%)

Query: 118 PQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDS 177
           P D N++AT +      +       ES +L T + H+ +   + ++P ++  LLS SDD 
Sbjct: 361 PYDPNVLATFAADSNKIIILDMRNPESPIL-TLEGHSSSVNEIKWHPTKRNVLLSCSDDC 419

Query: 178 NIVLWDVTGKSQE 190
            ++ WD+     E
Sbjct: 420 QVLYWDLNNSFME 432

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 48/213 (22%), Positives = 77/213 (36%), Gaps = 43/213 (20%)

Query: 208 WHNFDQNIFGSVSEDSTLQLHD-QRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDS 266
           W+  D N+  S S D+T  + D Q       + +        + F   ST LFA+ G D 
Sbjct: 251 WNTVDTNLIISSSIDTTCIVWDLQSSHYVKTQLIAHDSEVFDVRFLTKSTQLFASCGGDG 310

Query: 267 MVYLYDRRRASKPLHM------------------MPGHED--AVTSLEFHPQEDGVLISA 306
            V ++D R  +    +                   P  +   A+  LE  P +  VL + 
Sbjct: 311 SVRVFDLRSLAHSTIIYEPPSSSSSSSAPAAGTTTPSSDGSYALLRLEPSPYDPNVLATF 370

Query: 307 GSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEE 366
            +D   I+          + D  +  SP  ++   GH SS+N+   +P    +  +  ++
Sbjct: 371 AADSNKII----------ILDMRNPESP--ILTLEGHSSSVNEIKWHPTKRNVLLSCSDD 418

Query: 367 NIVQVW----------KPSSKLPRIGGTPSVDT 389
             V  W            S K P   GTP  DT
Sbjct: 419 CQVLYWDLNNSFMEINGGSVKSPGASGTPLEDT 451

>KAFR0H03340 Chr8 (637913..639016) [1104 bp, 367 aa] {ON} Anc_2.283
           YNL035C
          Length = 367

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 52/189 (27%), Positives = 89/189 (47%), Gaps = 22/189 (11%)

Query: 151 QFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTF-TDRHSDIVNDCKWH 209
           Q    + + L F P     LL+   +  + L D   ++  P+  F  D+ S  +N  K  
Sbjct: 9   QSFGSDNWCLKFQPLYNHGLLTSLSNGEVKLLD--WETLNPVRNFKIDQVS--INSMKLI 64

Query: 210 NFDQN---IFGSVSEDSTLQLHDQRIRDAAVEKVQAKK-PYNTLAFSAHSTNLFAAA--- 262
           N D N   +F + + +S ++++D +  D        KK P+ +L  S H  ++ A     
Sbjct: 65  NNDYNNASLFATATLNS-VKIYDIKSNDCIATITNDKKSPFLSLD-SRH--DMLACGTEL 120

Query: 263 -GTDSMVYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEI 320
            G D+ +Y+YD R  S P+   +  H D +T ++FHP +   L+S  +D  T ++DL   
Sbjct: 121 QGVDAELYIYDVRNWSSPVKSFVDSHHDDITDIKFHPSDSNFLLSGSTDGYTNVYDL--- 177

Query: 321 GAEQVPDDA 329
             +Q  DDA
Sbjct: 178 -TQQEEDDA 185

>TBLA0H03620 Chr8 (882587..885025) [2439 bp, 812 aa] {ON} Anc_8.544
           YBR198C
          Length = 812

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 62/253 (24%), Positives = 99/253 (39%), Gaps = 47/253 (18%)

Query: 147 LSTFQFHNENGYGLSFNPNEKGKLLS-GSDDSNIVLWDVTGKS----------QEPILTF 195
           +  + FHN N    S   ++  +L S G  DS I +W + G S              +T 
Sbjct: 446 VCMYTFHNTNQDMTSLEFSDDCRLASTGFQDSYIKIWSLDGTSLNTKFTQANKDRNRITI 505

Query: 196 TDR---------------HSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKV 240
           TDR               HS  V    + + D     S SED T++L       A V   
Sbjct: 506 TDRSLTHMDNELSATLIGHSGTVYSTSF-SPDNRYLISGSEDKTVRLWSLDTHTALVSYK 564

Query: 241 QAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQED 300
               P   + FS    + FA A  D    L+       PL +  GH + V  + FHP  +
Sbjct: 565 GHNHPIWDVQFSPLG-HYFATASHDQTARLWSCDHIF-PLRIFAGHLNDVDCVSFHP--N 620

Query: 301 GVLISAGSDRRTI-LWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPWL 359
           G  +  GS  +T  +WD++              + + + +  GH S++   +++P+  WL
Sbjct: 621 GYYVFTGSSDKTCRMWDIS--------------TGDSVRLFLGHTSAVVSTAVSPDGRWL 666

Query: 360 TATAEEENIVQVW 372
           T T  ++  + VW
Sbjct: 667 T-TGSDDGTINVW 678

>Skud_12.56 Chr12 (118914..120383) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/192 (24%), Positives = 80/192 (41%), Gaps = 35/192 (18%)

Query: 153 HNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDC------ 206
           H +  Y ++ N     KL +GS D  I  W+++  ++E  ++F   +  I   C      
Sbjct: 66  HRDGIYAIAKNYGSLNKLATGSADGVIKYWNMS--TREEFVSFKAHYGLITGLCVTQPHF 123

Query: 207 -----KWHNFDQNIFGSVSEDSTLQLHDQRIRDAA----------------VEKVQAKKP 245
                 W N  QN   S S+D T++L    + D +                V     +  
Sbjct: 124 HDKKSDWKN--QNFMLSCSDDKTVKLWSINVDDYSNKRSSDNDSVTNEEGLVRTFDGESA 181

Query: 246 YNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLIS 305
           +  +  S    + FA  G  + ++L+D  R  KP+  +    D +TS+ F+  E  +L S
Sbjct: 182 FQGID-SHRENSTFATGG--AKIHLWDVNRL-KPISNLSWGADNITSVRFNQNETDILAS 237

Query: 306 AGSDRRTILWDL 317
            GSD   +L+DL
Sbjct: 238 TGSDNSIVLYDL 249

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 71/164 (43%), Gaps = 8/164 (4%)

Query: 143 ESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDI 202
           E GL+ TF    E+ +    +  E     +G   + I LWDV     +PI   +   +D 
Sbjct: 169 EEGLVRTFD--GESAFQGIDSHRENSTFATGG--AKIHLWDVN--RLKPISNLS-WGADN 221

