Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F00440g6.7ON1039103947780.0
NCAS0F001806.7ON101871418180.0
TDEL0G046406.7ON101769717990.0
Kpol_1045.806.7ON101969217410.0
Skud_5.346.7ON101971117200.0
Smik_5.326.7ON102071017140.0
YEL055C (POL5)6.7ON102271117060.0
Suva_5.136.7ON102371117060.0
NDAI0K029106.7ON106373517000.0
KAFR0L003306.7ON102872616210.0
KNAG0E009706.7ON100472314930.0
SAKL0E00770g6.7ON104772814211e-179
CAGL0B03553g6.7ON102170113901e-175
Ecym_30096.7ON102773413071e-162
ACR020C6.7ON100272612991e-161
KLLA0D00792g6.7ON102071812891e-160
TPHA0J002506.7ON102471612851e-159
KLTH0C11594g6.7ON100672811701e-143
Kwal_56.223346.7ON100872211601e-141
TBLA0A072106.7ON104172811071e-133
Kwal_55.207668.155ON2680125744.6
NCAS0E028907.344ON315121718.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F00440g
         (1039 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar...  1845   0.0  
NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7 ...   704   0.0  
TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {...   697   0.0  
Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]...   675   0.0  
Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON} ...   667   0.0  
Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON} ...   664   0.0  
YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}  P...   661   0.0  
Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON} ...   661   0.0  
NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa] ...   659   0.0  
KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {O...   629   0.0  
KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6....   579   0.0  
SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar...   551   e-179
CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} simil...   540   e-175
Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to...   508   e-162
ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON} ...   504   e-161
KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar...   501   e-160
TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7...   499   e-159
KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa] ...   455   e-143
Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C...   451   e-141
TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_...   431   e-133
Kwal_55.20766 s55 (551209..559251) [8043 bp, 2680 aa] {ON} YGL19...    33   4.6  
NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON...    32   8.0  

>ZYRO0F00440g Chr6 (42723..45842) [3120 bp, 1039 aa] {ON} similar to
            gnl|GLV|CAGL0B03553g Candida glabrata CAGL0B03553g and
            weakly similar to YEL055C uniprot|P39985 Saccharomyces
            cerevisiae
          Length = 1039

 Score = 1845 bits (4778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 927/1039 (89%), Positives = 927/1039 (89%)

Query: 1    MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60
            MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN
Sbjct: 1    MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60

Query: 61   SARLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDER 120
            SARLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDER
Sbjct: 61   SARLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDER 120

Query: 121  GILFGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQELAELAVKKNWLRESCLYTLF 180
            GILFGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQELAELAVKKNWLRESCLYTLF
Sbjct: 121  GILFGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQELAELAVKKNWLRESCLYTLF 180

Query: 181  QTVQRLVPAMESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSLAL 240
            QTVQRLVPAMESEIVSSI    DKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSLAL
Sbjct: 181  QTVQRLVPAMESEIVSSILLLLDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSLAL 240

Query: 241  EFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSANWNPRLHFVWDILIPILA 300
            EFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSANWNPRLHFVWDILIPILA
Sbjct: 241  EFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSANWNPRLHFVWDILIPILA 300

Query: 301  PGKSDEEIPXXXXXXXXXXDTVEGIEFPEFFQAAVDETFFSEKASSERKYLGFLVFIRAV 360
            PGKSDEEIP          DTVEGIEFPEFFQAAVDETFFSEKASSERKYLGFLVFIRAV
Sbjct: 301  PGKSDEEIPSKKSHKKKKKDTVEGIEFPEFFQAAVDETFFSEKASSERKYLGFLVFIRAV 360

Query: 361  EVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKIALCLEA 420
            EVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKIALCLEA
Sbjct: 361  EVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKIALCLEA 420

Query: 421  MLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPNKQHYQFVL 480
            MLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPNKQHYQFVL
Sbjct: 421  MLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPNKQHYQFVL 480

Query: 481  DTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGEDISDLARERLFSILSELTIQKD 540
            DTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGEDISDLARERLFSILSELTIQKD
Sbjct: 481  DTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGEDISDLARERLFSILSELTIQKD 540

Query: 541  GQSWQHYTLKLILSKEAEGNEPINKLDEDLKAIETEALDILQNISSDSPQSRGLEWLLSN 600
            GQSWQHYTLKLILSKEAEGNEPINKLDEDLKAIETEALDILQNISSDSPQSRGLEWLLSN
Sbjct: 541  GQSWQHYTLKLILSKEAEGNEPINKLDEDLKAIETEALDILQNISSDSPQSRGLEWLLSN 600

Query: 601  CLLQLYSGDSESLSIVEELCIFYREGLNESNSLVGITEIXXXXXXXXXXXXXXXXXVVWE 660
            CLLQLYSGDSESLSIVEELCIFYREGLNESNSLVGITEI                 VVWE
Sbjct: 601  CLLQLYSGDSESLSIVEELCIFYREGLNESNSLVGITEILLSLLAQKKALLRKLSLVVWE 660

Query: 661  QFVSEVGEQELKILLEVLDARENKEGFAKLFENVDDYQXXXXXXXXXXXXXXXXXXXXXX 720
            QFVSEVGEQELKILLEVLDARENKEGFAKLFENVDDYQ                      
Sbjct: 661  QFVSEVGEQELKILLEVLDARENKEGFAKLFENVDDYQEESAGEEEDLEDGEGKSKKSDD 720

Query: 721  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNVAKIDREATSALAKALNLPENIVNDK 780
                                             NVAKIDREATSALAKALNLPENIVNDK
Sbjct: 721  KSKSGNDPSDESEDASSASEEDSSDDSDAEDDSNVAKIDREATSALAKALNLPENIVNDK 780

Query: 781  GEVDVERLEAENGANXXXXXXXXXXXXXXXXXXXXXXXXXXQMMKLDEQLSQIFKRRKEA 840
            GEVDVERLEAENGAN                          QMMKLDEQLSQIFKRRKEA
Sbjct: 781  GEVDVERLEAENGANSDEMDDDDDDEEDEEEDEEEESMDDEQMMKLDEQLSQIFKRRKEA 840

Query: 841  LSGVTTGNERKVEVKEARENVITFKHRIVDMLEAYIKHADRIALQDNNDEANSKDTFKNL 900
            LSGVTTGNERKVEVKEARENVITFKHRIVDMLEAYIKHADRIALQDNNDEANSKDTFKNL
Sbjct: 841  LSGVTTGNERKVEVKEARENVITFKHRIVDMLEAYIKHADRIALQDNNDEANSKDTFKNL 900

Query: 901  FLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKIKISAFKGAIDSKRLLEQLEVTHKALL 960
            FLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKIKISAFKGAIDSKRLLEQLEVTHKALL
Sbjct: 901  FLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKIKISAFKGAIDSKRLLEQLEVTHKALL 960

Query: 961  TSKPGQFPALYFSTCSTTSLFLGKVLVENNSEDPAISYGQMIDLYADTTKEWLLIGKFGA 1020
            TSKPGQFPALYFSTCSTTSLFLGKVLVENNSEDPAISYGQMIDLYADTTKEWLLIGKFGA
Sbjct: 961  TSKPGQFPALYFSTCSTTSLFLGKVLVENNSEDPAISYGQMIDLYADTTKEWLLIGKFGA 1020

Query: 1021 NVFADFHNWLLSRKKTPNA 1039
            NVFADFHNWLLSRKKTPNA
Sbjct: 1021 NVFADFHNWLLSRKKTPNA 1039

>NCAS0F00180 Chr6 (25742..28798) [3057 bp, 1018 aa] {ON} Anc_6.7
           YEL055C
          Length = 1018

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/714 (51%), Positives = 494/714 (69%), Gaps = 23/714 (3%)

Query: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60
           M  KVNRD FY+LASDLQ+ER +AA+SL++EL+ L LP   EEW+YV+ RLI GLAS R+
Sbjct: 1   MVTKVNRDLFYKLASDLQEERFQAAISLVKELTNLLLPDETEEWTYVVNRLIKGLASDRS 60

Query: 61  SARLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSK---KDLKGK 117
           SARLGFSLCL+EV+ +AL     AP+ L + D +L+LLS  LS D     K   K  KG+
Sbjct: 61  SARLGFSLCLTEVINLALSMKENAPEGLQTIDDFLQLLSKTLSLDTNANEKGALKKKKGR 120

Query: 118 DERGILFGKMFGLQAILNEPLFTSIFF---DQEGKVSPFALRFAQELAELAVKKNWLRES 174
           DERG+LFGKMFGLQA+ NEP+F+S+F    D + +++PFA +F  E+ +LA+KKNW++ES
Sbjct: 121 DERGLLFGKMFGLQAVTNEPVFSSVFLTKKDGKTEITPFAFKFMNEVVDLALKKNWIKES 180

Query: 175 CLYTLFQTVQRLVPAMESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKV 234
           CL+TLFQT+Q+L+P    +   SI    D + L++T+EGLA+YL + +G    N      
Sbjct: 181 CLFTLFQTIQKLLPYANKDTYLSILSLLDSHNLSLTSEGLAVYLTILYGDTNDNKLD--- 237

Query: 235 PSSLALEFAAWKNNDPLSKGNLPQLSRVLRDAPAND-SEVADGSHPKSA-NWNPRLHFVW 292
            SS+  +   WKNNDPLS+GNLP L+ VLRD+     SE  + S  ++A NWNPRLHFVW
Sbjct: 238 TSSIEFKNPGWKNNDPLSRGNLPLLTEVLRDSSVTQPSEGYENSKKQNASNWNPRLHFVW 297

Query: 293 DILIPILAPGKSDEEIPXXXXXXXXXXDTVE---GIEFPEFFQAAVDETFFSEKASSERK 349
           DIL+PIL  GK                +  E    IEFPEF+Q  VDE+FF+EKASSERK
Sbjct: 298 DILLPILISGKHTTASNTQHISKKRKKNNNELPKHIEFPEFWQMVVDESFFNEKASSERK 357

Query: 350 YLGFLVFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKD 409
           YLGFL+FI+ ++VVS   + +CF+ NFMR+LINQS+DSKRLL+K+SQ AL+ I++ C++D
Sbjct: 358 YLGFLIFIKTIKVVSQTQLNNCFSHNFMRSLINQSTDSKRLLHKMSQNALNTIIEVCQED 417

Query: 410 ASEKIALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREE 469
           +S K+  C+ AM+FGP G+I+FDKLTKSKT SKL++I  +    L  LF++ ++ +S + 
Sbjct: 418 SSNKLVKCVNAMVFGPSGSINFDKLTKSKTISKLISIHPLDVKTLADLFDLFTSNISEKS 477

Query: 470 EPNKQHYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGEDISDLARERLF 529
           E NKQ  ++VLDT+LH VRTH+  +  + I  PLLD ++  AFF+K+ E +++LA+ER  
Sbjct: 478 E-NKQKNRYVLDTLLHIVRTHKTGLEYDAIVTPLLDPLIQWAFFAKENEPLNELAKERFS 536

Query: 530 SILSELT--IQKD-GQSWQHYTLKLILSKEAEGN-EPINKLDEDLKAIETEALDILQNI- 584
           SIL+ELT  I K+   SWQ+Y L +IL KE  G  E +NKLDE+L  I+ +A D++  I 
Sbjct: 537 SILAELTSVIPKEPHHSWQYYALDIILKKERTGKFELVNKLDENLGKIKNDACDVIVKII 596

Query: 585 -SSDSPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYRE--GLNESNSLVGITEIXX 641
            S  SPQ  GLE LLS CLLQL+SG++ESLS +EEL  FY+E  G  ES SLVGITEI  
Sbjct: 597 KSPQSPQLNGLESLLSMCLLQLFSGETESLSTIEELIEFYKEHKGDTESTSLVGITEILL 656

Query: 642 XXXXXXXXXXXXXXXVVWEQFVSEVGEQELKILLEVLDARENKEGFAKLFENVD 695
                          +VWEQF++ VG++EL ILL+VL ARENK+GFA LFE  D
Sbjct: 657 SLLAQKKAVLRKLSLMVWEQFITNVGKEELNILLDVLKARENKQGFAHLFEGAD 710

 Score =  261 bits (667), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 144/280 (51%), Positives = 184/280 (65%), Gaps = 17/280 (6%)

Query: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXXX 814
            V  ID+EATSALAKALNLPENIVNDKGEVDV +LEA                        
Sbjct: 756  VNNIDKEATSALAKALNLPENIVNDKGEVDVAKLEA----------LSDSDMDDDDDDSD 805

Query: 815  XXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874
                   +MM LD+QLS+IFKRRKEALS  +TGN+RK+E KE+RENVI FK R+VD+L  
Sbjct: 806  EESMDDEKMMLLDDQLSEIFKRRKEALSTTSTGNQRKIEAKESRENVIAFKSRVVDLLTV 865

Query: 875  YIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKI 934
            Y+K+ +++   D++ +      F NL  FVEPM+ C+Q TLDK LADK+SKLLK R++KI
Sbjct: 866  YVKYVEKLQTADHSQK------FVNLISFVEPMVTCVQKTLDKSLADKVSKLLKTRIFKI 919

Query: 935  KISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSEDP 994
            K S FK + +   +LE L+  H+ LLT KPGQ P LY++  S+ SLF  K+ V  +S D 
Sbjct: 920  KSSTFKNSANPVEVLEYLKKLHEKLLTEKPGQHPQLYYTLSSSASLFFSKIYVA-SSTDE 978

Query: 995  AISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRK 1034
              +Y ++ID Y++TTK W+   KFG N FADF NWL SRK
Sbjct: 979  TNAYNKLIDQYSNTTKSWMSKSKFGPNFFADFFNWLASRK 1018

>TDEL0G04640 Chr7 complement(845491..848544) [3054 bp, 1017 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1017

 Score =  697 bits (1799), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/697 (52%), Positives = 493/697 (70%), Gaps = 11/697 (1%)

Query: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60
           M G+VNRD FY+LASDLQ+ERV+AAV+LI+ELSAL+LP    EWSYVLKRLI+GL+S RN
Sbjct: 1   MTGRVNRDWFYKLASDLQEERVQAAVALIQELSALDLPDGASEWSYVLKRLINGLSSSRN 60

Query: 61  SARLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGK-SKKDLKGKDE 119
           SARLGFSLCL+EV+ +AL+     P++LSS D +L+LLS+ LS    G+ SKK +KGKDE
Sbjct: 61  SARLGFSLCLTEVINLALNLEGDRPEELSSIDTFLDLLSSTLSLQPSGQDSKKQIKGKDE 120

Query: 120 RGILFGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQELAELAVKKNWLRESCLYTL 179
           RG+LFGKMFGLQA+L+EPLF  +F  +E  +S FALRF  EL +LAV K+WLRE CL+TL
Sbjct: 121 RGLLFGKMFGLQALLSEPLFEKVFISKEKGISDFALRFMDELCQLAVFKSWLREPCLFTL 180

Query: 180 FQTVQRLVPAMESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSLA 239
           FQ  +R++P  + E    +    D+YQLT+TNEGLAIYLLL +   R    S      + 
Sbjct: 181 FQAYERILPLADIETAQVVLRLLDQYQLTLTNEGLAIYLLLLYKSPRDYSSSIL---QMD 237

Query: 240 LEFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSANWNPRLHFVWDILIPIL 299
            E  +WK+NDPL++GNLP LS+VLRD+        D S PK++NW PRLHFVWDIL+PI+
Sbjct: 238 FESKSWKSNDPLARGNLPLLSQVLRDSSV---ATEDESSPKASNWTPRLHFVWDILLPII 294

Query: 300 APGKSDEEIP-XXXXXXXXXXDTVEGIEFPEFFQAAVDETFFSEKASSERKYLGFLVFIR 358
               S  E             +    I+FPEF+Q AVDE+ F+EKAS+ERK+LG ++F +
Sbjct: 295 TQDNSRRESEDRKPKTKKRKKEKATAIQFPEFWQMAVDESMFNEKASTERKFLGLVIFQK 354

Query: 359 AVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKIALCL 418
           A+EV   + +  CF+QN MRTLIN +SDSKRLL KIS K L++IV  C+K   EK+  CL
Sbjct: 355 ALEVTPHKLVGCCFSQNVMRTLINHASDSKRLLFKISLKVLNSIVDICKKRPKEKLVPCL 414

