Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F00418g6.6ON62623192e-40
TBLA0A072006.6ON65602055e-23
Sklu_YGOB_Anc_6.66.6ON61602031e-22
Kthe_YGOB_Anc_6.66.6ON62622021e-22
TDEL0G046506.6ON62602022e-22
Kwal_56.223336.6ON62601987e-22
Kpol_1045.826.6ON62601979e-22
Skud_16.66.6ON62611971e-21
Smik_6.4796.6ON62611919e-21
Suva_16.346.6ON62601901e-20
NDAI0I027406.6ON66571901e-20
TPHA0J002306.6ON62601882e-20
CAGL0A01111g6.6ON69591883e-20
Klac_YGOB_Anc_6.66.6ON61601874e-20
YPL271W (ATP15)6.6ON62611848e-20
KNAG0E027906.6ON65611822e-19
KAFR0B064906.6ON66591683e-17
NCAS0D022006.6ON85591633e-16
Ecym_30086.6ON61511259e-11
ACR021W6.6ON62601172e-09
Suva_8.1895.474ON62634620.75
KLTH0C02684g1.506ON101934611.1
KAFR0A034201.251ON165949582.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F00418g
         (62 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON} ...   127   2e-40
TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa] {O...    84   5e-23
Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa] ...    83   1e-22
Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON} ANN...    82   1e-22
TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6 Y...    82   2e-22
Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON} ...    81   7e-22
Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON} (192423...    80   9e-22
Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)       80   1e-21
Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON} ...    78   9e-21
Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W (REAL)    78   1e-20
NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}...    78   1e-20
TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON} ...    77   2e-20
CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly s...    77   3e-20
Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa] ...    77   4e-20
YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon ...    75   8e-20
KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6 Y...    75   2e-19
KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa] {O...    69   3e-17
NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6 Y...    67   3e-16
Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON} sim...    53   9e-11
ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic homo...    50   2e-09
Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON...    28   0.75 
KLTH0C02684g Chr3 complement(242904..245963) [3060 bp, 1019 aa] ...    28   1.1  
KAFR0A03420 Chr1 (697216..702195) [4980 bp, 1659 aa] {ON} Anc_1....    27   2.8  

>ZYRO0F00418g Chr6 complement(41813..42001) [189 bp, 62 aa] {ON}
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271W ATP15 Epsilon subunit of the F1 sector of
          mitochondrial F1F0 ATP synthase which is a large
          evolutionarily conserved enzyme complex required for
          ATP synthesis
          Length = 62

 Score =  127 bits (319), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 62/62 (100%), Positives = 62/62 (100%)

Query: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL
Sbjct: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60

Query: 61 VN 62
          VN
Sbjct: 61 VN 62

>TBLA0A07200 Chr1 complement(1795871..1796068) [198 bp, 65 aa]
          {ON} Anc_6.6 YPL271W
          Length = 65

 Score = 83.6 bits (205), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 37/60 (61%), Positives = 49/60 (81%)

Query: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          MSAWRKAG+TYNAY+++AAKTVR+ALKPE QTAAV+ R   ++++TK+ KG P  +P  L
Sbjct: 1  MSAWRKAGITYNAYIAIAAKTVRNALKPELQTAAVIDRSFTEARFTKYTKGSPDADPALL 60

>Sklu_YGOB_Anc_6.6 Chr5 complement(53390..53575) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 82.8 bits (203), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 48/60 (80%), Gaps = 1/60 (1%)

Query: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          MSAWRKAGLTYN YLS+AAKTVR+ALK E QTA VLSR + ++K+ KFE G P  +P PL
Sbjct: 1  MSAWRKAGLTYNNYLSIAAKTVRAALKTEFQTAQVLSRSKSEAKFIKFENGTP-SDPIPL 59

>Kthe_YGOB_Anc_6.6 Chr3 (955501..955689) [189 bp, 62 aa] {ON}
          ANNOTATED BY YGOB -
          Length = 62

 Score = 82.4 bits (202), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 37/62 (59%), Positives = 49/62 (79%)