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           +   +++  + +I  S   D+++ L+D R      + VQ  +  N + ++      F  A
Sbjct: 222 ITSVRFNQNETDILASTGSDNSIVLYDLRTNSPTQKIVQTMRT-NAICWNPMEAFNFVTA 280

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISA 306
             D   Y YD R  S+ L +   H  AV  ++F P  D ++  +
Sbjct: 281 NEDHNAYYYDMRNLSRSLTVFKDHVSAVMDVDFSPTGDEIVTGS 324

>KNAG0A03070 Chr1 complement(378279..379604) [1326 bp, 441 aa] {ON} 
           gene spans a gap in the genome sequence
          Length = 441

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/256 (22%), Positives = 105/256 (41%), Gaps = 44/256 (17%)

Query: 158 YGLSFNPNEKGKLLS-GSDDSNIV-LWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNI 215
           + LSF+     K  S G+++S+I+ + D  GK  E + T T   + + +  K+  FD ++
Sbjct: 174 FDLSFDGETIVKSQSNGTEESSILKIVDNAGKPSEILRTITVPGTTVAHTVKF--FDNHL 231

Query: 216 FGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHST--NLFAAAGTDSMVYLYDR 273
           F S S+D+ L+  D R +D  +  +   +      F + +   NLF    +  ++ L+D 
Sbjct: 232 FASCSDDNVLRFWDTRTQDKPLFVLADPQNGRLSCFDSSTVNNNLFVTGFSTGIMKLWDI 291

Query: 274 RRASKPLHMMPGHE------------------DAVTSLEFHPQEDGVLISAGSDRRTILW 315
           R     L      +                  D+V  ++F P     L++ G       W
Sbjct: 292 RCVENALEDFTYRQNGEDPIQKEVANFYHSGGDSVVDVQFSPTSPSELVTVGGSGNIYHW 351

Query: 316 D----LAEIGAEQVPDDADDGSPEVM-----MIHA--------GHRSSINDFSMNPNIPW 358
           D    LA    E   +   D S E+       +H         G R+++   + +P I  
Sbjct: 352 DMDYALANYSVEDTSNLPQDASEELQNESLKFVHKRVASKKIIGKRNTV---ACHPIIDG 408

Query: 359 LTATAEEENIVQVWKP 374
           L  T + +++V V+KP
Sbjct: 409 LVGTVDNDSLVSVYKP 424

>KLTH0F16192g Chr6 (1312331..1313719) [1389 bp, 462 aa] {ON} similar
           to uniprot|P40968 Saccharomyces cerevisiae YDR364C CDC40
           Pre-mRNA splicing factor important for catalytic step II
           of pre-mRNA splicing and plays a role in cell cycle
           progression required for DNA synthesis during mitosis
           and meiosis has WD repeats
          Length = 462

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 55/220 (25%), Positives = 93/220 (42%), Gaps = 17/220 (7%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVND 205
           ++ +++ H+     +   P      LSG +D+ + LWDV  K +  +L     HS  V D
Sbjct: 161 MIHSYRGHHNGTTTIKMLPKSGHLFLSGGNDNKVKLWDVYHKRE--LLRDYCGHSKAVRD 218

Query: 206 CKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTD 265
             +     + F SVS D  +++ +    D          P N   FS  ++N      ++
Sbjct: 219 VSFSGSGTS-FLSVSYDQHMKIWNTETGDIEHRYKFPAVP-NCAEFSPANSNELIVGLSN 276

Query: 266 SMVYLYDRRRASKP--LHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWD-LAEIGA 322
           S V  YD R A K   + +   H  ++ +L++ P +    IS+  D+   +WD    I  
Sbjct: 277 SEVRHYDLRVAHKDGLVQVYDHHLSSIIALKYFP-DGSKFISSSEDKSMRIWDNQVNIPI 335

Query: 323 EQVPDDADDGSPEVMMIHAGHR--------SSINDFSMNP 354
           +Q+ D A    P  + IH  H         ++I  FSM P
Sbjct: 336 KQISDTAQYSMP-FIDIHPEHHYFATQSMDNAIYAFSMKP 374

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 90/209 (43%), Gaps = 12/209 (5%)

Query: 114 ARYMPQDDN-LIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLS 172
           A + P + N LI  +S    +  Y+     + GL+  +  H  +   L + P +  K +S
Sbjct: 260 AEFSPANSNELIVGLSN-SEVRHYDLRVAHKDGLVQVYDHHLSSIIALKYFP-DGSKFIS 317

Query: 173 GSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQR- 231
            S+D ++ +WD   +   PI   +D     +     H  + + F + S D+ +     + 
Sbjct: 318 SSEDKSMRIWD--NQVNIPIKQISDTAQYSMPFIDIHP-EHHYFATQSMDNAIYAFSMKP 374

Query: 232 -IRDAAVEKVQAKKPYN-TLAFSAHSTNLFAAAG-TDSMVYLYDRRRASKPLHM-MPGHE 287
             R    ++ +  K     + F       + A+G T   VY++D +      H  +PG +
Sbjct: 375 KYRRNPKKRFEGHKCAGYGIGFGFSPDGQYLASGDTKGRVYIWDWKTTRLLKHFEVPG-K 433

Query: 288 DAVTSLEFHPQEDGVLISAGSDRRTILWD 316
            AV ++ + PQE   ++ AG+  R  L+D
Sbjct: 434 KAVITVAWAPQETSKMLCAGNGGRIFLYD 462

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 17/76 (22%), Positives = 34/76 (44%), Gaps = 13/76 (17%)

Query: 278 KPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVM 337
           K +H   GH +  T+++  P+   + +S G+D +  LWD+                 E++
Sbjct: 160 KMIHSYRGHHNGTTTIKMLPKSGHLFLSGGNDNKVKLWDVYH-------------KRELL 206

Query: 338 MIHAGHRSSINDFSMN 353
             + GH  ++ D S +
Sbjct: 207 RDYCGHSKAVRDVSFS 222

>Suva_6.187 Chr6 complement(344709..346853) [2145 bp, 714 aa] {ON}
           YJL112W (REAL)
          Length = 714

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/178 (26%), Positives = 77/178 (43%), Gaps = 36/178 (20%)

Query: 142 VESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDV-TGKSQEPI-LTFTDRH 199
           ++S  + TF+ H +    LS + +    L+SGS D  I  WD+ +GK  + I L+F +  
Sbjct: 490 IDSPCVYTFESHIDEITALSLDSDF---LVSGSQDRTIRQWDLRSGKCMQAIDLSFANVS 546