Query: 419 EAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPNKQHYQF 478
            A+LFGPHG+I+FDKLTKSKTA+ L+A+  +  + L+ LF +LS+ L       +++ QF
Sbjct: 415 SAILFGPHGSINFDKLTKSKTATNLLAVNGLDETALNELFGLLSSNLIESSLVEQKNQQF 474

Query: 479 VLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGEDISDLARERLFSILSELT-I 537
           +LDT+LHAVR+H+ E+++++I   +L  I++LAFF+ K E  S+LA+ER +SILSE+T +
Sbjct: 475 ILDTMLHAVRSHKSELNKDIIVTSILRPIISLAFFTVKDEHTSNLAKERFYSILSEITHL 534

Query: 538 QKDGQSWQHYTLKLILSKEAEGNEPINKLDEDLKAIETEALDILQNISSD--SPQSRGLE 595
             +G S+Q+  L +I  + A G E   KLD+ L+ +++EAL  LQ IS++  +PQ RGLE
Sbjct: 535 NNEGPSYQNMALDIIRDEIAAGKELTTKLDDTLEDVKSEALRTLQAISNNEKNPQLRGLE 594

Query: 596 WLLSNCLLQLYSGDSESLSIVEELCIFYREGLNESNSLVGITEIXXXXXXXXXXXXXXXX 655
            L+S CLLQLYSG+SE++S++EELC FY++    S SLVGITEI                
Sbjct: 595 MLISMCLLQLYSGESEAVSVIEELCAFYQDTDENSTSLVGITEILLSLLAQKKAVLRKLS 654

Query: 656 XVVWEQFVSEVGEQELKILLEVLDARENKEGFAKLFE 692
              W+QFVSE+GE ELK LL+VL ARENK+GF++LFE
Sbjct: 655 LSAWQQFVSEIGEAELKALLDVLPARENKKGFSQLFE 691

 Score =  268 bits (684), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 139/282 (49%), Positives = 191/282 (67%), Gaps = 9/282 (3%)

Query: 754  NVAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXX 813
            +VAKID+EATSALAKALNLP+NIVNDKGEVD+   +     +                  
Sbjct: 744  DVAKIDKEATSALAKALNLPDNIVNDKGEVDLNNWDDGA-DDVADDGADDEVDGEEDEDE 802

Query: 814  XXXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLE 873
                    +MM+LD+QLSQIFKRRK+ALS ++TGN+RK E KE+RE+VI FK R++DMLE
Sbjct: 803  DEDSMDDEKMMELDDQLSQIFKRRKDALSNISTGNQRKNEAKESREDVIAFKQRVIDMLE 862

Query: 874  AYIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYK 933
             Y+K  ++ +L++ N          +  L +EPMI+C+Q T DK LA++I+KLL+ +++K
Sbjct: 863  IYVKFVEKQSLKEEN-----YSKISSCLLLLEPMIKCIQQTTDKSLANRIAKLLRTKVFK 917

Query: 934  IKISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVEN-NSE 992
            +K SAF G+ D   L+E L +TH+ + T KPGQ  A+Y+S CST SLFL K+++EN +S+
Sbjct: 918  LKTSAFCGSCDQDELMEMLRMTHEKIQTLKPGQHQAIYYSVCSTASLFLTKIIIENSDSK 977

Query: 993  DPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRK 1034
            D A+    +IDLYA+T K+W   GKFG N+F DF NWL SRK
Sbjct: 978  DAAVH--DIIDLYAETMKQWASNGKFGPNIFIDFSNWLSSRK 1017

>Kpol_1045.80 s1045 complement(186944..190003) [3060 bp, 1019 aa]
           {ON} complement(186946..190005) [3060 nt, 1020 aa]
          Length = 1019

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/692 (51%), Positives = 489/692 (70%), Gaps = 16/692 (2%)

Query: 4   KVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRNSAR 63
           KVNRD FY+LASDL +ERV++AV+LI++LSAL+     +E+ YVL RLISGL+S RNSAR
Sbjct: 3   KVNRDSFYKLASDLPEERVQSAVALIKDLSALKPSEVEKEFEYVLNRLISGLSSNRNSAR 62

Query: 64  LGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDERGIL 123
           LGFSLCL+EVV +ALD+       L S D +L+++   L  D+V   KK  KGKDERGI+
Sbjct: 63  LGFSLCLTEVVNLALDRKDQPLTCLRSIDDFLDMVDKTLVLDSVATGKKLKKGKDERGIM 122

Query: 124 FGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQELAELAVKKNWLRESCLYTLFQTV 183
           FG+MF LQA+LNEPLF  +F D+ GK+S FA+RF  +L ELAV KNWLRE CL+TL+QTV
Sbjct: 123 FGRMFALQALLNEPLFAKVFIDKNGKISKFAIRFQTQLVELAVLKNWLREPCLFTLYQTV 182

Query: 184 QRLVPAMESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSLALEFA 243
           ++ +P ++S  + S+    DKY+LT+TNEGLAIYL L H     NGK  K+ SSL LE  
Sbjct: 183 EKFMPYIDSSYIESLVQLLDKYKLTLTNEGLAIYLSLIHT----NGK--KIASSLPLESQ 236

Query: 244 AWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSANWNPRLHFVWDILIPILAPGK 303
            WK NDPL+KGNLP L++VL ++  N SE   G+   +ANW+PRLHFVWDIL+PIL    
Sbjct: 237 GWKLNDPLAKGNLPTLTQVLLNSNINQSETPQGN---AANWSPRLHFVWDILLPILLGQD 293

Query: 304 SDEEIPXXXXXXXXXXDTVEGIEFPEFFQAAVDETFFSEKASSERKYLGFLVFIRAVEVV 363
           S                +   I+F  F++  VDE+FF+EK+SSERKYLGFL+  +++E+V
Sbjct: 294 STTNDEHVSKKQKSKTTSSTSIKFQSFWKMVVDESFFNEKSSSERKYLGFLIIQKSLELV 353

Query: 364 SSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKIALCLEAMLF 423
            +Q ++S F QN +R++INQS+D+KR+L+KISQK L++I++ACEKD + KI   ++ +LF
Sbjct: 354 PAQLVESLFGQNVLRSMINQSADTKRMLHKISQKVLNSIIEACEKDTT-KITPIVKVILF 412

Query: 424 GPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPNKQHYQFVLDTV 483
           G +G  +FDKLTK+KT +K+++IK++    L ++F MLS ++    E + Q  QFVLDT+
Sbjct: 413 GENGATNFDKLTKTKTINKILSIKNLEEETLSQIFIMLSNEIKGSSE-SIQKDQFVLDTI 471

Query: 484 LHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGEDISDLARERLFSILSEL-TIQKDGQ 542
           LH VR H+LE++   I   LL  ++ LAFF K+ E IS++A+ER FS+LSEL  I    +
Sbjct: 472 LHVVRNHKLEMNIGTIIIQLLTPVIDLAFFLKENERISNIAKERFFSLLSELAAITTSTR 531

Query: 543 SWQHYTLKLILSKEAEGNEPINK-LDEDLKAIETEALDILQNIS--SDSPQSRGLEWLLS 599
           SWQ+  L+LI +KEA G+ P+N+ +D+DL AI+ + ++ L+ ++  SD+ Q RGLE LLS
Sbjct: 532 SWQYTALELISNKEASGS-PLNQEMDQDLIAIKEKGIECLKEVTKKSDTVQLRGLECLLS 590

Query: 600 NCLLQLYSGDSESLSIVEELCIFYREGLNESNSLVGITEIXXXXXXXXXXXXXXXXXVVW 659
             LLQLY+GD +S+SIVE+LC FY E  ++S SLVGITEI                 V W
Sbjct: 591 MSLLQLYAGDVDSVSIVEDLCTFYDEREDDSVSLVGITEILLALLAQRKAVLKKIALVAW 650

Query: 660 EQFVSEVGEQELKILLEVLDARENKEGFAKLF 691
           EQFV  +G +E+K+L++VL+ARENKEGFA+LF
Sbjct: 651 EQFVPFIGPEEVKVLVDVLNARENKEGFAQLF 682

 Score =  268 bits (684), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 137/284 (48%), Positives = 198/284 (69%), Gaps = 10/284 (3%)

Query: 757  KIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXXXXX 816
            KI++E TSALAKALNLP+NI+N+ GEVD++ LE                           
Sbjct: 738  KINKETTSALAKALNLPDNIINENGEVDLDALEG------MSEEENDDDDDDESEEEDDE 791

Query: 817  XXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEAYI 876
                 +MM+LD+QLS+IFKRRKEALS V +GN+RK++VKE+RENVI FKHRI+D+LE YI
Sbjct: 792  SMDDEKMMELDDQLSEIFKRRKEALSSVASGNQRKLDVKESRENVIAFKHRIIDLLETYI 851

Query: 877  KHADRIALQDNNDEANSKDTFKN-LFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKIK 935
            K+ ++I  +   D+  +K+   N +F+ +  M+ C+Q TLD+PLADKISKLLK +L+KI 
Sbjct: 852  KYVEKITSRKLEDQPINKEQLLNCVFMMMNAMVECIQHTLDRPLADKISKLLKVKLFKIN 911

Query: 936  ISAF-KGAIDSKR-LLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVE-NNSE 992
            ++ F  G + ++  +L QL+  H+ L+TSKPGQ  +LYFS CST+SLFL K+L+E  N++
Sbjct: 912  LTFFDNGNVSNQESVLTQLKAIHELLITSKPGQHASLYFSVCSTSSLFLSKLLIETTNAD 971

Query: 993  DPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKKT 1036
            + + ++ Q+ID+Y + +K+WLL G+FG  VF DF+NWL S+K +
Sbjct: 972  ERSYAFSQLIDIYGELSKKWLLKGRFGPIVFMDFYNWLNSKKNS 1015

>Skud_5.34 Chr5 complement(47480..50539) [3060 bp, 1019 aa] {ON}
           YEL055C (REAL)
          Length = 1019

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/711 (50%), Positives = 490/711 (68%), Gaps = 29/711 (4%)

Query: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60
           M GKVNRD F++LASDLQ+ER+ AAV+LI++LSALELP+  EEWSYVL RLI GLAS RN
Sbjct: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDAEEWSYVLNRLIKGLASDRN 60

Query: 61  SARLGFSLCLSEVVKMALDKGT-LAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDE 119
           SARLGFSLCL+EVV + ++  +   P+ L S +++L+ LS+ L       SKK +KGKDE
Sbjct: 61  SARLGFSLCLTEVVNLGINMPSGQRPKGLESKNEFLDTLSSILDIYVNDGSKKPVKGKDE 120

Query: 120 RGILFGKMFGLQAILNEPLFTSIFFDQEGKV-SPFALRFAQELAELAVKKNWLRESCLYT 178
           RGILFGK+FGL+++LNEPLF+ IF D   K  + F +RF ++L +LA++KNW+RE CL++
Sbjct: 121 RGILFGKLFGLKSLLNEPLFSEIFVDDIKKGNTEFVIRFMEQLIDLALRKNWIREPCLFS 180

Query: 179 LFQTVQRLVPAMESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSL 238
           LFQT++ L+P M       I    DKY LT+TNEGL+ YL+L     +       +PS+L
Sbjct: 181 LFQTIKMLLPFMNESTAVKILLIYDKYDLTLTNEGLSTYLVL-----KYESDESLIPSTL 235

Query: 239 ALEFAAWKNNDPLSKGNLPQLSRVLRDA---PANDSEVADGSHPKSANWNPRLHFVWDIL 295
            L  + WKNNDPL++GNLP L++VLRD+   P  + ++ D    K+ANWNPRLHFVWD+L
Sbjct: 236 DLRNSGWKNNDPLARGNLPLLTKVLRDSSVLPDTNGKLQDAKKQKNANWNPRLHFVWDVL 295

Query: 296 IPILAPGKSDEEIPXXXXXXXXXXDTVEG-IEFPEFFQAAVDETFFSEKASSERKYLGFL 354
           +P+   GK +                V+  I+FPEF++ AVDE+FF+EKASSERKYLGFL
Sbjct: 296 LPLFGSGKLENTEHITKKRKKTSGKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFL 355

Query: 355 VFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKI 414
           +     + V    I SCF+QN MRTLINQS DS+R+LNKI+Q  L++IVKACE+D  +K+
Sbjct: 356 IIDATFKTVPGSCIGSCFSQNVMRTLINQSIDSQRILNKIAQITLESIVKACEEDPIKKL 415

Query: 415 ALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPNKQ 474
             CL AMLFGPHG+I+FDKLTKS   SKL+AIK++ S+ L +L +    QL +E+  +  
Sbjct: 416 VPCLNAMLFGPHGSINFDKLTKSNIISKLIAIKELPSAVLAQLISAFLLQL-QEKRGDLP 474

Query: 475 HYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFS-----KKGEDISDLARERLF 529
           H  F+LD++LH +R H++EI+   I  P+L  I+ +AFF      ++ E + +LA+ERL+
Sbjct: 475 HTHFILDSLLHIIRAHKVEINDVGIIKPVLTPIIHMAFFKHATDEQEFEQLHELAKERLY 534

Query: 530 SILSELTIQK-----DGQ--SWQHYTLKLILSKE-AEGNEPINKLDEDLKAIETEALDIL 581
           SIL ELTI K     D Q  SWQ+ TL LIL  E +   + IN LDE L+ I+ EA+  L
Sbjct: 535 SILGELTINKEVNSEDPQINSWQYLTLNLILDIEKSYKADLINPLDESLEKIKNEAISSL 594

Query: 582 QNIS-SDSPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGLNESNSLVGITEIX 640
             IS S++ QS GL  LLS CL+QLY+G+++S+S++EELC F +   +++NS+VGITEI 
Sbjct: 595 AEISKSNTTQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFTK---HDNNSMVGITEIL 651

Query: 641 XXXXXXXXXXXXXXXXVVWEQFVSEVGEQELKILLEVLDARENKEGFAKLF 691
                           ++W+QF+ +VG +EL+ILL+VL ARENK+GFA+LF
Sbjct: 652 LSFLAQKKALLRKLSLIIWQQFIEDVGLEELQILLDVLKARENKQGFAQLF 702

 Score =  271 bits (694), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 144/286 (50%), Positives = 194/286 (67%), Gaps = 25/286 (8%)

Query: 754  NVAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXX 813
            +V  ID+EAT AL KAL+LP+NIVNDKGEVD+ +L                         
Sbjct: 749  DVVNIDKEATGALIKALHLPDNIVNDKGEVDMNQLGG---------------LSDDDDDE 793

Query: 814  XXXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLE 873
                    +MM+LD+QLS+IFKRRKEALS ++TGN+RKVEVKE+RENVI+FKHRIVDML 
Sbjct: 794  DEESMDDEKMMELDDQLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLT 853

Query: 874  AYIKHADRIALQDN-NDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLY 932
             Y+K+ +++A+ +   + +N +     L  F+ PM++C++ TLDKPLADKISKLLKG+++
Sbjct: 854  VYVKYCEKLAIANKVENSSNLEGPLSKLVYFIVPMLKCIRETLDKPLADKISKLLKGKIF 913

Query: 933  KIKISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVE---N 989
            KIK + FK    +  L+  L+ TH+ +LTSKPGQ  +++FS CST+SLFL K+  E   N
Sbjct: 914  KIKANTFKILDKNIELMNLLKSTHELMLTSKPGQHASVFFSACSTSSLFLSKLYFEIGGN 973

Query: 990  NSEDPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKK 1035
            N+ D      ++IDLYA TTKEW+L GKF  NVF DF NWL S+K+
Sbjct: 974  NALD------ELIDLYAATTKEWMLKGKFSTNVFIDFTNWLSSKKQ 1013

>Smik_5.32 Chr5 complement(50787..53849) [3063 bp, 1020 aa] {ON}
           YEL055C (REAL)
          Length = 1020

 Score =  664 bits (1714), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/710 (49%), Positives = 485/710 (68%), Gaps = 29/710 (4%)

Query: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60
           M GKVNRD F++LASDLQ+ER+ AAV+LIE+LSAL LP+  EEW YVL RL+ GLAS RN
Sbjct: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIEDLSALNLPSDAEEWLYVLNRLVKGLASDRN 60

Query: 61  SARLGFSLCLSEVVKMALDKGT-LAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDE 119
           SARLGFSLCL+EV+ +A++  +   P+ L S + +L  LS+ L  +     KK +KGKDE
Sbjct: 61  SARLGFSLCLTEVINLAINMPSGQRPKGLESTNDFLNTLSSVLDVNVNDGGKKSVKGKDE 120