Query: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          MSAWRKAGLTYN Y+++AA+TVRSALK + QTA VL R + ++++ K+EKG P  E +PL
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKNDLQTAQVLGRSKTEARFIKYEKGTPVAEAQPL 60

Query: 61 VN 62
           N
Sbjct: 61 KN 62

>TDEL0G04650 Chr7 (850149..850337) [189 bp, 62 aa] {ON} Anc_6.6
          YPL271W
          Length = 62

 Score = 82.4 bits (202), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%)

Query: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          M+AWRKAGLTYN YLSVAA+TVR+ALKPE Q A VL+R + D++Y K+EKG    +  PL
Sbjct: 1  MAAWRKAGLTYNTYLSVAARTVRAALKPELQDARVLARSKTDARYVKYEKGSAASDSVPL 60

>Kwal_56.22333 s56 complement(53024..53212) [189 bp, 62 aa] {ON}
          YPL271W (ATP15) - nuclear gene for ATP synthase epsilon
          subunit [contig 186] FULL
          Length = 62

 Score = 80.9 bits (198), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%)

Query: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          MSAWRKAGLTYN Y+++AA+TVRSALK EAQTA VL R + ++++ K+E G    E +PL
Sbjct: 1  MSAWRKAGLTYNNYMAIAAQTVRSALKKEAQTARVLDRSKTEARFVKYENGTATAESQPL 60

>Kpol_1045.82 s1045 (192421..192609) [189 bp, 62 aa] {ON}
          (192423..192611) [189 nt, 63 aa]
          Length = 62

 Score = 80.5 bits (197), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 34/60 (56%), Positives = 47/60 (78%)

Query: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          MSAWRKAG+TYN Y+++AA+TVR ALK E +T  VL+R + ++K+  FE G P+GEP P+
Sbjct: 1  MSAWRKAGITYNGYVNIAAQTVRKALKNELKTNTVLARSKTEAKFVSFENGAPKGEPVPI 60

>Skud_16.6 Chr16 (9212..9397) [186 bp, 62 aa] {ON} YPL271W (REAL)
          Length = 62

 Score = 80.5 bits (197), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 48/61 (78%)

Query: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          MSAWRKAG++Y AYL+VAA+T+RS+LK E QTA+VLSR + D+ YTK++ G    EP P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQTIRSSLKTELQTASVLSRSKTDAFYTKYKNGAAASEPTPI 60

Query: 61 V 61
           
Sbjct: 61 T 61

>Smik_6.479 Chr6 complement(790945..791130) [186 bp, 62 aa] {ON}
          YPL271W (REAL)
          Length = 62

 Score = 78.2 bits (191), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 47/61 (77%)

Query: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          MSAWRKAG++Y AYL+VAAK +RS+LK E QTA+VLSR + D+ YT+++ G    EP P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAKAIRSSLKTELQTASVLSRSKTDAFYTQYKNGAAASEPTPI 60

Query: 61 V 61
           
Sbjct: 61 T 61

>Suva_16.34 Chr16 (45660..45845) [186 bp, 62 aa] {ON} YPL271W
          (REAL)
          Length = 62

 Score = 77.8 bits (190), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (76%)

Query: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          MSAWRKAG++Y AYL+VAA+T+RS+LK E QTA VLSR R D+ YTK++ G    EP  +
Sbjct: 1  MSAWRKAGVSYAAYLNVAAQTIRSSLKTELQTANVLSRSRTDAYYTKYKNGTAASEPVSI 60

>NDAI0I02740 Chr9 complement(643557..643757) [201 bp, 66 aa] {ON}
          Anc_6.6 YPL271W
          Length = 66

 Score = 77.8 bits (190), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 33/57 (57%), Positives = 46/57 (80%)

Query: 4  WRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          WRKAG+TY+AYLS+AA+T+R+ALKPE QTA V++R   D+ +TK++ G P  EP+ L
Sbjct: 7  WRKAGITYSAYLSIAARTLRAALKPELQTATVMARSHTDAYFTKYKDGAPASEPESL 63