Query: 200 SDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLF 259
           S   N              +S+ + L    +R    A++   A                 
Sbjct: 547 STATN------------VDLSKSTLLTQRSERPSIGALQSFDAA---------------L 579

Query: 260 AAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
           A    D +V L+D R + K +  + GH DA+TSL+F   +   L++   DR   +WDL
Sbjct: 580 ATGTKDGVVRLWDLR-SGKVIRTLEGHTDAITSLKF---DSACLVTGSYDRTVRVWDL 633

>KAFR0H02450 Chr8 complement(468767..470020) [1254 bp, 417 aa] {ON}
           Anc_8.672 YPL151C
          Length = 417

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 57/221 (25%), Positives = 97/221 (43%), Gaps = 37/221 (16%)

Query: 160 LSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGS 218
           ++ +P +     +GS+DS I +WD  +GK +   LT +  H   V D         +F S
Sbjct: 114 IAMDPVDNEWFATGSNDSTIKVWDFASGKLK---LTLSG-HVMGVRDLVVSKRHPYMF-S 168

Query: 219 VSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTN------LFAAAGTDSMVYLYD 272
            SED  ++  D       +EK    + Y       H+ +      L A+AG DS+V L+D
Sbjct: 169 ASEDKLVKCWD-------LEKNAPIRDYFGHLSGVHTVDIHPTLSLIASAGRDSVVKLWD 221

Query: 273 RRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDG 332
             R+ K +  + GH+  + S++  P  D  +IS  +D   I WDL               
Sbjct: 222 -IRSKKAVITLVGHKSPINSVKCTPA-DPQIISCSNDTTVITWDLVA------------A 267

Query: 333 SPEVMMIHAGHRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
            P  ++ H  HR ++ D +++P     +  +   N ++ WK
Sbjct: 268 KPMKVITH--HRKAVRDIAVHPGE--FSVASCSTNDIRSWK 304

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 68/154 (44%), Gaps = 16/154 (10%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFD----QNIFGSVSEDSTL 225
           + S S+D  +  WD+  +   PI  +    S +      H  D     ++  S   DS +
Sbjct: 166 MFSASEDKLVKCWDL--EKNAPIRDYFGHLSGV------HTVDIHPTLSLIASAGRDSVV 217

Query: 226 QLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPG 285
           +L D R + A +  V  K P N++  +     + + +  D+ V  +D   A+KP+ ++  
Sbjct: 218 KLWDIRSKKAVITLVGHKSPINSVKCTPADPQIISCS-NDTTVITWDLV-AAKPMKVITH 275

Query: 286 HEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
           H  AV  +  HP E  V   + +D R+  W L E
Sbjct: 276 HRKAVRDIAVHPGEFSVASCSTNDIRS--WKLPE 307

>KLTH0F19338g Chr6 (1564555..1568427) [3873 bp, 1290 aa] {ON}
           similar to uniprot|Q92271 Saccharomyces cerevisiae
           YOL138C Hypothetical ORF
          Length = 1290

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/198 (24%), Positives = 78/198 (39%), Gaps = 33/198 (16%)

Query: 124 IATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWD 183
           I   S   +IY  NRAN V+         H  +   + FN  +   L+SGS D  I +WD
Sbjct: 183 ICGTSTSVSIYDINRANLVDGPASMVLSKHTRSINSVDFNMAQTSLLISGSQDGCIKVWD 242

Query: 184 V---TGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKV 240
           +    G+  +  LT  +  SD V D KW                +  +D    D  V   
Sbjct: 243 LRSSQGRKNKSDLTI-NSGSDSVRDVKW----------------MPTYDFPNNDDVV--- 282

Query: 241 QAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQED 300
                    A  ++ ++ FA+     ++  YD R+ S+    +  H      L +HP  D
Sbjct: 283 ---------AGPSNRSHRFASIHDSGLLLTYDLRQPSQAEKRINAHSGPGLCLSWHPTLD 333

Query: 301 GVLISAGSDRRTILWDLA 318
             +++ G D +  LW++ 
Sbjct: 334 -YIMTGGRDGKCCLWNMG 350

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 4/65 (6%)

Query: 257 NLFAAAGTDSMVYLYDRRRAS---KPLHM-MPGHEDAVTSLEFHPQEDGVLISAGSDRRT 312
           N  A  GT + V +YD  RA+    P  M +  H  ++ S++F+  +  +LIS   D   
Sbjct: 179 NYVAICGTSTSVSIYDINRANLVDGPASMVLSKHTRSINSVDFNMAQTSLLISGSQDGCI 238

Query: 313 ILWDL 317
            +WDL
Sbjct: 239 KVWDL 243

>KAFR0F04350 Chr6 (853842..855389) [1548 bp, 515 aa] {ON} Anc_6.340
           YCR072C
          Length = 515

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 73/315 (23%), Positives = 121/315 (38%), Gaps = 77/315 (24%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESG--LLSTFQFHNENGYGLSFNP 164
           H+N V    + P D  +IAT S   TI L+    E + G  L    + H +    LS+ P
Sbjct: 185 HQNWVLCVSWSP-DGEIIATGSMDNTIRLW----ESDRGKPLGEPLRGHLKWITSLSWEP 239

Query: 165 ------NEKGKLLSGSDDSNIVLWDVTGKSQEPILTFT-DRHSDIVNDCKWHNFDQNIFG 217
                  EK +L S S D  I +WD   +    +  +T   H++ V+  KW    Q +  
Sbjct: 240 LHLVKAGEKPRLASASKDGTIKIWDTVRR----VCVYTLSGHTNSVSCVKWGG--QGVLY 293

Query: 218 SVSEDSTLQLHDQRIRDAAVE--------------------------------------K 239
           S S D T+++ D  +    +                                       +
Sbjct: 294 SGSHDKTVRVWDMNLGGKCINILKNHAHWVNHLSLSTDYALRRGPFDHTGTKMASPEEAR 353

Query: 240 VQAKKPYNTLAFSAHSTN-LFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQ 298
            +A K Y  +     +T  L   A  D  ++L++  +++KPL  M GH+  V  + F P 
Sbjct: 354 EKALKNYEKVVKKNGTTEELMVTASDDFTMFLWNPLKSNKPLARMTGHQKLVNHVAFSP- 412