Query: 120 RGILFGKMFGLQAILNEPLFTSIFFDQ-EGKVSPFALRFAQELAELAVKKNWLRESCLYT 178
           RGILFGK+FGL+++LNEPLF+ IF    E   + F +RF +EL +LA+KKNW++E C +T
Sbjct: 121 RGILFGKLFGLKSLLNEPLFSEIFIKNFENGNTDFFIRFTEELIDLALKKNWIKEPCFFT 180

Query: 179 LFQTVQRLVPAMESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSL 238
           LFQT++ L+P ++  I + I    DKY +T+TNEGL+ YLLL +G     G    +PS+L
Sbjct: 181 LFQTIKMLLPFIDESIAAKILLIYDKYNMTLTNEGLSTYLLLKYG-----GDKNLIPSTL 235

Query: 239 ALEFAAWKNNDPLSKGNLPQLSRVLRDA---PANDSEVADGSHPKSANWNPRLHFVWDIL 295
            L+   WK++DPL++GNLP L++VLRD+   P  D +  D    K+ NWNPRLHFVWDIL
Sbjct: 236 DLKNLGWKSDDPLARGNLPLLTKVLRDSSVIPDTDGKSRDTKKQKNTNWNPRLHFVWDIL 295

Query: 296 IPILAPGKSDEEIPXXXXXXXXXXDTVEG-IEFPEFFQAAVDETFFSEKASSERKYLGFL 354
           +P+   GK +                V+  I+FPEF++ A+DE+FF+EKASSERKYLGFL
Sbjct: 296 LPLFGSGKLENTEHVSKKRKKTSTKKVQNSIQFPEFWKMAIDESFFNEKASSERKYLGFL 355

Query: 355 VFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKI 414
           +   A + V   +I SCF+QN MRTLINQS DS+R+LNKI+Q  L +IVKACE+D + K+
Sbjct: 356 IIDAAFKTVPGSYIGSCFSQNVMRTLINQSIDSQRVLNKIAQITLGSIVKACEEDLTNKL 415

Query: 415 ALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPNKQ 474
             CL +MLFGPHG+++FDKLTKS T SKL+AIK++ S+ L +L N+   QL ++ + +  
Sbjct: 416 VPCLNSMLFGPHGSVNFDKLTKSSTVSKLIAIKELPSTVLTQLLNVFLPQL-QQSKRDLT 474

Query: 475 HYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGED-----ISDLARERLF 529
           H  F+LD++LH +R H++EI    +  P+L  I+ +AFF    +D     + +LA+ERLF
Sbjct: 475 HTHFILDSILHIIRAHKVEIDDMDVMKPILTPIIYMAFFKDATDDQELEQLHELAKERLF 534

Query: 530 SILSELTIQKDGQ-------SWQHYTLKLILSKE-AEGNEPINKLDEDLKAIETEALDIL 581
           SIL ELT+ K+         SWQ  TLKLIL  E +     IN LDE+L+  + EA+  L
Sbjct: 535 SILGELTMNKEIHSEDPEINSWQFLTLKLILDMEKSHRGILINPLDENLEKTKEEAISSL 594

Query: 582 QNIS-SDSPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGLNESNSLVGITEIX 640
             IS S + Q+ GL  LLS CL+QLY+G+++S+S++EELC F ++   ++NS+VGITEI 
Sbjct: 595 AEISRSSTAQAWGLSTLLSMCLIQLYAGETDSISVIEELCEFSKD---KNNSMVGITEIL 651

Query: 641 XXXXXXXXXXXXXXXXVVWEQFVSEVGEQELKILLEVLDARENKEGFAKL 690
                           ++W+QF+ +VG +EL++LL+VL ARENK+GFA+L
Sbjct: 652 LSLLAQKKALLKKLSLIIWQQFIEDVGLEELQVLLDVLKARENKQGFAQL 701

 Score =  289 bits (739), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 149/282 (52%), Positives = 200/282 (70%), Gaps = 18/282 (6%)

Query: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXXX 814
            V  ID+EATSAL KALNLP+NIVNDKGEVD+++LE                         
Sbjct: 750  VVNIDKEATSALVKALNLPDNIVNDKGEVDIDQLEG--------------LSDDDEDDED 795

Query: 815  XXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874
                   +MM+LD QLS+IFKRRKEALS ++TGN+RKVEVKE+RENVI+FKHRIVDML  
Sbjct: 796  EESMDDEKMMELDGQLSEIFKRRKEALSNISTGNQRKVEVKESRENVISFKHRIVDMLTV 855

Query: 875  YIKHADRIALQDNNDEANSKDT-FKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYK 933
            Y+K+ +++AL + +++++S  +    L  F+ P+++C+  TLD+PLADKISKLLKG+++K
Sbjct: 856  YVKYCEKLALANKSEDSSSIGSPLSKLVYFIIPILKCINETLDRPLADKISKLLKGKIFK 915

Query: 934  IKISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSED 993
            IK++AFK    +  +++ L+ THK LLTSKPGQ PA+++S CST+SLFL K+ VE +  D
Sbjct: 916  IKVNAFKEMDKNIEVMDLLKSTHKVLLTSKPGQHPAVFYSACSTSSLFLSKLYVEIHGND 975

Query: 994  PAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKK 1035
                  ++IDLYA TTKEW   GKFGANVF DF NWL S+K+
Sbjct: 976  ---KLDELIDLYAATTKEWTNRGKFGANVFIDFINWLSSKKQ 1014

>YEL055C Chr5 complement(48471..51539) [3069 bp, 1022 aa] {ON}
           POL5DNA Polymerase phi; has sequence similarity to the
           human MybBP1A and weak sequence similarity to B-type DNA
           polymerases, not required for chromosomal DNA
           replication; required for the synthesis of rRNA
          Length = 1022

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/711 (49%), Positives = 488/711 (68%), Gaps = 29/711 (4%)

Query: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60
           M GKVNRD F++LASDL++ER+ AAV+LI++LSAL+LP   EEWSYVL RLI GL+S RN
Sbjct: 1   MTGKVNRDLFFKLASDLREERLHAAVALIKDLSALDLPDDAEEWSYVLNRLIKGLSSDRN 60

Query: 61  SARLGFSLCLSEVVKMALDKGT-LAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDE 119
           SARLGFSLCL+EV+ +A++      P+ L S +++L  LS  L+ +    +KK +KGKDE
Sbjct: 61  SARLGFSLCLTEVINLAVNMPPGQRPKGLESTNEFLSTLSTILNVNVNEGTKKSMKGKDE 120

Query: 120 RGILFGKMFGLQAILNEPLFTSIFF-DQEGKVSPFALRFAQELAELAVKKNWLRESCLYT 178
           RGILFGK+FGL+++LNEPLF+ IF  D E   + F +RF ++L +LA+KKNW++E C +T
Sbjct: 121 RGILFGKLFGLKSLLNEPLFSEIFVKDLEKGNTEFFIRFTEQLIDLALKKNWIKEPCFFT 180

Query: 179 LFQTVQRLVPAMESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSL 238
           LFQT++ L+P M+      I    DKY LT+TNEGL+ YLLL     +  G    +PS L
Sbjct: 181 LFQTMKMLLPFMDESSAEKILLIYDKYDLTLTNEGLSTYLLL-----KYEGDESLIPSVL 235

Query: 239 ALEFAAWKNNDPLSKGNLPQLSRVLRDA---PANDSEVADGSHPKSANWNPRLHFVWDIL 295
            L+   WK+NDPL++GNLP L++VLR++   P  +  + +    K+ NWNPRLHFVW +L
Sbjct: 236 DLKNPGWKDNDPLARGNLPLLTKVLRNSSVIPDANGGLKETKKQKNTNWNPRLHFVWSVL 295

Query: 296 IPILAPGKSDEEIPXXXXXXXXXXDTVEG-IEFPEFFQAAVDETFFSEKASSERKYLGFL 354
           +P+   GK +                V+  I+FPEF++ AVDE+FF+EKASSERKYLGFL
Sbjct: 296 LPLFGNGKLENTSHISKKRKKTNNKKVQNSIQFPEFWKMAVDESFFNEKASSERKYLGFL 355

Query: 355 VFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKI 414
           +   A + V   +I  CF+QN MRTLINQS DS+R+LNKISQ  LD+IVKACE+D++ ++
Sbjct: 356 IIDAAFKAVPGSYIGFCFSQNVMRTLINQSIDSQRVLNKISQLTLDSIVKACEEDSANRL 415

Query: 415 ALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPNKQ 474
             CL AMLFGPHG+I+FDKLTKS T SKL+AIK++ S+ L +L ++   QL ++++    
Sbjct: 416 VPCLNAMLFGPHGSINFDKLTKSGTVSKLIAIKELPSTVLAQLLDVFFLQL-QDKKGVLS 474

Query: 475 HYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGEDIS-----DLARERLF 529
           H  F LD++LH VR H++EI+   I  P+L  IV +AFF    +D+      +LA+ERL+
Sbjct: 475 HTLFALDSILHIVRAHKVEINDMDIMKPVLRPIVYMAFFKHTSDDLKLEQLHELAKERLY 534

Query: 530 SILSELTIQKDGQ-------SWQHYTLKLILSKE-AEGNEPINKLDEDLKAIETEALDIL 581
           SIL ELTI K+ +       SWQ+ TLKLIL  E +   + IN LDE+L+ I+ EA+  L
Sbjct: 535 SILGELTINKEIRCKDPEINSWQYLTLKLILDIENSHVGDLINPLDENLENIKNEAISCL 594

Query: 582 QNIS-SDSPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGLNESNSLVGITEIX 640
             +  S + QS GL  LLS CL+QLY+GD++S+S++EELC F +   +E+NS+VGITEI 
Sbjct: 595 SKVCRSRTAQSWGLSTLLSMCLVQLYAGDTDSISVIEELCEFSK---HENNSMVGITEIL 651

Query: 641 XXXXXXXXXXXXXXXXVVWEQFVSEVGEQELKILLEVLDARENKEGFAKLF 691
                           ++W+QF+ EVG +EL+ILL++L ARENK+GFA+LF
Sbjct: 652 LSLLAQKKALLRKLSLIIWQQFIEEVGLEELQILLDILKARENKQGFAQLF 702

 Score =  277 bits (709), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 141/283 (49%), Positives = 194/283 (68%), Gaps = 18/283 (6%)

Query: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXXX 814
            +  ID+EATSAL KALNLP+NIVNDKGEVD+++LE                         
Sbjct: 752  ILNIDKEATSALVKALNLPDNIVNDKGEVDLDQLEG--------------LSDDGGDDED 797

Query: 815  XXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874
                   +MM+LD+QLS+IFKRRKEALS ++TGN+RK EVK++RENVI+FKHR+VDML  
Sbjct: 798  EESMDDEKMMELDDQLSEIFKRRKEALSSISTGNQRKFEVKQSRENVISFKHRVVDMLAV 857

Query: 875  YIKHADRIALQDNNDEANS-KDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYK 933
            Y+K+ +++ L + ++ +N+   +   L  F+ PM++C+  TLD+PLADKISKLLKG+++K
Sbjct: 858  YVKYCEKLTLANKSEHSNNLGGSLSKLVYFIIPMLKCVNETLDRPLADKISKLLKGKIFK 917

Query: 934  IKISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSED 993
            IK++AFK       L++ L+ THK +LTSKPGQ  A+++S CST+SLFL K+ VE    D
Sbjct: 918  IKVTAFKDMNKDIELMDLLKKTHKLMLTSKPGQHAAVFYSMCSTSSLFLSKLYVEIGGND 977

Query: 994  PAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKKT 1036
                  ++IDLY  TTKEW+  GK G N+F DF NWL S+K+T
Sbjct: 978  ---KLDELIDLYTATTKEWMQKGKCGPNIFIDFINWLSSKKQT 1017

>Suva_5.13 Chr5 complement(24593..27664) [3072 bp, 1023 aa] {ON}
           YEL055C (REAL)
          Length = 1023

 Score =  661 bits (1706), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/711 (49%), Positives = 486/711 (68%), Gaps = 30/711 (4%)

Query: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60
           M GKVNRD F++LASDLQ+ER+ AAV+LI++LSALELP+ +EEWSYVL RLI GLAS RN
Sbjct: 1   MTGKVNRDLFFKLASDLQEERLHAAVALIKDLSALELPSDSEEWSYVLNRLIKGLASDRN 60

Query: 61  SARLGFSLCLSEVVKMALDKGT-LAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDE 119
           SARLGFSLCL+EV+ +A++  +   P+ L S + +L+ LS  L  +     KK +KGKDE
Sbjct: 61  SARLGFSLCLTEVINLAMNMPSGQRPKGLESMNDFLDTLSFILDINVNETGKKPVKGKDE 120

Query: 120 RGILFGKMFGLQAILNEPLFTSIFF-DQEGKVSPFALRFAQELAELAVKKNWLRESCLYT 178
           RGILFGK+FGL+++LNEPLF+ IF  D +   + F +RF ++L +LA++KNW++E CLY+
Sbjct: 121 RGILFGKLFGLKSLLNEPLFSGIFVEDLKRGNTEFIIRFMEQLIDLALRKNWIKEPCLYS 180

Query: 179 LFQTVQRLVPAMESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSL 238
           LFQT++ L+P M     + I    DKY LT+TNEGL+ YLLL +   +       VPS+L
Sbjct: 181 LFQTIKMLLPTMNESTAAEILLTYDKYDLTLTNEGLSTYLLLKYESDKD-----LVPSTL 235

Query: 239 ALEFAAWKNNDPLSKGNLPQLSRVLRD---APANDSEVADGSHP-KSANWNPRLHFVWDI 294
            L+   WKNNDPL++GNLP L++VLRD   AP  + +  D +   K+ NWNPRLHFVW+I
Sbjct: 236 GLKNLGWKNNDPLARGNLPLLTKVLRDSAVAPDTNGKAQDNTKKQKNTNWNPRLHFVWNI 295

Query: 295 LIPILAPGK-SDEEIPXXXXXXXXXXDTVEGIEFPEFFQAAVDETFFSEKASSERKYLGF 353
           L+P+   GK  + E                 I+FPEF+Q AVDE+FF+EKASSERKYLGF
Sbjct: 296 LLPLFGSGKLENAEHISKKRKKTSNKKVPSSIQFPEFWQMAVDESFFNEKASSERKYLGF 355

Query: 354 LVFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEK 413
           L+     + V    I  CF++N MRTLINQS DS+R+LNKI+Q  LD+I+KACE+D   K
Sbjct: 356 LIIDATFKTVPGSCIGYCFSRNVMRTLINQSIDSQRILNKIAQITLDSIIKACEEDPVNK 415

Query: 414 IALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPNK 473
           +  CL AMLFGPHG+I+FDKLTK+   SKL+AIK++ ++ L++LFN+   QL +E++ + 
Sbjct: 416 LVPCLSAMLFGPHGSINFDKLTKTSITSKLIAIKELPATVLNQLFNLFVLQL-QEKKDDL 474

Query: 474 QHYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFF-----SKKGEDISDLARERL 528
            H  FVLD++LH +R H+ EI+   I  P+L  IV +AFF      K+ E + +LA+ERL
Sbjct: 475 PHTHFVLDSLLHIIRAHKAEINDVEIIKPVLSPIVYMAFFKHATDDKESEQLHELAKERL 534

Query: 529 FSILSELTIQKDGQ-------SWQHYTLKLILSKE-AEGNEPINKLDEDLKAIETEALDI 580
           +SIL ELTI K+ +       SWQ  TL+LIL  E +   +  N LDE L+  + EA+  
Sbjct: 535 YSILGELTINKEMRSEDPQINSWQFLTLRLILDMEKSHKGDLTNPLDEGLEKTKNEAISS 594

Query: 581 LQNIS-SDSPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGLNESNSLVGITEI 639
           L  IS S++ QS GL  LLS CL+QLY+G+++S+S++EELC F ++   E++S+VGITEI
Sbjct: 595 LTEISKSNTSQSWGLSTLLSMCLIQLYAGETDSISVIEELCEFAKD---ENSSMVGITEI 651

Query: 640 XXXXXXXXXXXXXXXXXVVWEQFVSEVGEQELKILLEVLDARENKEGFAKL 690
                            ++W+QF+ +VG +EL+ILL+VL  RENK+GFA L
Sbjct: 652 LLSLLAQKKALLKKLSLIIWQQFIGDVGLKELQILLDVLKTRENKQGFALL 702