>TPHA0J00230 Chr10 complement(54347..54535) [189 bp, 62 aa] {ON}
          Anc_6.6 YPL271W
          Length = 62

 Score = 77.0 bits (188), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%)

Query: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          MS WRKAGLTY+ YL+VAAKTVR +LK + +T +VLSR + D KYT FEKG  + EP  +
Sbjct: 1  MSTWRKAGLTYSNYLAVAAKTVRQSLKNDLKTNSVLSRSKTDIKYTIFEKGTAKSEPTSI 60

>CAGL0A01111g Chr1 (111480..111689) [210 bp, 69 aa] {ON} highly
          similar to uniprot|P21306 Saccharomyces cerevisiae
          YPL271w ATP15
          Length = 69

 Score = 77.0 bits (188), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 33/59 (55%), Positives = 48/59 (81%)

Query: 2  SAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          +AWRKAGL+Y+++L++AA+TVR +LK E QT AV+ R + D+ YTK+EKG P+ +P PL
Sbjct: 9  TAWRKAGLSYSSFLAIAARTVRESLKKELQTPAVMGRGKTDAAYTKYEKGSPKSDPIPL 67

>Klac_YGOB_Anc_6.6 Chr4 complement(72752..72937) [186 bp, 61 aa]
          {ON} ANNOTATED BY YGOB -
          Length = 61

 Score = 76.6 bits (187), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 37/60 (61%), Positives = 46/60 (76%), Gaps = 1/60 (1%)

Query: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          MS WRKAGLT+N Y+SVAA TVR+ALKPE QT +VL+R + ++K+ KFE G    EP PL
Sbjct: 1  MSTWRKAGLTFNNYVSVAANTVRAALKPELQTNSVLARSKSEAKFIKFENG-VASEPVPL 59

>YPL271W Chr16 (30079..30267) [189 bp, 62 aa] {ON}  ATP15Epsilon
          subunit of the F1 sector of mitochondrial F1F0 ATP
          synthase, which is a large, evolutionarily conserved
          enzyme complex required for ATP synthesis;
          phosphorylated
          Length = 62

 Score = 75.5 bits (184), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 47/61 (77%)

Query: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          MSAWRKAG++Y AYL+VAA+ +RS+LK E QTA+VL+R + D+ YT+++ G    EP P+
Sbjct: 1  MSAWRKAGISYAAYLNVAAQAIRSSLKTELQTASVLNRSQTDAFYTQYKNGTAASEPTPI 60

Query: 61 V 61
           
Sbjct: 61 T 61

>KNAG0E02790 Chr5 (561923..562120) [198 bp, 65 aa] {ON} Anc_6.6
          YPL271W
          Length = 65

 Score = 74.7 bits (182), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 37/61 (60%), Positives = 46/61 (75%), Gaps = 1/61 (1%)

Query: 1  MSA-WRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKP 59
          MSA W+KAG+TY  YL+V AKT+RSALK E QT  VLSR   D+ YT +EKG P+ +P+P
Sbjct: 1  MSAYWKKAGITYATYLNVTAKTLRSALKNELQTQNVLSRGTTDAAYTVYEKGTPKADPQP 60

Query: 60 L 60
          L
Sbjct: 61 L 61

>KAFR0B06490 Chr2 complement(1346858..1347058) [201 bp, 66 aa]
          {ON} Anc_6.6 YPL271W
          Length = 66

 Score = 69.3 bits (168), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%)

Query: 2  SAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          S WRKAGLTY +YLS+A+KT+R  LK E QTAAV SR   ++  T ++ G P  +P+PL
Sbjct: 3  SVWRKAGLTYASYLSIASKTLREVLKTEYQTAAVASRSVTEAHVTNYKNGSPLSDPEPL 61

>NCAS0D02200 Chr4 (410202..410459) [258 bp, 85 aa] {ON} Anc_6.6
          YPL271W
          Length = 85

 Score = 67.4 bits (163), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 30/59 (50%), Positives = 42/59 (71%)