Query: 299 EDG-VLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIP 357
            DG  ++SA  D    LW            D  DG  + +    GH SS+   + + +  
Sbjct: 413 -DGRYIVSASFDNSIKLW------------DGRDG--KFLSTFRGHVSSVYQVAWSSDCR 457

Query: 358 WLTATAEEENIVQVW 372
            L  +  ++  ++VW
Sbjct: 458 -LLVSCSKDTTLKVW 471

 Score = 44.7 bits (104), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/178 (23%), Positives = 81/178 (45%), Gaps = 16/178 (8%)

Query: 148 STFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCK 207
           S    H       +F P+   ++++G+ D+   +WD    +Q P+ T T  H + V    
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDC--DTQTPMTTLTG-HQNWVLCVS 193

Query: 208 WHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAK-KPYNTLAF------SAHSTNLFA 260
           W + D  I  + S D+T++L +        E ++   K   +L++       A      A
Sbjct: 194 W-SPDGEIIATGSMDNTIRLWESDRGKPLGEPLRGHLKWITSLSWEPLHLVKAGEKPRLA 252

Query: 261 AAGTDSMVYLYDR-RRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
           +A  D  + ++D  RR    ++ + GH ++V+ +++  Q  GVL S   D+   +WD+
Sbjct: 253 SASKDGTIKIWDTVRRVC--VYTLSGHTNSVSCVKWGGQ--GVLYSGSHDKTVRVWDM 306

>TBLA0B05920 Chr2 complement(1390257..1391468) [1212 bp, 403 aa]
           {ON} Anc_2.283 YNL035C
          Length = 403

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/177 (25%), Positives = 82/177 (46%), Gaps = 16/177 (9%)

Query: 156 NGYGLSFNPNEKGKLLSGSDDSNIVLWD-VTGKSQEPILTFTDRHSD--IVNDCKWHNFD 212
           N + L F P     LL+   +  I + D  T + ++ I       +D  IVN+    N++
Sbjct: 14  NNWCLKFKPLYNYGLLTSLSNGEISILDWKTNQIKDKIKIGETSINDFEIVNN----NYN 69

Query: 213 QNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKK-PYNTLAFSAHSTNLFAA----AGTDSM 267
                  + + +++++D +  D        K  P+ +L  S H  N+ A     +G D+ 
Sbjct: 70  GGSLMVTATNESVKIYDLKSNDCIKTITNEKNSPFLSLD-SLH--NMMACGTELSGVDAE 126

Query: 268 VYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAE 323
           +Y+YD R    P+   +  H D +T ++FHP +  VL+S  +D  T ++DL E   E
Sbjct: 127 LYIYDIRSWDTPIRSFVDSHHDDITDIKFHPNDSKVLMSGSTDGYTNIYDLTETEEE 183

>KNAG0D00740 Chr4 complement(115399..116913) [1515 bp, 504 aa] {ON}
           Anc_6.276 YPL247C
          Length = 504

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 40/162 (24%), Positives = 69/162 (42%), Gaps = 16/162 (9%)

Query: 170 LLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD 229
           L+S S D+  ++WD+  +S   + T    H   V D ++ +   ++F S   D ++++ D
Sbjct: 262 LVSSSIDTTCIVWDL--QSPNYVKTQLIAHDSEVYDVRFLSQSTHLFASCGGDGSVRVFD 319

Query: 230 QR------------IRDAAVEKVQAKK-PYNTLAFSAHSTNLFAAAGTDSM-VYLYDRRR 275
            R              +  V  V A+      L  S    N+ A    DS  + + D R 
Sbjct: 320 LRSLAHSTIVYEPPAGEGTVNDVTAQNNALLRLEPSLMDPNIIATLVADSKDILILDMRN 379

Query: 276 ASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
              P   + GH   V  +++HP +  VL+S   D + + WDL
Sbjct: 380 PESPALTLKGHSSLVNQIKWHPTKRNVLLSCSDDCQVLYWDL 421

>Ecym_2139 Chr2 complement(262217..263524) [1308 bp, 435 aa] {ON}
           similar to Ashbya gossypii AFL157C
          Length = 435

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 68/322 (21%), Positives = 121/322 (37%), Gaps = 72/322 (22%)

Query: 111 VTRARYMPQDDNLIATISGVGTIYLYNRANEVESGL-LSTFQFHN-----ENGYGLS--- 161
           V+R ++MP     +AT S   ++ +++  ++++  + LS  ++        NG+ L    
Sbjct: 110 VSRIQWMPMSSEKLATCSD--SLRIWSLGDQLKEQVNLSLVKYGKGVGDVANGHTLGKLP 167

Query: 162 ------FNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNI 215
                 +N  +   +LS S D+   +WD+  ++   + T    H   V D K+     N+
Sbjct: 168 PVTSFDWNSIDTNIILSSSIDTTCTVWDL--QASNYVKTQLIAHDSEVFDAKFLTQSSNL 225

Query: 216 FGSVSEDSTLQLHDQRIR-----------------------------DAAVEKVQAKKPY 246
           F S   D ++++ D R                               D    K       
Sbjct: 226 FASCGGDGSVRVFDLRCLAHSTIIYEPQSQIQTHTPSQIQLSAQGHDDGHARKNNQNAAE 285

Query: 247 NTLAFSAHST-------------NLFAAAGTDS-MVYLYDRRRASKPLHMMPGHEDAVTS 292
            +LA S+  +             N+ A    DS +V + D R    P+  + GH  A+  
Sbjct: 286 TSLAVSSLESQALLRLEPSPFDPNILATIQQDSNVVIILDMRYPGSPILTLNGHYCALNQ 345

Query: 293 LEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSM 352
           L +HP +  VL + G D + + WDL          D+ +G      I     +S N    
Sbjct: 346 LRWHPSKPNVLATCGDDCQILYWDLL---------DSLNGGTISSGIPQQRWTSTNTVHF 396

Query: 353 NPNIPWLTATAEEENIVQVWKP 374
               P ++ TA+ E    VW+P
Sbjct: 397 -LETPQMSYTAQNEVNNMVWRP 417

>Kpol_1024.42 s1024 complement(112044..114575) [2532 bp, 843 aa]
           {ON} complement(112044..114575) [2532 nt, 844 aa]
          Length = 843

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 58/257 (22%), Positives = 99/257 (38%), Gaps = 50/257 (19%)