 Score =  281 bits (720), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 148/282 (52%), Positives = 193/282 (68%), Gaps = 15/282 (5%)

Query: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXXX 814
            V  ID+EATSAL KALNLP+NIVNDKGEVD+++LE  +                      
Sbjct: 751  VVNIDKEATSALIKALNLPDNIVNDKGEVDMDQLEGISDD-----------GDGGDDDED 799

Query: 815  XXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874
                   +MM+LD+QLS+IFKRRKEALS ++TGN+RKVEVKE+RENVI FKHRIVDML  
Sbjct: 800  EESMDDEKMMELDDQLSEIFKRRKEALSSISTGNQRKVEVKESRENVIAFKHRIVDMLTI 859

Query: 875  YIKHADRIALQDNND-EANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYK 933
            Y+KH +++A+ +  +          NL  F+ PMI+C++ TLD+PLADKISKLLKG+++K
Sbjct: 860  YVKHCEKLAIANKGELSIEIGGPLSNLVYFIIPMIKCIKETLDRPLADKISKLLKGKIFK 919

Query: 934  IKISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSED 993
            I+ SAFK    +  LL+ L+  HK +LTSKPGQ   ++FS CST+SLFL K+ V+ N  D
Sbjct: 920  IRTSAFKDLDKTIELLDLLKSAHKEMLTSKPGQHANVFFSACSTSSLFLSKLYVDINGND 979

Query: 994  PAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKK 1035
                +  +IDLYA TTK+W   GKFGAN+F DF NWL S+K+
Sbjct: 980  ---KFDDLIDLYASTTKQWTQKGKFGANIFIDFINWLSSKKE 1018

>NDAI0K02910 Chr11 complement(658930..662121) [3192 bp, 1063 aa]
           {ON} Anc_6.7 YEL055C
          Length = 1063

 Score =  659 bits (1700), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 365/735 (49%), Positives = 486/735 (66%), Gaps = 48/735 (6%)

Query: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60
           M GKVNRD FY+LASDL++ER+++AVSLI+ELS L +P   EEW+YVL RLI GLAS RN
Sbjct: 1   MAGKVNRDLFYKLASDLEEERLQSAVSLIKELSQLNVPDDIEEWTYVLNRLIKGLASDRN 60

Query: 61  SARLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDA---VGKSKKDL--- 114
           SARLGFSLCL+E + +AL  G  APQ + S +++L+LLS  L  D+     ++K  L   
Sbjct: 61  SARLGFSLCLTEAINLALGMGDNAPQGVQSINEFLDLLSKTLPIDSNTVATENKTALKKK 120

Query: 115 KGKDERGILFGKMFGLQAILNEPLFTSIFFDQEGKV--SPFALRFAQELAELAVKKNWLR 172
           KG+DERGILFGK+F LQA+LNEPLF++IF  ++ K   S   +R+  EL  L  KKNW+R
Sbjct: 121 KGRDERGILFGKLFALQALLNEPLFSTIFLSEDKKKIDSSLFIRYVDELFTLGSKKNWIR 180

Query: 173 ESCLYTLFQTVQRLVPAMESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNGKSF 232
           ESC +TL+QT+++L+P  + E    +    DKY+LT++ EGLAIYLL+ +  A K     
Sbjct: 181 ESCFFTLYQTIEKLLPYADIEFYQLVLTLLDKYELTLSKEGLAIYLLIIYRSANKKQLE- 239

Query: 233 KVPSSLALEFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKS-------ANWN 285
           K  S + L  + WK+N+PL++GNLP L+ +LRD  +N +E  D   P +       ANW 
Sbjct: 240 KTLSDIQLSNSHWKSNNPLARGNLPALTNILRD--SNVTEFQDHEKPPTKNNKQPPANWA 297

Query: 286 PRLHFVWDILIPIL-------APGKSDEEIPXXXXXXXXXXDTVEGIEFPEFFQAAVDET 338
           PRLHFVWDIL+PIL            D+ I           D+ E I FPEF+Q A+DE+
Sbjct: 298 PRLHFVWDILLPILTTTTTEEDTNSDDKHISKKRKKIKKNQDSNEFIRFPEFWQMAIDES 357

Query: 339 FFSEKASSERKYLGFLVFIRAVEVV---SSQWIQSCFTQNFMRTLINQSSDSKRLLNKIS 395
           FF+EKASSERKYLGFL+F + ++ +   +++ I +CFT+NFMR+LINQSSD+KRLL+K+S
Sbjct: 358 FFNEKASSERKYLGFLIFQKTIQSIGKNNAKLISTCFTRNFMRSLINQSSDNKRLLHKMS 417

Query: 396 QKALDAIVKACEKDASEKIALCLEAMLFGPH--GTISFDKLTKSKTASKLVAIKDISSSG 453
           Q A+D IVK CE D S K+  CL+A+LF  +  G+I+FDKLTKSKT SKL++IK +SSS 
Sbjct: 418 QIAIDTIVKVCEDDPSNKLIPCLDALLFNTNVGGSINFDKLTKSKTVSKLISIKHLSSST 477

Query: 454 LDRLFNMLSAQ---LSREEEPNKQHYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTL 510
           L +L  +  +Q   +S E+E    + QF LDT+LH VR+H+ E   + +  PLL+ +V L
Sbjct: 478 LRQLIKLFISQINAMSTEKEITIVN-QFALDTILHVVRSHKSEFDYDSVVEPLLNPLVKL 536

Query: 511 AFFSKKGEDISDLARERLFSILSELT-------IQKDGQSWQHYTLKLILSKEAEGN-EP 562
           AFFSK  E +++LA+ERL+SILSELT             SW +YTL+LIL  E  GN E 
Sbjct: 537 AFFSKDNEALNELAKERLYSILSELTGATSSPKSSNAAHSWHYYTLQLILELEKSGNQEL 596

Query: 563 INKLDEDLKAIETEALDILQNISSD-----SPQSRGLEWLLSNCLLQLYSGDSESLSIVE 617
           +NKLD DL+ I+   L +L  IS       + QS+GLE LLS C+LQL+SGD+ESLS +E
Sbjct: 597 VNKLDADLETIKNNGLKVLNEISMTNTDEMTQQSKGLELLLSMCILQLFSGDTESLSTIE 656

Query: 618 ELCIFYREGLN-ESNSLVGITEIXXXXXXXXXXXXXXXXXVVWEQFVSEVGEQELKILLE 676
           EL  FY      ES SLVGITEI                  VWE F+S++G+ EL +LL 
Sbjct: 657 ELVEFYSNSKQEESTSLVGITEILLSLLAQKKAILRKLSLSVWEHFISDIGKNELNVLLA 716

Query: 677 VLDARENKEGFAKLF 691
           VL  RENK+GFA LF
Sbjct: 717 VLPVRENKQGFAHLF 731

 Score =  301 bits (770), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 153/288 (53%), Positives = 202/288 (70%), Gaps = 14/288 (4%)

Query: 754  NVAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXX 813
            ++A ID+EATSALAKALNLPENIVN+KGEVD+ +LE     N                  
Sbjct: 786  DIANIDKEATSALAKALNLPENIVNEKGEVDLAKLE-----NMSDNDLDNSINDDDDDES 840

Query: 814  XXXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLE 873
                    +MM+LD+QLS+IFKRRKEALS ++TGN+RK+EVKE+RENVI FKHR++DML 
Sbjct: 841  DEESMDDEKMMELDDQLSEIFKRRKEALSNISTGNQRKIEVKESRENVIAFKHRVIDMLM 900

Query: 874  AYIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYK 933
             Y+K+ + + L   N E      F NL LF+EPMI+C++ TLDK LADK+ KL+K +L+K
Sbjct: 901  IYMKYVEGLTLTTENGEK-----FGNLLLFIEPMIKCVKQTLDKSLADKVVKLVKTKLFK 955

Query: 934  IKISAFKGA---IDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENN 990
            IK S F+      D  R++E L+ TH++LLTSK GQFP+LY+S CST S+FLGK+LV   
Sbjct: 956  IKSSNFQIESLNADDDRVMELLQRTHESLLTSKAGQFPSLYYSLCSTFSIFLGKILVHVE 1015

Query: 991  SEDPAISYGQMIDLYADTTKEWLLI-GKFGANVFADFHNWLLSRKKTP 1037
            S D  I+YG++IDLY +TTK W++  GKFG N F DF+NWL S+++ P
Sbjct: 1016 SNDKEIAYGKLIDLYGETTKSWVMSKGKFGINTFTDFYNWLSSQRQIP 1063

>KAFR0L00330 Chr12 complement(57677..60763) [3087 bp, 1028 aa] {ON}
           Anc_6.7 YEL055C
          Length = 1028

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/726 (49%), Positives = 485/726 (66%), Gaps = 39/726 (5%)

Query: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60
           M GKVNRD FY+LAS+L +ER++AAVS+I+ELSAL+LP   EEW+YVL RLI GL+S R 
Sbjct: 4   MSGKVNRDLFYKLASELGEERLQAAVSIIQELSALKLPDHTEEWNYVLGRLIKGLSSDRT 63

Query: 61  SARLGFSLCLSEVVKMALD---KGTLAPQDLSSPDQYLELLSNNLSPDAVGK-SKKDLKG 116
            ARLGFSLCL+EV+ +A+D   KG +    LS+ DQYL +LS  LS DA  K + K +KG
Sbjct: 64  GARLGFSLCLTEVINLAIDLAGKG-VELDSLSNIDQYLTILSETLSIDAGNKQNNKKMKG 122

Query: 117 KDERGILFGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQELAELAVKKNWLRESCL 176
           KDERG+LFGKMFGL+A+LNEPLF+  F   +   S F  RF  EL +LA +KNW+RE CL
Sbjct: 123 KDERGLLFGKMFGLKALLNEPLFSKTFLPNKKVASNFCERFMVELLDLASRKNWIREPCL 182

Query: 177 YTLFQTVQRLVPAMESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPS 236
           +TLFQTV++L+P  + E +  +    D ++ T+TNEGLAIYLLL H K  + GK F    
Sbjct: 183 FTLFQTVEKLLPFADFEFIKIVLGLLDDHKFTLTNEGLAIYLLLLH-KGPEKGKEFNDKI 241

Query: 237 S-LALEFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSANWNPRLHFVWDIL 295
             L L+ ++WK NDPL++GNLP+L++VLR++     E        SANW PRLHFVWDIL
Sbjct: 242 KLLVLKNSSWKLNDPLARGNLPRLTQVLRESSLASEE--KKVEVMSANWQPRLHFVWDIL 299

Query: 296 IPILAP--GKSDEEIPXXXXXXXXXXDTVEGIEFPEFFQAAVDETFFSEKASSERKYLGF 353
           +P ++     SDE+            +T   I FPEF+Q  VDE+FF+EKASSERKYLGF
Sbjct: 300 LPTVSTIESNSDEKHMSKRRKKNKGPETNTYIRFPEFWQMTVDESFFNEKASSERKYLGF 359

Query: 354 LVFIRAVEVVSSQW-IQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASE 412
            +F RA+ +V +    ++CF+QNFMR+LINQSSD+ RLL+KIS + ++ IVKACE+  S 
Sbjct: 360 SIFERAISIVQNPLHSETCFSQNFMRSLINQSSDASRLLHKISTRVMNTIVKACEESPST 419

Query: 413 KIALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPN 472
           K+   + ++LF  +G+ +FDKLTKSKT SKL++I  ++   L +LF+ML++Q+      +
Sbjct: 420 KLIPVIHSILFATNGSTNFDKLTKSKTVSKLISITGLTLHTLLQLFDMLTSQIKVGTSED 479

Query: 473 KQHYQFVLDTVLHAVRTHRLEI--------SQELIAHPLLDSIVTLAFFSK----KGEDI 520
            +  QF+LD++LH VR+H+ +I          ELI    +  +V LAFF++    K ED 
Sbjct: 480 FKKTQFILDSLLHIVRSHKQDIFDSCTGSTETELIIKHAIAPLVRLAFFAQTDIAKKEDE 539

Query: 521 SD-----LARERLFSILSELTIQKDGQ--SWQHYTLKLILSKEAEG-NEPINKLDEDLKA 572
           SD     LA+ERLFS+LSELT   + Q  SWQ+YTL  I+ +E E  N  INK+D+DLK 
Sbjct: 540 SDNQVDELAKERLFSVLSELTTTTNKQLHSWQYYTLLEIIDRENENPNSLINKMDDDLKT 599

Query: 573 IETEALDILQNISSDSPQS-----RGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREG- 626
           +   A+ +++ I+S + ++     RGLE LLS CLLQLYSGD++S++ +EEL  FY    
Sbjct: 600 VRDNAIKVIKGIASKNEKTTSSGERGLESLLSMCLLQLYSGDADSVATIEELITFYNASR 659

Query: 627 -LNESNSLVGITEIXXXXXXXXXXXXXXXXXVVWEQFVSEVGEQELKILLEVLDARENKE 685
            + E  ++VGITEI                 +VWEQFVSE+ E  L +LL+VL ARENK+
Sbjct: 660 DVEEKRTMVGITEILLSLLAQKKAVLKKLSLLVWEQFVSEIDEDVLNLLLDVLPARENKQ 719

Query: 686 GFAKLF 691
           GFA+LF
Sbjct: 720 GFAELF 725

 Score =  255 bits (651), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 135/285 (47%), Positives = 197/285 (69%), Gaps = 35/285 (12%)

Query: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXXX 814
            +AKID+EATSALAKALNLP++I+N+ GEV+ + L   +G++                   
Sbjct: 775  IAKIDKEATSALAKALNLPDDIINENGEVNFDDLS--DGSDISSDEESLDDE-------- 824

Query: 815  XXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874
                   +MM+LD+QL++IFKRRKEALS V+TGN+RK+EVKE+RE+VI FKHR+ D+L  
Sbjct: 825  -------KMMELDDQLAEIFKRRKEALSSVSTGNQRKIEVKESRESVIAFKHRVFDLLSI 877

Query: 875  YIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKI 934
            YIKHA+           +S+   K   LF+EPM++C+Q TLDK LADKISKLLK ++YK+
Sbjct: 878  YIKHAE-----------DSELPAKYAILFIEPMMKCVQQTLDKSLADKISKLLKTKVYKL 926

Query: 935  KISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGK--VLVENNSE 992
            K    +  I ++++ + +   H+ LLTSKPGQ+   ++S CS+TS+FL K  +LV N+ E
Sbjct: 927  KTKNME-EITAEQVFDHMTSVHETLLTSKPGQYQPTFYSLCSSTSIFLSKLLLLVSNDKE 985

Query: 993  DPAISYGQMIDLYADTTKEWLLI-GKFGANVFADFHNWLLSRKKT 1036
            +   +YG+++D+Y++TTK+W+L   KFG+N+F DF+NWL S+K T
Sbjct: 986  E---AYGKIVDIYSETTKKWVLKDSKFGSNIFIDFYNWLSSKKST 1027

>KNAG0E00970 Chr5 (183126..186140) [3015 bp, 1004 aa] {ON} Anc_6.7
           YEL055C
          Length = 1004

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/723 (45%), Positives = 466/723 (64%), Gaps = 43/723 (5%)

Query: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60
           M GKVNRD FY+LASDL +ER++AAVSLI+ELS+L LPA  +EWSYV+ RLI GL+S RN
Sbjct: 1   MTGKVNRDHFYKLASDLPEERLQAAVSLIKELSSLPLPASKDEWSYVVNRLIKGLSSDRN 60

Query: 61  SARLGFSLCLSEVVKMAL----DKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKG 116
            ARLGFSLCL+EVV +A+    DK   AP++L S D +L LLS   S D     KK  KG
Sbjct: 61  GARLGFSLCLTEVVDLAIKMDDDK---APEELKSMDSFLHLLSKTFSIDP-QDEKKKRKG 116

Query: 117 KDERGILFGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQELAELAVKKNWLRESCL 176
           K+ERG++FGK+F LQA+LNEPLF+ IF  ++GK++ F  +F  EL  LA +KNW+++ CL
Sbjct: 117 KEERGLMFGKLFALQALLNEPLFSDIFI-KDGKITKFTTKFIDELVNLASRKNWIKQPCL 175

Query: 177 YTLFQTVQRLVPAMESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPS 236
           +TL+QT++RL+P  +   V ++    D  + T+TNEGLAIYLL           S  V +
Sbjct: 176 FTLYQTIERLLPYSDDSFVKTVVTVLDVNKYTLTNEGLAIYLLFISKGYSSALLSINVTN 235