Query: 2  SAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          +  RKAG+TY  YL VA++T+R++LK E QT  V++R   D+ YTK+EKG P  +P PL
Sbjct: 22 ATLRKAGVTYAQYLCVASRTLRASLKTELQTPVVMARSNTDAYYTKYEKGSPIADPAPL 80

>Ecym_3008 Chr3 complement(17404..17589) [186 bp, 61 aa] {ON}
          similar to Ashbya gossypii ACR021W
          Length = 61

 Score = 52.8 bits (125), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 31/51 (60%), Positives = 40/51 (78%)

Query: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKG 51
          MSAWRKAGL+YN Y++VAA+ VRSALKPE + AAVLSR   ++K   ++ G
Sbjct: 1  MSAWRKAGLSYNTYMAVAARAVRSALKPELKNAAVLSRSNTEAKVINYKDG 51

>ACR021W Chr3 (394894..395082) [189 bp, 62 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YPL271W (ATP15)
          Length = 62

 Score = 49.7 bits (117), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 42/60 (70%)

Query: 1  MSAWRKAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRDRVDSKYTKFEKGEPQGEPKPL 60
          MSAWRKAGLTYN+YL+VAA+TVR+ALK E Q+ AVL+R   ++K   +       E  PL
Sbjct: 1  MSAWRKAGLTYNSYLAVAARTVRAALKKELQSPAVLNRSVTEAKVIDYASKGSAAEAVPL 60

>Suva_8.189 Chr8 complement(336968..338848) [1881 bp, 626 aa] {ON}
           YOR137C (REAL)
          Length = 626

 Score = 28.5 bits (62), Expect = 0.75,   Method: Composition-based stats.
 Identities = 14/34 (41%), Positives = 22/34 (64%), Gaps = 1/34 (2%)

Query: 6   KAGLTYNAYLSVAAKTVRSALKPEAQTAAVLSRD 39
           + G+ YN+YL V AK ++S LK   +  A+ +RD
Sbjct: 108 QTGIFYNSYLYVHAKNIQSKLKNSIKELAI-ARD 140

>KLTH0C02684g Chr3 complement(242904..245963) [3060 bp, 1019 aa]
           {ON} similar to uniprot|P24004 Saccharomyces cerevisiae
           YKL197C PEX1 AAA-family ATPase peroxin required for
           peroxisome biogenesis contains two 230 amino acid ATP-
           binding AAA cassettes upregulated in anaerobiosis Pex1p
           and Pex6p interact via their N-terminal AAA-cassettes
          Length = 1019

 Score = 28.1 bits (61), Expect = 1.1,   Method: Composition-based stats.
 Identities = 17/34 (50%), Positives = 20/34 (58%), Gaps = 1/34 (2%)

Query: 1   MSAWRKAGLTYNAYLSVAAKTVRSA-LKPEAQTA 33
           MS     GL YNAYL    +++ SA LK E QTA
Sbjct: 885 MSGADLQGLCYNAYLKAVHRSMASAPLKEEKQTA 918

>KAFR0A03420 Chr1 (697216..702195) [4980 bp, 1659 aa] {ON} Anc_1.251
            YKR031C
          Length = 1659

 Score = 26.9 bits (58), Expect = 2.8,   Method: Composition-based stats.
 Identities = 18/49 (36%), Positives = 28/49 (57%), Gaps = 5/49 (10%)

Query: 7    AGLTYNAYLSVAAKTVRSALKPEAQTAAVLS---RDRVDSKYTK--FEK 50
            A L YN   ++AAK+  SA K +  ++A++    R+  D KY+   FEK
Sbjct: 1160 ASLNYNTLNTIAAKSADSASKKQRISSAMIEMGFREVFDCKYSPIWFEK 1208

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.123    0.346 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 5,905,905
Number of extensions: 149469
Number of successful extensions: 298
Number of sequences better than 10.0: 24
Number of HSP's gapped: 298
Number of HSP's successfully gapped: 24
Length of query: 62
Length of database: 53,481,399
Length adjustment: 35
Effective length of query: 27
Effective length of database: 49,468,089
Effective search space: 1335638403
Effective search space used: 1335638403
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 59 (27.3 bits)