Query: 147 LSTFQFHNENGYGLSFNPNEKGKLLS-GSDDSNIVLWDVTGKSQEPILTFTDRHSDIVN- 204
           +  + FHN N   LS + ++  +L + G  DS I +W + G S + + +  + H    N 
Sbjct: 479 VCMYTFHNTNREMLSLDFSDDCRLAAAGFQDSYIKIWSLDGSSLDTLTSTNNTHFTKKNT 538

Query: 205 -DCKWHNF---------------------------DQNIFGSVSEDSTLQLHDQRIRDAA 236
            D   H+                            D  +  S SED T++L     +   
Sbjct: 539 ADNNLHSKKKHQEHVNTNTKLVGHSGAVYSTSFSPDNKLLISGSEDKTVRLWAMDTQSTL 598

Query: 237 VEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFH 296
           V       P   +AFS    + FA A  D    L+        L +  GH   V  + FH
Sbjct: 599 VSYKGHNHPVWDVAFSPMG-HYFATASHDQTARLWSCDHIY-SLRIFAGHLSDVDCVTFH 656

Query: 297 PQEDGVLISAGSDRRTI-LWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPN 355
           P  +G  +  GS  +T  +WD++              + E + +  GH + +    ++P+
Sbjct: 657 P--NGCYVFTGSSDKTCRMWDVS--------------TGETVRLFLGHTAPVVSLGVSPD 700

Query: 356 IPWLTATAEEENIVQVW 372
             WL A+  E+ ++ VW
Sbjct: 701 GRWL-ASGSEDGLINVW 716

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 60/231 (25%), Positives = 104/231 (45%), Gaps = 18/231 (7%)

Query: 89  KEEEEVLKSNVKIIKKFEHENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLS 148
           K+ +E + +N K++    H   V    + P D+ L+ + S   T+ L+  A + +S L+S
Sbjct: 547 KKHQEHVNTNTKLVG---HSGAVYSTSFSP-DNKLLISGSEDKTVRLW--AMDTQSTLVS 600

Query: 149 TFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDC-K 207
            ++ HN   + ++F+P       + S D    LW         +  F    SD+  DC  
Sbjct: 601 -YKGHNHPVWDVAFSPMGH-YFATASHDQTARLWSC--DHIYSLRIFAGHLSDV--DCVT 654

Query: 208 WHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSM 267
           +H     +F + S D T ++ D    +     +    P  +L  S     L A+   D +
Sbjct: 655 FHPNGCYVF-TGSSDKTCRMWDVSTGETVRLFLGHTAPVVSLGVSPDGRWL-ASGSEDGL 712

Query: 268 VYLYDRRRASKPLHMMPGH-EDAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
           + ++D   + K L  M GH  +AV S+ F  QE  V+IS G+D    +WD+
Sbjct: 713 INVWDIG-SGKRLKQMRGHGRNAVNSIVF-SQEGTVIISGGTDNSVRVWDM 761

>Ecym_7403 Chr7 (829923..831476) [1554 bp, 517 aa] {ON} similar to
           Ashbya gossypii ABL044C
          Length = 517

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/178 (24%), Positives = 75/178 (42%), Gaps = 20/178 (11%)

Query: 100 KIIKKFEHENEVTRARYMPQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYG 159
           ++IK F    +V  +    QD  L+      G + +Y+  N      L TFQ  +   + 
Sbjct: 72  QVIKTFSRFKDVVYSASFRQDGKLLVAGDATGLVSIYDSYNPRNQ--LVTFQASSHPTHV 129

Query: 160 LSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSV 219
             F+P +   L + +DD  + LWD++  + +PIL  T   SD V    +     ++  S 
Sbjct: 130 TKFHPMDSKSLTTANDDRVVRLWDIS-HAYQPILELTG-ASDYVRSICFLPGTPHMVVSG 187

Query: 220 SEDSTLQLHDQRIRDAAVEKVQAKKPYNTL--------AFSAHSTNLFAAAGTDSMVY 269
           S D  ++L+D R+        ++ +P  TL          S   T L +  G+   V+
Sbjct: 188 SYDGVIRLYDTRM--------ESSQPVTTLNHGMPIEDTISMSQTQLISCGGSKFKVW 237

 Score = 31.2 bits (69), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 22/104 (21%), Positives = 39/104 (37%), Gaps = 7/104 (6%)

Query: 218 SVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSA---HSTNLFAAAGTDSMVYLYDRR 274
           +V+  + +Q+   R R      ++    +  + +SA       L  A     +V +YD  
Sbjct: 56  AVTSSTRVQVFSSRTRQV----IKTFSRFKDVVYSASFRQDGKLLVAGDATGLVSIYDSY 111

Query: 275 RASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLA 318
                L             +FHP +   L +A  DR   LWD++
Sbjct: 112 NPRNQLVTFQASSHPTHVTKFHPMDSKSLTTANDDRVVRLWDIS 155

>ZYRO0F09922g Chr6 complement(805666..807033) [1368 bp, 455 aa] {ON}
           similar to uniprot|P40968 Saccharomyces cerevisiae
           YDR364C CDC40 Pre-mRNA splicing factor important for
           catalytic step II of pre-mRNA splicing and plays a role
           in cell cycle progression required for DNA synthesis
           during mitosis and meiosis has WD repeats
          Length = 455

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 56/223 (25%), Positives = 90/223 (40%), Gaps = 25/223 (11%)

Query: 147 LSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDC 206
           + +F  H      L F P      LSG +D+ + +WD     +   L     HS  +   
Sbjct: 155 IHSFTGHTRGTSALQFLPKTGHLFLSGGNDNILKIWDFY--HERICLRDYIGHSKPIKTV 212

Query: 207 KWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNT----LAFSAHSTNLFAAA 262
            + N D N F S S D  ++L      D    +V+++  YN     L +     N F   
Sbjct: 213 NF-NEDGNSFLSASFDQNVKL-----WDTETGQVKSRYRYNATPNDLKYRPGHLNEFVVG 266

Query: 263 GTDSMVYLYDRRRASKP--LHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWD-LAE 319
            ++S +  YD R A+    + +   H  ++ SLEF P +   LIS+  D+   +W+    
Sbjct: 267 LSNSKINHYDDRVAANQGLVQVYDHHLSSILSLEFFP-DGSKLISSSEDKTVRIWENQVN 325

Query: 320 IGAEQVPDDADDGSPEVMMIHAGHR--------SSINDFSMNP 354
           I  +Q+ D A    P  + +H  H         + I  F M P
Sbjct: 326 IPIKQISDTAQHSMP-FLRVHPEHHYFCAQSMDNVIYSFGMKP 367