Query: 237 SLALEFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKS--ANWNPRLHFVWDI 294
                   WK N+PL KGNL  +S V+R++      V D +  K+  ANW+P+LHFVWDI
Sbjct: 236 K------GWKYNNPLLKGNLSLVSEVVRESAV----VVDDNETKTNNANWHPKLHFVWDI 285

Query: 295 LIPILAPGKSDEEIPXXXX----XXXXXXDTVEGIEFPEFFQAAVDETFFSEKASSERKY 350
           L+PIL     +E +               + V  IEFPEF++A VDET+FS+KASSERK+
Sbjct: 286 LLPILYNDPREEPLKKKKKHNNGSSKSKSEAVGAIEFPEFWKAIVDETYFSDKASSERKF 345

Query: 351 LGFLVFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDA 410
           LG L+F++A+  V S+WI  CF+QN MR LINQ SDS+R L+KI++K L +IVK CE D 
Sbjct: 346 LGLLIFLKALPTVPSKWIACCFSQNLMRCLINQCSDSERHLHKIAEKCLISIVKTCEADP 405

Query: 411 SEKIALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEE 470
             K+   + A+LFG +G+I+FD+LTKSKT +KL+A K +    + +LF + +++L+ ++ 
Sbjct: 406 GHKLVPVVGALLFGTNGSINFDRLTKSKTVAKLIATKGLEDDSIGKLFALFTSELNSQK- 464

Query: 471 PNKQHYQFVLDTVLHAVRTHRLEISQELIA----HPLLDSIVTLAFFS---KKGED---I 520
            N+    F+LDT+LH +R+H+L +  E I+      LL  +V L FF       ED   +
Sbjct: 465 -NEAVLHFILDTLLHILRSHKLNLKGEHISTWLMSVLLLPLVKLGFFHATETSPEDKINV 523

Query: 521 SDLARERLFSILSELTI--QKDGQSWQHYTLKLILSKEAEGNEPINKLDEDLKAIETEAL 578
           S++ARER++SILSEL+     D  SWQ + L  + + E E     N LDEDL  ++   L
Sbjct: 524 SEIARERIYSILSELSSVPTGDAHSWQFHILNELTTVENELT-LTNALDEDLTTVKDTGL 582

Query: 579 DILQNIS-SDSPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGLNESN--SLVG 635
            ++ ++S  +   SRG+E LL+ CLLQLYSG+++S++ ++E+C +  E  +  N  SLVG
Sbjct: 583 SVIHSLSVKNDKSSRGIESLLAMCLLQLYSGEADSVATIKEICDYLTEEKSSKNSISLVG 642

Query: 636 ITEIXXXXXXXXXXXXXXXXXVVWEQFVSEVGEQELKILLEVLDARENKEGFAKLFENVD 695
           ITEI                 +VWEQ + +VG  EL ++L+VL ARENKEGF+ LFE  +
Sbjct: 643 ITEILLGLLAQKKTVLTKTSLLVWEQLIEDVGSDELNLILDVLSARENKEGFSYLFEGAE 702

Query: 696 DYQ 698
           +Y+
Sbjct: 703 EYE 705

 Score =  224 bits (572), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 120/283 (42%), Positives = 178/283 (62%), Gaps = 24/283 (8%)

Query: 754  NVAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXX 813
            +V  IDR+   ALAKAL LPEN+VN+ GEV    ++     +                  
Sbjct: 743  DVTNIDRQTACALAKALKLPENVVNEDGEVKFNEIDDLEDESSDDESMDDEA-------- 794

Query: 814  XXXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLE 873
                     MM LD QL+ IFKRRK+ALS V TGN RK+EV+++RE+VI FK R++DML 
Sbjct: 795  ---------MMALDGQLADIFKRRKDALSHVPTGNMRKIEVRDSRESVINFKQRMIDMLT 845

Query: 874  AYIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYK 933
             Y+K+ +++ L+D +     K+  + +  FVEPM++C+Q TLD+PLADKI KLLK +++K
Sbjct: 846  IYVKYVEKLDLEDKD---VMKEKLQTVSTFVEPMLKCVQRTLDRPLADKIFKLLKAKIFK 902

Query: 934  IKISAFKGAIDSKRLLEQLEVTHKA-LLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSE 992
            +KI     A D +R +E L+  H   LL  K GQ+ A+Y+S CS+ S+F  K+L+E+   
Sbjct: 903  VKIPV--SAEDGERFVESLQRIHGTYLLAEKSGQYQAIYYSLCSSASIFFCKLLIESRDN 960

Query: 993  DPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKK 1035
              A ++ ++ID+YA+TTK+W+   KF  +VF DF+NWL S+++
Sbjct: 961  KDA-AHNEVIDIYAETTKKWMDKKKFPTSVFFDFYNWLSSKRQ 1002

>SAKL0E00770g Chr5 (53894..57037) [3144 bp, 1047 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1047

 Score =  551 bits (1421), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 327/728 (44%), Positives = 461/728 (63%), Gaps = 61/728 (8%)

Query: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60
           M  K+NRD FY+LASDLQ+ERV+AA+SLI+EL++LE    + EW YVL RLI GL+S RN
Sbjct: 1   MVEKINRDLFYKLASDLQEERVQAAISLIKELASLE--NNDSEWEYVLNRLIKGLSSNRN 58

Query: 61  SARLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDER 120
           SARLGFSLCL+EV+ +AL+KG L     +S ++Y++LL + L  + V        GK+ER
Sbjct: 59  SARLGFSLCLTEVLSVALEKGYL-----NSIEEYIQLLQSTLLKETVKN------GKEER 107

Query: 121 GILFGKMFGLQAILNEPLFTSIFFDQEGKVSP-FALRFAQELAELAVKKNWLRESCLYTL 179
           G+LFG+MFGLQA+LNEPL + IF D+ G ++  F + F  EL ++A+ K W+RE CL+TL
Sbjct: 108 GLLFGRMFGLQALLNEPLLSKIFLDKTGGLNAHFMVNFMGELVQVALSKTWIREPCLFTL 167

Query: 180 FQTVQRLVPAMESEI-VSSIXXXXDKYQLTMTNEGLAIYLLLFH---GKARKNGKSFKVP 235
           FQ V++L P +   + + SI    D  +L++TNEGLAIYL L H   G ++   KS  + 
Sbjct: 168 FQVVEKLSPFLNDTVCIESIFKLLDDNKLSLTNEGLAIYLFLIHLCPGTSKFIKKS-GLL 226

Query: 236 SSLALEFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSANWNPRLHFVWDIL 295
            +L L  + WKNNDPL+KGNLP LS VL+D     S V D    +  +W PRLHFVW+I+
Sbjct: 227 KNLELN-SQWKNNDPLTKGNLPTLSAVLKDV----SPVEDSGLKQKGSWAPRLHFVWNII 281

Query: 296 IPILA-----PGKSDEEIPXXXXXXXXXXDTVEGIEFPEFFQAAVDETFFSEKASSERKY 350
           +PILA      G SDE I             V+ IEFPEF++A VDE+FF+EK+S ERKY
Sbjct: 282 LPILARDDQNEGSSDEHITKKRKKEKAKDVQVKMIEFPEFWKAVVDESFFNEKSSGERKY 341

Query: 351 LGFLVFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDA 410
           LGFL+   A + V    +   F++N MRTLINQSSDSKR+L+KISQK L +I++ CE   
Sbjct: 342 LGFLILEAAFKQVPLSLVSLLFSKNLMRTLINQSSDSKRILHKISQKVLASILELCESHP 401

Query: 411 SEKIALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEE 470
            +K    ++AMLF  +GTI+FDKLTK+KT   LVA   ++   L  L ++  + L   ++
Sbjct: 402 -DKTVPSIQAMLFSENGTINFDKLTKTKTVDLLVANPSMTPKHLSSLVDLFVSHLP--DD 458

Query: 471 PNKQH--YQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFS---------KKGED 519
           PN++    +F+LD++LH VRTH+  +S +    PL+ S++++ FF           + +D
Sbjct: 459 PNEEAALTRFLLDSMLHVVRTHK-TVSDKTWVKPLITSVISMGFFKTSPAKVDQENQDDD 517

Query: 520 ISD----LARERLFSILSELT-IQKD---GQSWQHYTLKLILSKEAEGNEPINKLDEDLK 571
            +D     ARERL+SIL++L  + K      SW + TL+++LS+E +  E I+ LD+ L 
Sbjct: 518 HTDGFEFQARERLYSILADLIPLSKQSIHSASWPYITLQVLLSQE-QSKELIHPLDDGLN 576

Query: 572 AIETEALDILQNISSD------SPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYR- 624
            I+ +AL+ L+ I  +      + Q  GLE LLS  +LQ+Y GD+ESLS++E+L  FY  
Sbjct: 577 KIKLDALNDLEGIRRELENDPSASQFYGLELLLSMTVLQIYGGDTESLSVLEDLVTFYHS 636

Query: 625 -EGLNESNSLVGITEIXXXXXXXXXXXXXXXXXVVWEQFVSEVGEQELKILLEVLDAREN 683
               +E NSL+G+ EI                 +VWE FV +VG  EL++L ++L AREN
Sbjct: 637 MRDSSEENSLIGVIEILLALLAQKKALLRRLSLLVWELFVDKVGTPELEVLFDILSAREN 696

Query: 684 KEGFAKLF 691
           KEGF  LF
Sbjct: 697 KEGFTALF 704

 Score =  232 bits (592), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 126/285 (44%), Positives = 176/285 (61%), Gaps = 20/285 (7%)

Query: 754  NVAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXX 813
            ++ KID+E TSALAKALNLP+ I+N+ GEV+   L   +                     
Sbjct: 778  DINKIDKETTSALAKALNLPDGIINENGEVNFNELSESDDE------------DESEEDE 825

Query: 814  XXXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLE 873
                    +MM+LD+QLSQIF+RRKEALS ++TGN+RK+E KE+RENVI FKH++VDMLE
Sbjct: 826  DEESMDDEKMMELDDQLSQIFQRRKEALSKISTGNKRKLEAKESRENVIAFKHKVVDMLE 885

Query: 874  AYIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYK 933
             ++K  +R +    N E    +  K++    +P+I+C+Q T DK LADK+SKL+K R+ K
Sbjct: 886  VFVKFVERTS---KNKECGETE-LKSVTSMFQPLIKCVQQTTDKALADKLSKLIKNRMCK 941

Query: 934  IKISAFKGAIDS--KRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNS 991
            +K+       D   +  +  L   H+ +L  K GQFP LYFSTCS  SLFL K+LV+ ++
Sbjct: 942  LKLPKLINDSDDIEELTISNLGAVHRLMLADKCGQFPNLYFSTCSVVSLFLSKLLVQAST 1001

Query: 992  EDPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKKT 1036
             D    Y ++ID+Y  T K+W   GKFG + F DF NWL S+K+T
Sbjct: 1002 NDSI--YDRLIDIYLSTMKKWFSKGKFGTSFFFDFINWLASKKQT 1044

>CAGL0B03553g Chr2 (354365..357430) [3066 bp, 1021 aa] {ON} similar
           to uniprot|P39985 Saccharomyces cerevisiae YEL055c POL5
           DNA polymerase V
          Length = 1021

 Score =  540 bits (1390), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 310/701 (44%), Positives = 445/701 (63%), Gaps = 22/701 (3%)

Query: 3   GKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRNSA 62
            KVNRD FY+LASDL +ER++AAV +I++LSALE+P   EEW+Y + RL+ GL S RNSA
Sbjct: 2   AKVNRDHFYKLASDLPEERLQAAVGVIKDLSALEVPQEIEEWNYTINRLVKGLGSSRNSA 61

Query: 63  RLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDERGI 122
           RLGFS+CLSE + +AL  G  AP+ L+S + YL++L+  L  D     K+  KGKDERGI
Sbjct: 62  RLGFSMCLSEALNLALSLGDKAPEGLNSIENYLKILNETLGADFDEGKKR--KGKDERGI 119

Query: 123 LFGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQELAELAVKKNWLRESCLYTLFQT 182
           LFGK+FGLQA+LNEPLF+++F  ++G +S F   F QE+  L+  KNW+RE  L++L+QT
Sbjct: 120 LFGKLFGLQALLNEPLFSNVFVTKDG-ISNFVPVFVQEMINLSKCKNWIREPALFSLYQT 178

Query: 183 VQRLVPAMESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSLALEF 242
           +++L+  +    ++++    D+  LTMTNEGLAIYLLL       N  S    + + L+ 
Sbjct: 179 LEKLISKVSKSDITNLISQLDENNLTMTNEGLAIYLLLVD---ESNKISRAEIAEIKLQN 235

Query: 243 AAWKNNDPLSKGNLPQLSRVLRD----APANDSEVADGSHPKSANWNPRLHFVWDILIPI 298
             WK+NDPL+KGNLP L++VL D    A A D+E         ANWNPRLHFVW+ L+  
Sbjct: 236 QGWKSNDPLAKGNLPSLTKVLLDNDGVAFAEDNE--QRKQKGGANWNPRLHFVWEKLLST 293

Query: 299 LAPGKSDEEIP-XXXXXXXXXXDTVEGIEFPEFFQAAVDETFFSEKASSERKYLGFLVFI 357
           +  G     +            +T+  I+F EF+Q  VDET+F++KASSERKYLGFL+F 
Sbjct: 294 IINGSHSLNVEDKHVSKKRKKNNTIASIKFHEFWQMVVDETYFNDKASSERKYLGFLIFQ 353

Query: 358 RAVEVVSS-QWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKIAL 416
           RA  ++ S + +     QNF+R+LINQ S+ KR LNKI+ + ++ IV++CE D + KI  
Sbjct: 354 RAFPMLKSYEDVVDSLGQNFIRSLINQCSEKKRHLNKIALQTVEIIVESCENDTT-KILP 412

Query: 417 CLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEPNKQHY 476
             E + FG  G+I+FD+L+K+K  S+L+ IK +    L +LF++LS QLS + E  K   
Sbjct: 413 VFETLAFGKSGSITFDRLSKTKLLSRLLGIKSVRYEVLSKLFDILSRQLSIKSE-EKSFS 471

Query: 477 QFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGEDISDLARERLFSILSELT 536
           QF+LD++LH VR  + E+   L+   +L  IV LAFF+   E + ++++ERLFSILSEL 
Sbjct: 472 QFILDSMLHLVRNQKAEVDSLLLTEKVLPQIVKLAFFTGDNETLQEMSKERLFSILSELN 531

Query: 537 ---IQKDGQSWQHYTLKLILSKEAEGNEPINKLDEDLKAIETEALDILQNI--SSDSPQS 591
              + +  +  Q+  +KL+      G +  ++LD++L+  E+ AL IL  I  ++D P  
Sbjct: 532 SLHLSESQEIPQYVVIKLVQQHIEGGEKMTSELDDELRETESSALRILAEIAKATDKPYL 591

Query: 592 RGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGL-NESNSLVGITEIXXXXXXXXXXX 650
           RGL  L + CLLQLY+GDSES+  ++EL   Y + + ++   L  ITEI           
Sbjct: 592 RGLGSLFATCLLQLYTGDSESVGTLQELKDIYEKLISDDERPLSSITEILLSLLAQKKAL 651

Query: 651 XXXXXXVVWEQFVSEVGEQELKILLEVLDARENKEGFAKLF 691
                  VWEQ V  V + EL +LL++L ARENK+GFA+LF
Sbjct: 652 LKKASIAVWEQVVPYVSQDELNLLLDILLARENKQGFAQLF 692

 Score =  251 bits (641), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 132/283 (46%), Positives = 184/283 (65%), Gaps = 17/283 (6%)

Query: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXXX 814
            V  ID+E TSALAKAL+LP +I+N  GEVD+E+LE ++                      
Sbjct: 753  VNNIDKETTSALAKALDLPADIINANGEVDIEKLEMQSDD--------------DEDDED 798

Query: 815  XXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874
                   QMM LD+QLS+IFKRRKEALS + TGN+RK EVKE+RE+VI FKHRIVD+L  
Sbjct: 799  DESMDDEQMMDLDDQLSEIFKRRKEALSNIPTGNKRKNEVKESRESVIAFKHRIVDLLLV 858

Query: 875  YIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKI 934
            YIKH +++  +++ DE +  D    L  F  PMI+C++ TLDK LA+K++KLLK RL+KI
Sbjct: 859  YIKHVEKMIQREDVDENSKADKLNCLLTFAIPMIKCIKQTLDKSLAEKLAKLLKTRLFKI 918

Query: 935  KISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSEDP 994
            +++  K  +D+  ++E  +  H+  L +KPGQFP LY+S CS+TSL+  K+LV+N     
Sbjct: 919  RVTGIK--LDTADVVEDFQRIHQDFLFAKPGQFPILYYSVCSSTSLYFSKILVDNADYQQ 976

Query: 995  AISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKKTP 1037
             + Y  ++D Y+ T KEWL   KF  ++F DF NWL S+K+ P
Sbjct: 977  GV-YETLVDTYSTTIKEWLKDTKFPHSIFLDFVNWLASKKQGP 1018

>Ecym_3009 Chr3 (18017..21100) [3084 bp, 1027 aa] {ON} similar to
           Ashbya gossypii ACR020C
          Length = 1027

 Score =  508 bits (1307), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 312/734 (42%), Positives = 431/734 (58%), Gaps = 63/734 (8%)

Query: 4   KVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRNSAR 63
           +VNRD FYRLASD+++ERVKAAV ++ ELS +      +EW YVL RLI GLAS R  AR
Sbjct: 3   QVNRDLFYRLASDIEEERVKAAVGIVNELSEIVEQDNEQEWQYVLGRLIKGLASARQGAR 62

Query: 64  LGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDERGIL 123
           LGFS+CLSEVV + L+KG      L S + Y+  L   L+   V        GK+ERG++
Sbjct: 63  LGFSMCLSEVVTLGLEKGR-----LESVEVYIGQLFEKLADGHVK------NGKEERGLV 111

Query: 124 FGKMFGLQAILNEPLFTSIFFDQEGKVS--PFALRFAQELAELAVKKNWLRESCLYTLFQ 181
           FGK+FGLQA+LNEPLF  IF D  GKV    F + F   L +LA+ K WLRE CL+TL+Q
Sbjct: 112 FGKLFGLQALLNEPLFGRIFMD--GKVIDLQFTVLFMDHLVKLALSKTWLREPCLFTLYQ 169

Query: 182 TVQRLVPAM-ESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNG---KSFKVPSS 237
            +++L     E   + +I    D ++LT+TNEGLAIYLLL +          KS K+ S 
Sbjct: 170 LIEKLSSKFTEVGHLEAIFKLLDHHKLTLTNEGLAIYLLLIYECVETKSLLIKS-KILSK 228

Query: 238 LALEFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSANWNPRLHFVWDILIP 297
           + L  + WKNNDPLSKGN+  LS VL+D       V D    +  +W PRLHFVWDILIP
Sbjct: 229 ITLR-SCWKNNDPLSKGNVTILSSVLKDIIP----VEDNVMKQKGSWAPRLHFVWDILIP 283

Query: 298 ILA-----PGKSDEEIPXXXXXXXXXXDTVEG-IEFPEFFQAAVDETFFSEKASSERKYL 351
           IL      PG ++              + V   + F EF+Q  VDE+FF+ KASSERKYL
Sbjct: 284 ILCRQQEIPGAAEHVPKKRKTDKKDKIEKVRAPLSFSEFWQVVVDESFFNAKASSERKYL 343

Query: 352 GFLVFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDAS 411
           G L+  +A++ V S ++ S F++N MRTLINQSS+S R L+KIS   L  IV  CE D +
Sbjct: 344 GLLIIEKAMQCVPSSYVPSIFSKNIMRTLINQSSESTRNLHKISTNVLKNIVSICESDPT 403

Query: 412 EKIALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEEP 471
            K+   + ++ FGP+G+I+FD LTKSKT   ++A++ + S  L  L  ++ +++ +E  P
Sbjct: 404 -KVLPVVNSLWFGPNGSINFDILTKSKTMDSIIAVQGLKSEHLASLVALIVSEIDKESSP 462

Query: 472 NKQHYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGED------------ 519
             +  +++LD +LH V+ H+L+ +      PLL SIV L+FF+ K  D            
Sbjct: 463 VSK-VRYLLDILLHIVQAHKLK-ADMFWTKPLLSSIVKLSFFNDKLSDFEDVDLDAHADA 520

Query: 520 ------ISDLARERLFSILSELTIQK----DGQSWQHYTLKLILSKEAEGNEPINKLDED 569
                 I  L+RERLFSIL +L        DG +W + TL++++++E      I KLDE+
Sbjct: 521 DAESKKIPVLSRERLFSILGQLIPTSKQNVDGPTWPYVTLQIVIAEEHR-RSLIFKLDEE 579

Query: 570 LKAIETEALDILQNI---SSDSPQSRGLEWLLSN---CLLQLYSGDSESLSIVEELCIFY 623
           L+  +  AL  + +I   S +SPQ+  L  L       +LQ+YSGD+ES SI+EEL  FY
Sbjct: 580 LQQTKEHALKAINDIRKKSQESPQASELCGLELLLGVTILQMYSGDAESASILEELTTFY 639

Query: 624 REGLNESNSLVGITEIXXXXXXXXXXXXXXXXXVVWEQFVSEVGEQELKILLEVLDAREN 683
           +    + N LVGITEI                 +VWE  + ++   EL +L ++L  REN
Sbjct: 640 KSIDTKPNGLVGITEILLSMVAQKKAVLRRLTLIVWESLIDKIEGDELNLLFDILSVREN 699

Query: 684 KEGFAKLFENVDDY 697
           K+GFA LFE  D+Y
Sbjct: 700 KQGFAALFEAADEY 713

 Score =  234 bits (598), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 123/282 (43%), Positives = 180/282 (63%), Gaps = 24/282 (8%)

Query: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXXX 814
            + KI++E TSALA AL LPEN++++ G+V  E  +  +                      
Sbjct: 765  IDKINKETTSALADALKLPENMIDENGDVGFEDFDDGDEEEEEEESMDDEA--------- 815

Query: 815  XXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874
                    MM+LD QLS+IFKRRKEALS V TGN+RK+EV+E+RE+VI+FKHR++DMLE 
Sbjct: 816  --------MMELDGQLSEIFKRRKEALSKVPTGNKRKLEVRESRESVISFKHRVLDMLEI 867

Query: 875  YIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKI 934
            Y K+  R+A +    EA+      N+   ++P+++C+Q T+D+PLA+K +KLLK  + K+
Sbjct: 868  YCKYVVRLAGKSQQCEASK---LLNIHSMIDPLLKCIQQTIDRPLAEKAAKLLKNHICKL 924

Query: 935  KISAFKGAID--SKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSE 992
            K+  FKG +D  S+ +   LE  H ++L  KPGQF  LYF  CST+SLFLGK+LV    +
Sbjct: 925  KLEPFKGCVDEVSEIVFLSLENIHNSMLAKKPGQFQQLYFGACSTSSLFLGKILVVTKPD 984

Query: 993  DPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRK 1034
            +  ++Y ++ID+Y+ + K W + GKFG N F DF NWL S++
Sbjct: 985  E--VTYNRIIDIYSQSIKNWTVKGKFGPNFFIDFINWLASKR 1024

>ACR020C Chr3 complement(391573..394581) [3009 bp, 1002 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL055C
           (POL5)
          Length = 1002

 Score =  504 bits (1299), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 314/726 (43%), Positives = 437/726 (60%), Gaps = 49/726 (6%)

Query: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60
           M  +VNRD FY+L SDL DERV++A++LI EL+ L +    +EW YVL RL+ GLAS   
Sbjct: 1   MARQVNRDLFYKLTSDLSDERVQSAIALITELNELAVEENGKEWEYVLGRLVRGLASSNK 60

Query: 61  SARLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDER 120
           SARLGFSLCL+EV   AL+ G      + S ++YLE L   L  D V        GK+ER
Sbjct: 61  SARLGFSLCLTEVAAAALENG-----HIGSAEEYLERLEAALPVDKVKN------GKEER 109

Query: 121 GILFGKMFGLQAILNEPLFTSIFFDQEGKVS-PFALRFAQELAELAVKKNWLRESCLYTL 179
           G LFG+MFGLQA+LNEPLF+ +F   +G++   FA +F Q L +LA+ K WLR+ CL+TL
Sbjct: 110 GQLFGRMFGLQAMLNEPLFSRVFVAGDGQIQQAFAHQFMQRLVQLALTKAWLRQPCLFTL 169

Query: 180 FQTVQRLVP-AMESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHG--KARKNGKSFKVPS 236
           +Q ++RL P A ++E + ++    D++ LT T+EGLAIYL L +   + ++     K+  
Sbjct: 170 YQVIERLAPRATDTEFLRAVLTLLDEHNLTHTSEGLAIYLFLQNKCPEIKRILDETKIFD 229

Query: 237 SLALEFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSAN-WNPRLHFVWDIL 295
           +L L    WK ++PL+KGN   L+ VL+D       + +G  PK    W PRLHFVWD+L
Sbjct: 230 ALPL-VKRWKADNPLAKGNAKALASVLKD-----DALIEGDGPKQKGVWTPRLHFVWDLL 283

Query: 296 IPILAPGKSDEEIPXXXXXXXXXXDTVEGIE-----FPEFFQAAVDETFFSEKASSERKY 350
           +P+LA  K   +               +  E     F EF+Q  VDE+FFSEKASSERKY
Sbjct: 284 LPLLAEEKVSPDTHVHIAKKHKTGKKPKSAESGMLSFGEFWQVVVDESFFSEKASSERKY 343

Query: 351 LGFLVFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDA 410
           LG L+  +AV  V S  +Q  F++N +RTLINQSS++ R L+K+S   L  IV ACE DA
Sbjct: 344 LGVLIMEKAVRSVPSSLVQDIFSKNALRTLINQSSETTRHLHKLSVNFLKTIVSACETDA 403

Query: 411 SEKIALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEE 470
           S K+   L A+ FGP+GTI+FDKLTKSKT   LV  K ++++ L +L   L  Q    E 
Sbjct: 404 S-KVVPVLTAIWFGPNGTINFDKLTKSKTTDSLVTAKSLTATELAQL-VTLLLQQLEHEN 461

Query: 471 PNKQHYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFF------SKKGEDISDLA 524
            +    +F+LDT+LH +R H+ +       +PLL ++V  AFF      S++ E+I  L+
Sbjct: 462 TDISKIKFILDTLLHVIRAHKWKAHLSW-TNPLLLALVRYAFFSAPSHLSEQSEEIITLS 520

Query: 525 RERLFSILSELTI----QKDGQSWQHYTLKLILSKEAEGNEPINKLDEDLKAIETEALDI 580
           RERLFS+L EL           SW + TL+L+L +E E +    +LD +L+ + + AL I
Sbjct: 521 RERLFSVLGELIPLSKHDMGAPSWAYATLELLL-QEKEKHPLALQLDAELETVTSNALKI 579

Query: 581 LQNI-------SSDSPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGLNES-NS 632
           L+ I        +++PQ  GLE LLS  +LQ+++GD +S S +EEL  FY      + N 
Sbjct: 580 LRKIINKSTKSPNENPQLFGLELLLSVSILQVHAGDVDSASTLEELASFYESATQGADNG 639

Query: 633 LVGITEIXXXXXXXXXXXXXXXXXVVWEQFVSEVGEQELKILLEVLDARENKEGFAKLFE 692
           LVGITEI                 VVWE F+ +VG++EL++LL  L ARENK GFA+LFE
Sbjct: 640 LVGITEILLSLVAQKKSMLRKLTLVVWESFIDKVGKEELELLLNTLSARENKAGFAQLFE 699

Query: 693 NVDDYQ 698
             D+Y+
Sbjct: 700 GADEYE 705

 Score =  231 bits (588), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 130/284 (45%), Positives = 178/284 (62%), Gaps = 28/284 (9%)

Query: 754  NVAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXX 813
            +VAKID+EATSALA AL LP+NI+++ G V  E ++ E                      
Sbjct: 741  DVAKIDKEATSALAHALRLPDNILDEDGNVGFEEMDDEEEEEESMDDEA----------- 789

Query: 814  XXXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLE 873
                     MM+LD QLS+IFKRRK+AL+ + TGN+RK+E KE+R++VI FKHR+VDMLE
Sbjct: 790  ---------MMELDGQLSEIFKRRKDALNKIPTGNQRKIEAKESRDSVIAFKHRVVDMLE 840

Query: 874  AYIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYK 933
             Y K+ +R   ++    A       N+    EPM++ +Q TLD+PLA+KISKLLK  + K
Sbjct: 841  IYCKNVERSVTKNKKLSATMS---ANMLSMAEPMVKAIQQTLDRPLAEKISKLLKNSVCK 897

Query: 934  IKISAFK---GAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENN 990
            +K +A+K     I+ + +L  LE  H  +L+ KPGQFP L+FS CS+TSLFL KVL+   
Sbjct: 898  MKPAAYKEFTSEINEESILTSLENVHATILSPKPGQFPQLFFSACSSTSLFLSKVLIAMK 957

Query: 991  SEDPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRK 1034
             +DP+ S  Q+I +Y+ T K W + GKFG N F DF NWL S+K
Sbjct: 958  -DDPSTSE-QVIGIYSTTMKHWNVSGKFGPNFFIDFINWLASKK 999

>KLLA0D00792g Chr4 (73422..76484) [3063 bp, 1020 aa] {ON} similar to
           uniprot|P39985 Saccharomyces cerevisiae YEL055C
          Length = 1020

 Score =  501 bits (1289), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 291/718 (40%), Positives = 429/718 (59%), Gaps = 51/718 (7%)

Query: 3   GKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNE---EWSYVLKRLISGLASGR 59
            +VNRD F+++AS+L+ ER++AA+ LI E+S ++     +   EW YV+ RL+ GLAS R
Sbjct: 8   SRVNRDLFFKVASELEKERLEAAIQLINEISRVDTRESEDGVREWEYVIGRLVKGLASNR 67

Query: 60  NSARLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDE 119
             ARLGFS+CL+EV+ +AL++  + P    S   +L  L   L      K+     GK+E
Sbjct: 68  GGARLGFSMCLTEVIALALERRDILP----SIYAFLNQLEQTLPAGTAFKN-----GKEE 118

Query: 120 RGILFGKMFGLQAILNEPLFTSIFF--DQEGKVSPFALRFAQELAELAVKKNWLRESCLY 177
           RG+LFG+MF LQ++LNEP+F+ +F   D       F L +  +L +LA+ K WLRE CLY
Sbjct: 119 RGVLFGQMFALQSLLNEPVFSKLFLSTDDNSINMEFLLTYLNKLIQLALSKTWLREPCLY 178

Query: 178 TLFQTVQRLVPAM--ESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVP 235
           +++QT+Q+    +  +   ++ I    D+ +LT+TNEGL+IYL+        N +     
Sbjct: 179 SVYQTIQKCETRLFNDPTAINLILGLLDEKKLTLTNEGLSIYLMF-------NAQRDTYS 231

Query: 236 SSLALEFAAWKNNDPLSKGNLPQLSRVLRDA-PANDSEVADGSHPKSANWNPRLHFVWDI 294
           SSL +  + WKNNDPLSKGN+  L+ VL+D  P   S++      +   W PRLH+VWDI
Sbjct: 232 SSLVIHNSGWKNNDPLSKGNVQLLASVLKDVVPVEKSDL-----KQKGTWAPRLHYVWDI 286

Query: 295 LIPIL----APGKSDEEIPXXXXXXXXXXDTVEG---IEFPEFFQAAVDETFFSEKASSE 347
           L+P+L    + G+S E              + E    I+FP+F+QA VDE+FF+EK+S+E
Sbjct: 287 LLPLLEDDGSFGQSMESHISKKRKKNTASMSSERTGRIQFPDFWQAVVDESFFNEKSSNE 346

Query: 348 RKYLGFLVFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACE 407
           RKYLGFL+   A++V S + IQ   +QN +R +INQS DS+R+LNKIS +AL +IV  CE
Sbjct: 347 RKYLGFLILEEAIKVCSPKLIQVLLSQNLLRCIINQSQDSQRMLNKISTQALKSIVAECE 406

Query: 408 KDASEKIALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSR 467
           +  ++ + L +E   FG +G+I+FDKL KSK  + L++   +    L  L N+L +QL +
Sbjct: 407 RSPAKVVPL-VEVFWFGRNGSINFDKLIKSKLVNSLISTSSLEKEHLVDLVNLLISQLPQ 465