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 5/53 (9%)

Query: 265 DSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDL 317
           D   YL  RR     +H   GH    ++L+F P+   + +S G+D    +WD 
Sbjct: 145 DFKCYLPKRR-----IHSFTGHTRGTSALQFLPKTGHLFLSGGNDNILKIWDF 192

>Smik_12.52 Chr12 (114649..116118) [1470 bp, 489 aa] {ON} YLL011W
           (REAL)
          Length = 489

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/190 (24%), Positives = 83/190 (43%), Gaps = 31/190 (16%)

Query: 153 HNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDC----KW 208
           H +  Y ++ N     KL +GS D  I  W+++  ++E  ++F   +  I   C    ++
Sbjct: 66  HRDGVYAIAKNYGSLNKLATGSADGVIKYWNMS--TREEFVSFKAHYGLITGLCVTQPRF 123

Query: 209 HNF-----DQNIFGSVSEDSTLQLHDQRIRD----------------AAVEKVQAKKPYN 247
           H+      +QN   S S+D T++L    + D                  V     +  + 
Sbjct: 124 HDKKPDLKNQNFMLSCSDDKTVKLWSINVDDFSNKSSSDNDSVTNEEGLVRTFDGESAFQ 183

Query: 248 TLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAG 307
            +  S    + FA  G  + ++L+D  R  KP+  +    D +TS++F+  E  +L S G
Sbjct: 184 GID-SHRENSTFATGG--AKIHLWDVNRL-KPVSNLSWGADNITSVKFNQSETDILASTG 239

Query: 308 SDRRTILWDL 317
           SD   +L+DL
Sbjct: 240 SDNSIVLYDL 249

 Score = 46.6 bits (109), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 71/164 (43%), Gaps = 8/164 (4%)

Query: 143 ESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDI 202
           E GL+ TF    E+ +    +  E     +G   + I LWDV        L++    +D 
Sbjct: 169 EEGLVRTFD--GESAFQGIDSHRENSTFATGG--AKIHLWDVNRLKPVSNLSWG---ADN 221

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           +   K++  + +I  S   D+++ L+D R      + VQ  +  N + ++      F  A
Sbjct: 222 ITSVKFNQSETDILASTGSDNSIVLYDLRTNSPTQKIVQTMRT-NAICWNPMEAFNFVTA 280

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISA 306
             D   Y YD R  S+ L++   H  AV  ++F P  D ++  +
Sbjct: 281 NEDHNAYYYDMRNLSRSLNVFKDHVSAVMDVDFSPTGDEIVTGS 324

>Ecym_3321 Chr3 complement(615730..616959) [1230 bp, 409 aa] {ON}
           similar to Ashbya gossypii ADL218C
          Length = 409

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 6/110 (5%)

Query: 214 NIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAA---AGTDSMVYL 270
           N F + SEDS +++ D R+ +  V  VQ  K    ++  +    L      +GTD+ ++L
Sbjct: 72  NTFVTASEDS-VKIFDLRL-NQCVATVQNAKNSPFISLDSRHGMLACGTELSGTDAEIHL 129

Query: 271 YDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
           YD ++   P+      H D +T ++FH  +  VL+S  +D    ++DL +
Sbjct: 130 YDLKKIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNVYDLKQ 179

 Score = 34.7 bits (78), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 4/75 (5%)

Query: 168 GKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQL 227
           G  LSG+D + I L+D+  K   P+ +F D H D + D K+H  D ++  S S D  + +
Sbjct: 117 GTELSGTD-AEIHLYDLK-KIDAPMRSFCDSHHDDITDIKFHASDPSVLLSGSTDGYVNV 174

Query: 228 HD--QRIRDAAVEKV 240
           +D  Q+  + A+ +V
Sbjct: 175 YDLKQQEEEEALHQV 189

>NCAS0B01440 Chr2 (236104..237390) [1287 bp, 428 aa] {ON} 
          Length = 428

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 52/236 (22%), Positives = 100/236 (42%), Gaps = 38/236 (16%)

Query: 175 DDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRD 234
           +DS + + D  GK  E + T     + + +  ++  FD ++F S S+D+ L+  D R  D
Sbjct: 189 EDSILKIIDNAGKPSEILRTIHVPGTTVTHSVRF--FDNHMFASCSDDNVLRFWDTRTND 246

Query: 235 AAVEKVQAKKPYNTLAFSAH--STNLFAAAGTDSMVYLYD-------------RRRASKP 279
             +  +   +     +F A   S++LF    +  ++ L+D             R+   +P
Sbjct: 247 KPLWVLADPQNGRLTSFDASSVSSDLFVTGFSTGLIKLWDARAVEAATLDFTNRQNGEEP 306

Query: 280 LH-----MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWD----LAEIGAE---QVPD 327
           +            D+V  ++F P     +++ G       WD    L+   A+   +VP 
Sbjct: 307 IQKEIANFYHSGGDSVVDVQFSPTSPTEVLTVGGSGNVYHWDMEYALSNYDADDKNRVPQ 366

Query: 328 DADDG--SPEVMMIHAG-------HRSSINDFSMNPNIPWLTATAEEENIVQVWKP 374
           DA +   +  +  +H G        R   N  + +P I  L AT +++++V V+KP
Sbjct: 367 DACEKLQTESLKFLHTGGSRRSSKQRGKRNTVAWHPVIDELVATVDDDSLVSVYKP 422

>TPHA0G03100 Chr7 complement(659503..661032) [1530 bp, 509 aa] {ON}
           Anc_2.469 YMR093W
          Length = 509

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 65/257 (25%), Positives = 109/257 (42%), Gaps = 22/257 (8%)

Query: 64  SDEEQNYLKIAAIYLPDEVVPDAEPKEEEEVLKSNVKIIKKFEHENEVTRARYMPQDDNL 123
           S + Q  +   A  LP +  P+     +     S+ +++K  EH N VT   + PQ  + 
Sbjct: 2   SSQRQRIITSKAPLLPQQTTPEQRYWRQY----SSTQLVK--EH-NSVTHIAFNPQHTHD 54

Query: 124 IATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIV-LW 182
            A  S        +R  +V    + TF    +  Y  SF  +  GKLL   D + +V ++
Sbjct: 55  FAVTSSTRVQIFSSRTRQV----VKTFSRFKDVVYSASFRND--GKLLVAGDATGLVSVF 108