Query: 468 EEEPNKQH--YQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKK-GEDISDLA 524
           ++         +F+ DT LH  R H+  +    +  PLL +I+  AFF++     +S+LA
Sbjct: 466 DQSTKDSFNLTRFIFDTFLHITRAHKTRLESHWV-KPLLSAIIKAAFFNESDNSKLSELA 524

Query: 525 RERLFSILSELTIQK-----DGQSWQHYTLKLILSKEAEGNEPINKLDEDLKAIETEALD 579
           +ERL+SIL EL  +      D  +W +  L++IL  E  G+     LDEDL+++   A+ 
Sbjct: 525 KERLYSILGELISEPSKSSGDISTWPYIALQIILKIEGSGSTLSIDLDEDLESVRKSAIK 584

Query: 580 ILQNISSD-----SPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGLNESNSLV 634
            L+   SD     +P+  GLE LLS  +LQLY+GD ES+SI+++L  FY E   ES  LV
Sbjct: 585 SLKQNHSDNKNNTNPKLNGLELLLSVAILQLYAGDEESVSILQDLISFYEECDKESTDLV 644

Query: 635 GITEIXXXXXXXXXXXXXXXXXVVWEQFVSEVGEQELKILLEVLDARENKEGFAKLFE 692
           GITEI                 +VWE FV ++GE EL +LL+ L ARENK+GFA LFE
Sbjct: 645 GITEILLSLVAQRKSLLKKLSLIVWESFVHDIGEPELNVLLQTLTARENKQGFADLFE 702

 Score =  231 bits (590), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 129/279 (46%), Positives = 174/279 (62%), Gaps = 15/279 (5%)

Query: 757  KIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXXXXX 816
            KI++EATSALAKALNLP++IV + G+V +         N                     
Sbjct: 754  KIEKEATSALAKALNLPDSIVGEHGDVQL--------GNNEEEDSDEDSDEDDDFSGEDE 805

Query: 817  XXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEAYI 876
                  MM+LD+QLS+IFKRRKEAL  V TGN+RKVEV+E+RENVI+FKHR+VDMLE Y+
Sbjct: 806  SMDDEAMMQLDDQLSEIFKRRKEALGSVPTGNKRKVEVQESRENVISFKHRVVDMLEIYV 865

Query: 877  KHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKIKI 936
            K  DR A+  NN    + + + NL   + P+++CLQ TLDK LADK +KL+K RL K+K 
Sbjct: 866  KSFDR-AVARNNTSIITVEEWNNLSSIILPLLKCLQHTLDKALADKCAKLMKLRLCKVKA 924

Query: 937  S-AFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSEDPA 995
            + A +    +  +   LE  HK ++T+KPGQF  L+FSTCS  SLFL K+ + +      
Sbjct: 925  TIAKEEKTVTSEIFHLLEKVHKLIMTAKPGQFQQLFFSTCSLASLFLSKLYLSSGG---- 980

Query: 996  ISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRK 1034
             S+  +IDLYADT+K W+  GK   N F DF NWL +++
Sbjct: 981  -SHENLIDLYADTSKAWMKDGKCTVNFFIDFSNWLQTKR 1018

>TPHA0J00250 Chr10 (55997..59071) [3075 bp, 1024 aa] {ON} Anc_6.7
           YEL055C
          Length = 1024

 Score =  499 bits (1285), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 292/716 (40%), Positives = 441/716 (61%), Gaps = 47/716 (6%)

Query: 4   KVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNE-EWSYVLKRLISGLASGRNSA 62
           +V+RD FY+LASD+ +ER+ + V ++  L  L +    E EW YV+ RL+ GL S RNSA
Sbjct: 2   RVDRDLFYKLASDVPEERIASVVGVVGNLEKLSVGDEGEKEWVYVVDRLVKGLESNRNSA 61

Query: 63  RLGFSLCLSEVVKMALDKGTLA-PQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGK--DE 119
           RLGFS+CL+E + + L +     P+ L     YL+ + +     AVG  K  +K K  DE
Sbjct: 62  RLGFSMCLTEALHLVLSRDVAERPRCLKDVGDYLKAVDSQFPLSAVGTGKAKVKVKGKDE 121

Query: 120 RGILFGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQELAELAVKKNWLRESCLYTL 179
           RG LFG++F  + +LNEPLF S+ FDQ+     F + F + + +L   KNWL E C ++L
Sbjct: 122 RGTLFGRLFAYKVLLNEPLF-SLLFDQK-----FLIEFQERVIQLGSMKNWLLEPCFFSL 175

Query: 180 FQTVQRLVPAMESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSLA 239
           +Q +++L+P ++ E   +     D+++LTMTNEGL++YLLL         K F + S   
Sbjct: 176 YQAIEKLLPGLDQEYAQATVAQIDEHKLTMTNEGLSVYLLL--------AKKFTL-SDFT 226

Query: 240 LEFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKS-ANWNPRLHFVWDILIPI 298
           LE +AWK NDPL KGNL  +++V+ D         DG++  +  NW PRLH++WDI++  
Sbjct: 227 LENSAWKANDPLQKGNLSVMAKVMLDTNV------DGANSNTNKNWAPRLHYIWDIILRE 280

Query: 299 LAPGK---SDEEIPXXXXXXXXXXDTVEGIEFPEFFQAAVDETFFSEKASSERKYLGFLV 355
               +   SD +            +  + +EF  F+QA VDE+FF++KAS ERKY G+L+
Sbjct: 281 FFDNEQHGSDAKHVYQKKKHDKSKNP-QRVEFKSFWQAVVDESFFNDKASPERKYQGYLI 339

Query: 356 FIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKIA 415
           F +AVE V +  ++ CFTQN MR++INQ+SDSKR+LNK+SQK L+ +V  CE + + K+ 
Sbjct: 340 FQKAVESVPASEVEYCFTQNIMRSMINQASDSKRMLNKLSQKTLNTLVSICESEPA-KLT 398

Query: 416 LCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQL-----SREEE 470
             L A+LF   G+++FD LTKSKT S+L+A K      L  L  + +++L     + E E
Sbjct: 399 PVLTALLFSEEGSLNFDILTKSKTVSRLLATKQSDHHYLATLIRLFTSRLNVSDKTPELE 458

Query: 471 PNKQHYQFVLDTVLHAVRTHR--LEISQELIAHPLLDSIVTLAFFSKKGEDISDLARERL 528
                 +F+LD++L+ +R+ +  LE  +E++   +L+S + LAFF K  E I+++A+ERL
Sbjct: 459 ELNPRLKFILDSLLNLIRSQKALLETDKEIVME-ILESTIQLAFFQKDNEYINNIAKERL 517

Query: 529 FSILSELTI--QKDGQSWQHYTLKLILSKEAEGNEPINKLDEDLKAIETEALDILQNIS- 585
            S+L+EL +    DG SW +  L++I++KE +    I+ LD+ L A++ E+LDIL+ IS 
Sbjct: 518 SSMLAELIVLPSTDG-SWPYLALEIIVTKE-KSETLIDSLDDSLVAVKAESLDILKKISE 575

Query: 586 --SDSPQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGLN-ESNSLVGITEIXXX 642
             S S Q  G+E L+S  L+QLYSGD+ES+ I+E+L  FY E  N E+ +  G+TEI   
Sbjct: 576 LKSKSSQLLGIESLMSMNLIQLYSGDAESIGIIEDLTTFYHETSNHETANFTGVTEILLS 635

Query: 643 XXXXXXXXXXXXXXVVWEQFVSEVGEQELKILLEVLDARENKEGFAKLFENVDDYQ 698
                         +VWEQF+ ++G++E+ +LL  L ARENKEGF+ LFEN  DY+
Sbjct: 636 LLAQRKSLLRKLSLLVWEQFIDQIGKEEINLLLNFLHARENKEGFSVLFENEGDYE 691

 Score =  242 bits (618), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 128/287 (44%), Positives = 183/287 (63%), Gaps = 15/287 (5%)

Query: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXXX 814
            +++ID+E TSALAKALNLP+NI+N+ GEV++  LE                         
Sbjct: 744  ISQIDKETTSALAKALNLPDNIINENGEVNINMLEG---------MDEDDDDDSSSAEDD 794

Query: 815  XXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874
                   +MM+LD+QLS+IFKRRK+ALS V+TGN+RK++VKE+RENVI FKHRI+DMLE 
Sbjct: 795  DESMDDEKMMELDDQLSEIFKRRKDALSTVSTGNQRKLDVKESRENVIAFKHRIIDMLEI 854

Query: 875  YIKHADRIALQ--DNNDEANSKDTFKNLFLF---VEPMIRCLQLTLDKPLADKISKLLKG 929
            YIKH ++++L   D      ++ T + L +    V+    C+Q TLDKPL +KI KL KG
Sbjct: 855  YIKHIEQLSLNRADGGKVVTTEKTEQTLAIMLAIVDAFANCVQQTLDKPLIEKIIKLFKG 914

Query: 930  RLYKIKISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVEN 989
            R  KI+ + F+    S  ++  LE  H  L T+KPGQF A Y+  CS+TSL+L + L++ 
Sbjct: 915  RFSKIRFTLFEDIETSTEIMNSLERIHIHLNTNKPGQFSAAYYLFCSSTSLYLCRFLIDT 974

Query: 990  NSE-DPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKK 1035
              E +    + +++D+YA TTK W+  GK+GA +F DF+NWL S+K+
Sbjct: 975  TVEAEKTKMFEKLVDVYAATTKIWMQEGKYGAKIFVDFYNWLASKKQ 1021

>KLTH0C11594g Chr3 complement(952163..955183) [3021 bp, 1006 aa]
           {ON} similar to uniprot|P39985 Saccharomyces cerevisiae
           YEL055C
          Length = 1006

 Score =  455 bits (1170), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 284/728 (39%), Positives = 417/728 (57%), Gaps = 59/728 (8%)

Query: 1   MPGKVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRN 60
           +  +V+RD FY+LASDL +ER++A + L+ +LS +E  +   EW YVL RLI GL+S RN
Sbjct: 2   VAAEVDRDLFYKLASDLSEERLQAIIGLVTQLSKVEKES--REWEYVLNRLIKGLSSSRN 59

Query: 61  SARLGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDER 120
            ARLG+ LCL+EVV  AL+K  LA  D         L   N+             GK+ER
Sbjct: 60  GARLGYCLCLTEVVASALEKSVLAHADEYLRLLLSTLSRENIK-----------NGKEER 108

Query: 121 GILFGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQELAELAVKKNWLRESCLYTLF 180
           GILFGK+FGLQ +LNEPLF+ +F  ++     F L +   L ++A+ K W+RES ++TL+
Sbjct: 109 GILFGKLFGLQVLLNEPLFSQVFKAEDEINLEFMLTYVGTLIDVALAKTWIRESSMFTLY 168

Query: 181 QTVQRLVPAMESE-IVSSIXXXXDKYQLTMTNEGLAIYLLLFH------GKARKNGKSFK 233
           Q +++L P M S+  + ++    D   LT T+EGLA+YL LFH      G  RK G    
Sbjct: 169 QAIEKLSPVMGSQKPLKALLTLLDSRGLTQTSEGLAVYLYLFHKSFITTGALRKKG---- 224

Query: 234 VPSSLALEFAAWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSANWNPRLHFVWD 293
           +   L L  + WKNNDPLSKGNLP ++  L++   N SE  D S  +   W PRLHFVWD
Sbjct: 225 LLEDLKLN-SPWKNNDPLSKGNLPAIANALKEI--NSSE--DLSVKQKGIWMPRLHFVWD 279

Query: 294 ILIPILAPGKSDEEI---PXXXXXXXXXXDTVEGIEFPEFFQAAVDETFFSEKASSERKY 350
           I++     G   E+    P          +  + I+FPEF+++ VDE+FF+EK+SSERKY
Sbjct: 280 IILTSFFEGGEYEDKASEPAKKKRKKSSEERHQQIKFPEFWKSVVDESFFNEKSSSERKY 339

Query: 351 LGFLVFIRAVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDA 410
           LGFLVF +A  +    +  +  ++N  R LINQ   S+R L+K+SQ+ L  IV  C K+ 
Sbjct: 340 LGFLVFEKAFSLAPVSYTHTLLSKNLTRCLINQCGSSERNLHKVSQRVLTTIVDVC-KNQ 398

Query: 411 SEKIALCLEAMLFGPHGTISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREEE 470
            EK A   E +    HG+ISFD+LTKSKT + L++ K ++   L  L  +L+  L     
Sbjct: 399 PEKTAPSFETLALKEHGSISFDQLTKSKTLNLLLSGKSLTDQQLTLLGEVLTNHLFTSLR 458

Query: 471 PNKQHYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKGED----------- 519
            +    +F+LD +LH VR H+    +  +A PLLDS+V   FF     D           
Sbjct: 459 -DHSRVRFLLDAMLHLVRAHKSAADKVWLA-PLLDSLVQQGFFELDENDRQPEVGDETFT 516

Query: 520 ISDLARERLFSILSELTIQKDGQS----WQHYTLKLILSKEAEGNEPINKLDEDLKAIET 575
           +S LA ERL+SIL++L I  D +S    W  +T+++++SK  + N+ +N +DE+L  I  
Sbjct: 517 VSKLAVERLYSILADL-ISADYKSEKVCWPRFTVEILMSK-LKKNKLLNPMDEELTEILN 574

Query: 576 EALDILQNISSDSP------QSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYRE-GLN 628
            ++   + I S++       Q+RG + + S  +LQ YSG+++S+ ++++L  F++    N
Sbjct: 575 SSIKTFKTICSEAEKGGKQMQARGFQLIFSVNILQAYSGETDSIPVLQDLNSFHQTLEEN 634

Query: 629 ESNSLVGITEIXXXXXXXXXXXXXXXXXVVWEQFVSEVGEQELKILLEVLDARENKEGFA 688
           +S S  G  EI                 +VWE FV E  + ++ +LLE+L ARENKEGF+
Sbjct: 635 KSGSYAGFIEILLSLAAQKKALLRKASLLVWELFVGEASQDDIAVLLEILPARENKEGFS 694

Query: 689 KLFENVDD 696
           KLFE  D+
Sbjct: 695 KLFEGDDE 702

 Score =  202 bits (514), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 131/289 (45%), Positives = 175/289 (60%), Gaps = 27/289 (9%)

Query: 754  NVAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXX 813
            +  +ID+EATSAL KALNLPE+IVND GEV  E LE                        
Sbjct: 741  DTEQIDKEATSALVKALNLPESIVNDNGEVHFEDLED-----------------TEDEEI 783

Query: 814  XXXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLE 873
                    +MM+LD QLS+IFKRRKEALS + TGN+RK EVKE+RENVI FKHR+VDMLE
Sbjct: 784  SDEDLDDEKMMELDGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLE 843

Query: 874  AYIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYK 933
             +++ A+    Q    E   K     +   + P+I C++ TLDKPLA+K++KLLK ++ K
Sbjct: 844  IFVRWAESELKQGGRPE---KSVTSKIISIILPLISCVRTTLDKPLAEKVTKLLKNKICK 900

Query: 934  IKISAFKGAIDS--KRLLEQ-LEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENN 990
            +KI+    ++D   + L E  L+  H+A+L  K GQF  LYFS CST S+FL K+ V + 
Sbjct: 901  LKITT-DTSLDGLEENLFENSLKSVHEAMLLKKCGQFQNLYFSACSTASMFLAKLFV-HR 958

Query: 991  SEDPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKKTPNA 1039
            S  P  +Y  + ++Y  T  EW + GKF AN+F +F NW LS KK  N+
Sbjct: 959  SPRPE-TYFTLTEVYHKTLNEWFVGGKFSANLFIEFLNW-LSIKKQQNS 1005

>Kwal_56.22334 s56 (53478..56504) [3027 bp, 1008 aa] {ON} YEL055C
           (POL5) - DNA polymerase V [contig 186] FULL
          Length = 1008

 Score =  451 bits (1160), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 287/722 (39%), Positives = 415/722 (57%), Gaps = 64/722 (8%)

Query: 4   KVNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRNSAR 63
           ++NRD FY+LASDL +ER++A + L+ +LS LE  +   EW YVL RLI GL+S RN AR
Sbjct: 5   EINRDLFYKLASDLSEERLQATIDLVTQLSKLEKDSS--EWQYVLDRLIKGLSSSRNGAR 62

Query: 64  LGFSLCLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDERGIL 123
           LGFSLCL+EVV +AL+KG LA       DQY+ LL + LS + V        GK+ERG+L
Sbjct: 63  LGFSLCLTEVVALALEKGVLA-----RVDQYMHLLISALSKENVKN------GKEERGLL 111