Query: 183 DVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHD-QRIRDAAVEKVQ 241
           D    +   +L   +  +  V+  K+H+ D     + S+D   +L D     + ++E   
Sbjct: 109 D--SYNPRTLLLSINVSTHPVHVTKFHSQDSKTLVTASDDRVTRLWDISYAYEPSLELTG 166

Query: 242 AKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRA-SKPLHMMPGHEDAVTSLEFHPQED 300
           A     TL F   + +L A    D +V LYD R + S+P+  +   +     L   P + 
Sbjct: 167 ASDYVRTLTFIPSAPHLVATGSYDGIVRLYDTRNSGSEPVFSLNHEQPLENILAISPTQ- 225

Query: 301 GVLISAGSDRRTILWDL 317
             LISAG +   + WDL
Sbjct: 226 --LISAGGNNFKV-WDL 239

>Smik_16.442 Chr16 (754983..756395) [1413 bp, 470 aa] {ON} YPR178W
           (REAL)
          Length = 470

 Score = 47.8 bits (112), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 53/207 (25%), Positives = 89/207 (42%), Gaps = 11/207 (5%)

Query: 107 HENEVTRARYMPQDDNLIATISGVGTIYLYNRAN-EVESGLLSTFQFHNENGYGLSFNPN 165
           H  ++    + P  +N + + +  G I  +   N E E  LL  F  H      + ++P+
Sbjct: 222 HVGKIGAVEWHPSSNNQMVSCAEDGLIKNFQYLNKEGELRLLGDFVGHERRVSDVKYHPS 281

Query: 166 EKGKLL-SGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDST 224
             GK + S S D    LWD +   +   L   + HS  V    +   D ++  S   DS 
Sbjct: 282 --GKFIGSASHDMTWRLWDASTHQE---LLLQEGHSKGVFSLSFQ-CDGSLVCSGGMDSL 335

Query: 225 LQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYD-RRRASKPLHMM 283
             L D R     +      KP  T+A+S +   + A  G D ++ ++D R+R    L+ +
Sbjct: 336 TMLWDIRSGSKVMTLAGHSKPVYTVAWSPNGYQV-ATGGGDGLINVWDIRQRDEGQLNQI 394

Query: 284 PGHEDAVTSLEFHPQEDG-VLISAGSD 309
             H + VT ++F   + G  L+S G D
Sbjct: 395 LAHRNIVTQVKFSNDDGGKKLVSCGYD 421

 Score = 42.0 bits (97), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/194 (21%), Positives = 79/194 (40%), Gaps = 24/194 (12%)

Query: 184 VTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAV----EK 239
           ++ ++ +P+    D H   +   +WH    N   S +ED  ++      ++  +    + 
Sbjct: 207 LSSQTLQPLSQKLDSHVGKIGAVEWHPSSNNQMVSCAEDGLIKNFQYLNKEGELRLLGDF 266

Query: 240 VQAKKPYNTLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQE 299
           V  ++  + + +  H +  F  + +  M +        + L +  GH   V SL F  Q 
Sbjct: 267 VGHERRVSDVKY--HPSGKFIGSASHDMTWRLWDASTHQELLLQEGHSKGVFSLSF--QC 322

Query: 300 DGVLI-SAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSINDFSMNPNIPW 358
           DG L+ S G D  T+LWD+               S   +M  AGH   +   + +PN  +
Sbjct: 323 DGSLVCSGGMDSLTMLWDIR--------------SGSKVMTLAGHSKPVYTVAWSPN-GY 367

Query: 359 LTATAEEENIVQVW 372
             AT   + ++ VW
Sbjct: 368 QVATGGGDGLINVW 381

>KNAG0I02540 Chr9 (489509..492265) [2757 bp, 918 aa] {ON} Anc_6.325
           YCR057C
          Length = 918

 Score = 48.1 bits (113), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/166 (25%), Positives = 80/166 (48%), Gaps = 8/166 (4%)

Query: 151 QFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHN 210
           Q H ++   L+++P +  ++++ ++D  I +WDV        L   D H+  V   ++  
Sbjct: 338 QGHFDSTNSLTYSP-DGSRVVTAAEDGKIKVWDVVSGF---CLATLDEHTAAVTQVQFAK 393

Query: 211 FDQNIFGSVSEDSTLQLHDQ-RIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAAGTDSMVY 269
             Q +F S S D T++  D  R R+  V     +  +N+LA       + A +  +  ++
Sbjct: 394 KGQVLF-SASLDGTVKAWDLIRYRNFRVFTAAERIQFNSLAVDPSGEVVCAGSMDNFDIH 452

Query: 270 LYDRRRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILW 315
           ++  +   + L  + GHE  V+ L F  QE+GVL SA  D+   +W
Sbjct: 453 VWSVQ-TGQLLDSLSGHEGPVSCLAF-SQENGVLASASWDKTIRIW 496

>Kwal_26.7570 s26 (423448..424104) [657 bp, 218 aa] {ON} YMR116C
           (ASC1) - G-beta like protein [contig 54] FULL
          Length = 218

 Score = 46.2 bits (108), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 77/173 (44%), Gaps = 13/173 (7%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +P +   LLSGS D +++ W +TG  Q+   P+ +F   HS I
Sbjct: 9   LRGTLEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTGDDQQYGVPVRSFRG-HSHI 67

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V DC     D     S S D T++L +          V  K    ++     ++ + +A+
Sbjct: 68  VQDCT-VTPDGEYALSASWDKTVRLWELATGKCIQRFVGHKSDVLSVTIDRRASQIVSAS 126

Query: 263 GTDSMVYLYDRRRASKPLHMMPGHEDAVTSLEFHPQED-----GVLISAGSDR 310
             D  V +++     + +  + GH D V+ +   P E        +ISAG D+
Sbjct: 127 -RDKTVKVWN--TLGECMVTLLGHNDWVSQVRVAPNESPEDETVTVISAGMDK 176

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 40/91 (43%), Gaps = 10/91 (10%)

Query: 283 MPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAG 342
           + GH   VTSL   P +  +L+S   D+  I W L         DD   G P  +    G
Sbjct: 13  LEGHNGWVTSLATSPAQPNLLLSGSRDKSLITWKLTG-------DDQQYGVP--VRSFRG 63

Query: 343 HRSSINDFSMNPNIPWLTATAEEENIVQVWK 373
           H   + D ++ P+  +   +A  +  V++W+
Sbjct: 64  HSHIVQDCTVTPDGEY-ALSASWDKTVRLWE 93

>Skud_3.145 Chr3 complement(225459..227006) [1548 bp, 515 aa] {ON}
           YCR072C (REAL)
          Length = 515

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 62/263 (23%), Positives = 108/263 (41%), Gaps = 44/263 (16%)

Query: 118 PQDDNLIATISGVGTIYLYNRANEVESGLLSTFQFHNENGYGLSFNPNEKGKLLSGSDDS 177
           P     +A+ S  GTI +++  N V    LS    H  +   + +    +G L SGS D 
Sbjct: 245 PGSKPRLASSSKDGTIKIWDSVNRVCQYTLSG---HTNSVSCVKWG--GQGLLYSGSHDR 299

Query: 178 NIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQNIFGSVSEDSTLQL----HDQRIR 233
            + +WD+   SQ   +     H+  VN             S+S D  L++    H  + +
Sbjct: 300 TVRVWDM--NSQGRCINILKSHAHWVNHL-----------SLSTDYALRVGAFDHTGK-K 345

Query: 234 DAAVEKVQAKKPYN---TLAFSAHSTNLFAAAGTDSMVYLYDRRRASKPLHMMPGHEDAV 290
            A  E+ Q K   N       +  S  +   A  D  ++L++  +++KP+  M GH+  V
Sbjct: 346 PATSEEAQKKALENYEKICKKNGSSEEMMVTASDDFTMFLWNPLKSTKPIARMTGHQKLV 405

Query: 291 TSLEFHPQEDG-VLISAGSDRRTILWDLAEIGAEQVPDDADDGSPEVMMIHAGHRSSIND 349
             + F P  DG  ++SA  D    LW            D  DG  + +    GH +S+  
Sbjct: 406 NHVAFSP--DGRYIVSASFDNSIKLW------------DGRDG--KFISTFRGHVASVYQ 449

Query: 350 FSMNPNIPWLTATAEEENIVQVW 372
            + + +   L  +  ++  ++VW
Sbjct: 450 VAWSSDCR-LLVSCSKDTTLKVW 471

 Score = 40.4 bits (93), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 37/182 (20%), Positives = 79/182 (43%), Gaps = 16/182 (8%)

Query: 148 STFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCK 207
           S    H       +F P+   ++++G+ D+   +WD    +Q P+ T    H + V    
Sbjct: 137 SAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDC--DTQTPMHTLKG-HFNWVLCVS 193

Query: 208 WHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTL-------AFSAHSTNLFA 260
           W + D  +  + S D+T++L + +  +   + ++    + T             S    A
Sbjct: 194 W-SPDGEVIATGSMDNTIRLWNPKTGECLGDALRGHSKWITCLSWEPIHLVKPGSKPRLA 252

Query: 261 AAGTDSMVYLYDR-RRASKPLHMMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
           ++  D  + ++D   R  +  + + GH ++V+ +++  Q  G+L S   DR   +WD+  
Sbjct: 253 SSSKDGTIKIWDSVNRVCQ--YTLSGHTNSVSCVKWGGQ--GLLYSGSHDRTVRVWDMNS 308

Query: 320 IG 321
            G
Sbjct: 309 QG 310

>Kwal_27.11550 s27 (845458..846681) [1224 bp, 407 aa] {ON} YNL035C -
           Hypothetical ORF [contig 27] FULL
          Length = 407

 Score = 47.4 bits (111), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 82/173 (47%), Gaps = 16/173 (9%)

Query: 156 NGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQEPILTFTDRHSDIVNDCKWHNFDQN- 214
           + + L   P     LL+   + ++ L D     Q   ++    H   ++D    N D+N 
Sbjct: 14  DNWCLKLQPLYNRGLLASLSNGSVQLIDWVKNKQ---ISQIQAHGTTISDMVVLNNDRNN 70

Query: 215 --IFGSVSEDSTLQLHDQRIRD-AAVEKVQAKKPYNTL----AFSAHSTNLFAAAGTDSM 267
             +  + +EDS +++ D R  D  A  K +   P+ +L       A  T L   +G D+ 
Sbjct: 71  GFLIATAAEDS-VKIFDLRSSDTVATLKNEKSAPFLSLDSRHGMLACGTEL---SGVDAE 126

Query: 268 VYLYDRRRASKPLH-MMPGHEDAVTSLEFHPQEDGVLISAGSDRRTILWDLAE 319
           +++YD +   +PL  ++  H D +T+++FHP +  VL+S  +D    ++DL +
Sbjct: 127 LHIYDMKAWHQPLRSLVDSHHDDITNIKFHPTDPNVLLSGSTDGYVNIYDLTQ 179

>TPHA0G02840 Chr7 (604491..605033) [543 bp, 180 aa] {ON} Anc_2.431
           YMR116C
          Length = 180

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 78/182 (42%), Gaps = 31/182 (17%)

Query: 146 LLSTFQFHNENGYGLSFNPNEKGKLLSGSDDSNIVLWDVTGKSQE---PILTFTDRHSDI 202
           L  T + HN     L+ +  +   L+S S D  ++ W +TG  Q+   P+ +F   H+ I
Sbjct: 8   LRGTLEGHNGWVTSLATSAGQPNLLVSASRDKTLISWKLTGDDQQYGVPVRSFKG-HNHI 66

Query: 203 VNDCKWHNFDQNIFGSVSEDSTLQLHDQRIRDAAVEKVQAKKPYNTLAFSAHSTNLFAAA 262
           V DC     D     S S D TL+L +          V   + Y    F+ H +++ + A
Sbjct: 67  VQDCA-LTADGAYALSASWDKTLRLWN----------VATGETYQR--FTGHKSDVMSVA 113

Query: 263 --GTDSMVYLYDRRRASK-------PLHMMPGHEDAVTSLEFHP---QEDG--VLISAGS 308
                SM+    R +  K        L  + GH D V+ +   P   QED    LISAGS
Sbjct: 114 IDRKASMIISGSRDKTIKVWSIKGDCLATLLGHNDWVSQVRVAPNEKQEDDNVTLISAGS 173

Query: 309 DR 310
           D+
Sbjct: 174 DK 175

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.131    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,570,520
Number of extensions: 2163484
Number of successful extensions: 9543
Number of sequences better than 10.0: 961
Number of HSP's gapped: 8408
Number of HSP's successfully gapped: 1491
Length of query: 393
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 281
Effective length of database: 40,638,807
Effective search space: 11419504767
Effective search space used: 11419504767
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 67 (30.4 bits)