Query: 124 FGKMFGLQAILNEPLFTSIFFDQEGKVS-PFALRFAQELAELAVKKNWLRESCLYTLFQT 182
           FGK+FGLQ +LNEPLF+ +F   E +++      +   L ++A+ K W+RES L+TLFQ 
Sbjct: 112 FGKLFGLQVLLNEPLFSKVFTPDENQLNVELMSSYMSYLIDIALAKTWIRESSLFTLFQA 171

Query: 183 VQRLVPAMES-EIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNGKSFKVPSSL-AL 240
           V++L P + S + + ++    D   LT T+EGLAIYL L H +    G   +    L  L
Sbjct: 172 VEKLAPLLGSRQPLKAVLELLDSKGLTQTSEGLAIYLFLLH-RCSHTGPVLRKKGFLDEL 230

Query: 241 EFA-AWKNNDPLSKGNLPQLSRVLRDAPANDSEVADGSHPKSANWNPRLHFVWDILIPIL 299
                WKNNDPL +GNLP +S  L+D+ A D    D S  +   W PRLHF WDI++  L
Sbjct: 231 NLKNPWKNNDPLKRGNLPAISNALKDSGARD----DPSLTQKGVWAPRLHFAWDIVLQTL 286

Query: 300 APGKSDEEIPXXXXXXXXXXDTVEG-IEFPEFFQAAVDETFFSEKASSERKYLGFLVFIR 358
              ++ E             +  E  I+FPEF+++ VDE+FF+EK+SSERKYLG LVF +
Sbjct: 287 LHAENSEITTMQPPSKKRKKEEKEAFIKFPEFWKSVVDESFFNEKSSSERKYLGILVFEK 346

Query: 359 AVEVVSSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDASEKIALCL 418
             ++   +++   F++N +R LINQ   ++R L+KISQKAL  IV+ C K   EK A   
Sbjct: 347 TFQLSPPRYLPQLFSKNLIRCLINQCGSAERNLHKISQKALATIVEVC-KAQPEKTAPSF 405

Query: 419 EAMLFGPHGTISFDKLTKSKTASKLVAIKDISS--------SGLDRLFNMLSAQLSREEE 470
             + FG +GTI+FD LTK+KT + L++ K + S        S +  LF  L  +LSR   
Sbjct: 406 VGLSFGEYGTINFDHLTKTKTVNSLLSNKSLRSDDLMILEESLISNLFGNLK-ELSRA-- 462

Query: 471 PNKQHYQFVLDTVLHAVRTHRLEISQELIAHPLLDSIVTLAFFSKKG-----------ED 519
                 +F+LD +LH VR H+   + E+   P+L ++V L FF +               
Sbjct: 463 ------RFILDAILHLVRAHKAH-ADEVWLKPVLKALVCLGFFQQSELKDVKDSQESFHS 515

Query: 520 ISDLARERLFSILSE-LTIQKDGQS--WQHYTLKLILSKEAEGNEPINKLDEDLKAIETE 576
           +S +A ERLFSIL++ LT+++D  S  W    ++L L  +      +  +DE+L  I   
Sbjct: 516 LSSIASERLFSILADLLTVEQDTYSVCWPFIAVQL-LKTDTNQKTLLQSMDEELGDILDS 574

Query: 577 ALDILQNISSDS-----PQSRGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGLNESN 631
           ++ +L +IS  +      Q +GL+ L S  +LQ Y+G+ ES+S++E+L  F  E  + + 
Sbjct: 575 SMTVLSSISQKANEANLSQFQGLQLLFSVNILQAYAGEVESISVLEDLVSFCNEFEDGAK 634

Query: 632 S--LVGITEIXXXXXXXXXXXXXXXXXVVWEQFVSEVGEQELKILLEVLDARENKEGFAK 689
           S  L G  EI                 + WE FV++V E++L +LL VL  RENKEGF+ 
Sbjct: 635 SAPLAGFIEILLSLAAQKKALSRKSSLLAWESFVADVTEKDLTVLLNVLPTRENKEGFSN 694

Query: 690 LF 691
           LF
Sbjct: 695 LF 696

 Score =  221 bits (562), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 128/284 (45%), Positives = 175/284 (61%), Gaps = 24/284 (8%)

Query: 755  VAKIDREATSALAKALNLPENIVNDKGEVDVERLEAENGANXXXXXXXXXXXXXXXXXXX 814
            + KID+EATSALAKALNLP++IV+DKGEV  E L   +                      
Sbjct: 745  MGKIDKEATSALAKALNLPDSIVDDKGEVRFEDLGDTDEEEEESEEDLDDE--------- 795

Query: 815  XXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDMLEA 874
                   +MM+LD QLS+IFKRRKEALS + TGN+RK EVKE+RENVI FKHR+VDMLE 
Sbjct: 796  -------KMMELDGQLSEIFKRRKEALSKIPTGNKRKQEVKESRENVIAFKHRVVDMLEI 848

Query: 875  YIKHADRIALQDNNDEANSKDTFKNLFLFVEPMIRCLQLTLDKPLADKISKLLKGRLYKI 934
             ++  +    +D + E   K     +F  + P++ C++ TLDKPLA+KI+KLLK ++ K+
Sbjct: 849  LVRWIESKMKKDGHIE---KSVLDKVFAIILPLLDCIRTTLDKPLAEKIAKLLKNKICKL 905

Query: 935  K--ISAFKGAIDSKRLLEQLEVTHKALLTSKPGQFPALYFSTCSTTSLFLGKVLVENNSE 992
            K   S+    +D K +L  L   H+A+L  K GQF  LYFS CSTTS+FL +++V+   E
Sbjct: 906  KPSFSSTTEKVDKKAVLSLLRSVHEAMLVKKAGQFQTLYFSGCSTTSMFLARLVVDTFPE 965

Query: 993  DPAISYGQMIDLYADTTKEWLLIGKFGANVFADFHNWLLSRKKT 1036
                +Y ++  +Y  T   W + GKFG ++F +F NW LS KKT
Sbjct: 966  LE--TYEELTGIYHKTLDGWFVTGKFGVSMFVEFLNW-LSVKKT 1006

>TBLA0A07210 Chr1 (1796426..1799551) [3126 bp, 1041 aa] {ON} Anc_6.7
           YEL055C
          Length = 1041

 Score =  431 bits (1107), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 269/728 (36%), Positives = 434/728 (59%), Gaps = 52/728 (7%)

Query: 5   VNRDCFYRLASDLQDERVKAAVSLIEELSALELPACNE-------EWSYVLKRLISGLAS 57
           VNRD FYRLASDL++ER+++ V L++EL  L+    +E       EW+YV+ RLI+GLAS
Sbjct: 4   VNRDVFYRLASDLEEERLQSVVLLVKELDELKANNSDENRELVVKEWNYVVNRLINGLAS 63

Query: 58  GRNSARLGFSLCLSEVVKMALDKG--TLAPQDLSSPDQYLELLSNNLS-PDA-VGKSKKD 113
            R  ARLGFSLCL+EV+ +AL +    + P +L+    +L L+S+ LS P +  G+ +K 
Sbjct: 64  NRKGARLGFSLCLTEVLNLALSQKWKNILPPNLTDISSFLHLISDTLSIPSSKQGEPRKL 123

Query: 114 LKGKDERGILFGKMFGLQAILNEPLFTSIFFDQEGKVSPFALRFAQELAELAVKKNWLRE 173
           LKGKDERG+LFGK+F LQ++LN+P+F  IF +++ K   F   F  EL  L+  KNW++E
Sbjct: 124 LKGKDERGLLFGKLFALQSLLNDPIFGKIF-NKDNKAILF--EFIYELIALSNLKNWIKE 180

Query: 174 SCLYTLFQTVQRLVPAMESEIVSSIXXXXDKYQLTMTNEGLAIYLLLFHGKARKNGKSFK 233
             L+TLF  +Q+++  ++   +  +        LT+TNEGL+IY+ L +     + +  +
Sbjct: 181 PTLFTLFNFIQKIIEFLDRSDIVQLLNILASNNLTLTNEGLSIYIYLIYTNPHISPEDIQ 240

Query: 234 VPSSLALEFAAWKNNDPLSKGNLPQLSRVLRD-APANDSEVADGSHPKSANWNPRLHFVW 292
           + ++    +     NDP  K N+  LS+VL + + A+ SE     H  +ANW PRLH+VW
Sbjct: 241 IDNNNNNTWKN---NDPFLKSNIVLLSKVLLNTSAASQSE----KHTSNANWTPRLHYVW 293

Query: 293 DILIPILAPGKSDEEIPXXXXXXXXXXDTVEGIEFPEFFQAAVDETFFSEKASSERKYLG 352
           D+++PIL   KS +++            + + I+F EF++  +DE+FF+EKAS ERKYLG
Sbjct: 294 DVILPILLNPKSSDKLLNKNGNKRRKV-SRDRIKFNEFWRQVIDESFFNEKASHERKYLG 352

Query: 353 FLVFIRAVEVV-SSQWIQSCFTQNFMRTLINQSSDSKRLLNKISQKALDAIVKACEKDAS 411
           FL+  +   ++ ++  I+S FT N +R++INQ +DSKR LNKIS K +D IV  C+ ++ 
Sbjct: 353 FLIIQKTFPLLNTANDIESIFTSNLIRSIINQMNDSKRYLNKISHKTIDQIVSQCQSNSE 412

Query: 412 EKIALCLEAMLFGPHG--TISFDKLTKSKTASKLVAIKDISSSGLDRLFNMLSAQLSREE 469
            ++   L   LF      +I+FDKLTK+KT S+L+ ++D+S+  L +LF + +++L  + 
Sbjct: 413 LRLIPVLNGFLFKEENSSSINFDKLTKTKTISRLINLQDLSTDTLSKLFFLFTSKL--DS 470

Query: 470 EPNKQHYQFVLDTVLHAVRTHRLEISQELIAH----PLLDSIVTLAFFSKKGE-DISDLA 524
                  QF+LD++LH +R+H+   SQ +++H    P+L+ I+ L FF +  +  IS++ 
Sbjct: 471 FTTTTELQFLLDSILHIIRSHK---SQIIVSHKFLDPVLEPIILLTFFKETADVSISNIL 527

Query: 525 RERLFSILSEL-TIQKDGQSWQHYTLKLILSKEAEGNEPIN-KLDEDLKAIETEALDILQ 582
           ++RL SIL++L T+ ++  S Q+ TL LI++   +    +N K D+ L  ++  A+  L+
Sbjct: 528 KDRLISILNDLTTVGENSSSIQYLTLNLIVNLNEDPKNVLNFKFDDSLLEVKDSAITTLK 587

Query: 583 NISSDSPQS---RGLEWLLSNCLLQLYSGDSESLSIVEELCIFYREGLNESNSLV----- 634
                S +    + L  LLS  ++QLY  D +S++ +++LC FY     +SN+++     
Sbjct: 588 RAIEHSKRDSRLKSLVSLLSLSVIQLYLADIDSIATIQDLCDFYDRY--KSNTIMKNDKN 645

Query: 635 ----GITEIXXXXXXXXXXXXXXXXXVVWEQFVSEVGEQELKILLEVLDARENKEGFAKL 690
               GI EI                  +WE F+  +   E   + +VL  RENKEGFA+L
Sbjct: 646 RPSLGIIEILLALFAQKKSILKKLGLAMWESFIDLIELNEFDEIFDVLLTRENKEGFARL 705

Query: 691 FENVDDYQ 698
           FE  D+Y+
Sbjct: 706 FEGDDEYE 713

 Score =  229 bits (585), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 131/289 (45%), Positives = 180/289 (62%), Gaps = 18/289 (6%)

Query: 754  NVAKIDREATSALAKALNLPENIVNDKGEVDVERLE--AENGANXXXXXXXXXXXXXXXX 811
            ++ +ID+EATSALAKAL LP+NI+NDKGEVD+ +LE  ++N  +                
Sbjct: 756  DINRIDKEATSALAKALKLPDNIINDKGEVDLGKLEDISDNEVHFSSSDDDADMSDESMD 815

Query: 812  XXXXXXXXXXQMMKLDEQLSQIFKRRKEALSGVTTGNERKVEVKEARENVITFKHRIVDM 871
                      QMM+LD QLSQIF RRKEALS + TGN+RK++VKE+RENVI FKHRIVDM
Sbjct: 816  DE--------QMMELDGQLSQIFSRRKEALSNIQTGNKRKLDVKESRENVIAFKHRIVDM 867

Query: 872  LEAYIKHADRIALQDNNDEANSKDTFKN-LFLFVEPMIRCLQLTLDKPLADKISKLLKGR 930
            +E Y+KH + I     N E    +   N + L ++ ++ C+Q TLD+ LA+KISKLLK +
Sbjct: 868  IEVYLKHIEIITKSSENIERTYFNKILNSIPLIIKSLLLCIQQTLDRNLAEKISKLLKNK 927

Query: 931  LYKIKISAFK--GAIDSKRLLEQLEVTH-KALLTSKPGQFPALYFSTCSTTSLFLGKVLV 987
            L+KIK+  FK  G + S+ +LE +   H + +L  K GQ+  LYF  CS +SLF  ++  
Sbjct: 928  LFKIKLVEFKDCGDLTSENILEWISTLHTECILVKKSGQYQPLYFKLCSGSSLFYCRIFA 987

Query: 988  ENNSEDPAISYGQMIDLYADTTKEWLLIG--KFGANVFADFHNWLLSRK 1034
            E ++   A  Y  +IDLY  TTK W      K    +F+DFHNWL S++
Sbjct: 988  ETSTN--ADLYDSLIDLYGQTTKTWFKNSEMKIPTTIFSDFHNWLSSKR 1034

>Kwal_55.20766 s55 (551209..559251) [8043 bp, 2680 aa] {ON} YGL195W
            (GCN1) - translational activator of GCN4 through
            activation of GCN2 in response to starvation [contig 139]
            FULL
          Length = 2680

 Score = 33.1 bits (74), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 53/125 (42%), Gaps = 12/125 (9%)

Query: 9    CFYRLASDLQDERVKAAVSLIEELSALELPACNEEWSYVLKRLISGLASGRNSARLGFSL 68
             F R  +D  D   K  V ++    A  LPA +     +L+RLIS L +   + +   S 
Sbjct: 1261 VFERALTDKHDVATKENVIILYGTLARHLPAEDSRVVTILERLISTLDTPSEAVQQAVSA 1320

Query: 69   CLSEVVKMALDKGTLAPQDLSSPDQYLELLSNNLSPDAVGKSKKDLKGKDERGILFGKMF 128
            C+S +V +   K           D Y++ L+  L    +G S +        G++ G  F
Sbjct: 1321 CISPLVVLLGSK----------VDGYIDNLTQRLLDSKIGTSSRRGAAWGLAGLVQG--F 1368

Query: 129  GLQAI 133
            G+ A+
Sbjct: 1369 GISAL 1373

>NCAS0E02890 Chr5 complement(565154..566101) [948 bp, 315 aa] {ON}
           Anc_7.344 YLR205C
          Length = 315

 Score = 32.0 bits (71), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 54/121 (44%), Gaps = 18/121 (14%)

Query: 379 TLINQSSDSKRLLNKISQKALDAIVKACEKDASEKIALCLEAMLFGPHGTISFD------ 432
           T+I   +D+K L N+I+ +  DA  K   K  S K+A+ L        G +++       
Sbjct: 7   TIIPSPTDTKALANRINFQTRDAHNK-INKKMSIKLAIALRHGFIYRQGILTYYYIFKVV 65

Query: 433 -----KLTKSKTASKLVAIKDISSSG----LDRLFNMLS--AQLSREEEPNKQHYQFVLD 481
                KLT S T S+ V I ++ S       +R  N+L     L  +E P K+  Q  L+
Sbjct: 66  EEEIIKLTTSPTTSEEVKIGNLLSKTWIPEFNRTENLLKDLQLLYHDEYPTKEALQLFLE 125

Query: 482 T 482
           T
Sbjct: 126 T 126

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.133    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 95,225,157
Number of extensions: 3827858
Number of successful extensions: 11863
Number of sequences better than 10.0: 36
Number of HSP's gapped: 11870
Number of HSP's successfully gapped: 67
Length of query: 1039
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 919
Effective length of database: 39,721,479
Effective search space: 36504039201
Effective search space used: 36504039201
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 71 (32.0 bits)