Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0F00396g6.5ON73271736990.0
TDEL0G046606.5ON73972224860.0
CAGL0A01133g6.5ON80173723540.0
Suva_16.356.5ON76774123350.0
YPL270W (MDL2)6.5ON77369223270.0
Kpol_1045.836.5ON74865423260.0
TPHA0J002206.5ON74071823160.0
NDAI0I027306.5ON83271923110.0
NCAS0D022106.5ON77370123060.0
Skud_16.76.5ON77369823040.0
Smik_6.4786.5ON77369023040.0
TBLA0A071906.5ON79467522370.0
SAKL0E00748g6.5ON77465322040.0
KNAG0E028006.5ON74171821740.0
KLTH0C11616g6.5ON74062921580.0
Kwal_56.223296.5ON77662821600.0
KLLA0D00748g6.5ON78967521500.0
Ecym_30076.5ON76968721030.0
ACR022W6.5ON75470620160.0
KAFR0B064806.5ON75170619880.0
Ecym_10721.67ON68366914180.0
Kpol_2000.791.67ON70765414160.0
TDEL0C063501.67ON69364814090.0
NDAI0A005601.67ON71465814100.0
SAKL0C02244g1.67ON71264213890.0
YLR188W (MDL1)1.67ON69565813850.0
Skud_12.2531.67ON69265013820.0
KLLA0C01991g1.67ON70665713681e-179
NCAS0B087001.67ON71565513681e-179
TPHA0B046201.67ON72063813651e-179
Smik_12.2481.67ON69662313561e-178
AFR683C1.67ON67763613351e-175
Suva_10.2841.67ON69363713371e-175
Kwal_33.133081.67ON70669013371e-175
ZYRO0F17050g1.67ON71463813281e-173
KLTH0F02024g1.67ON73467213271e-173
TBLA0A053001.67ON70761512731e-165
CAGL0E00385g1.67ON60860312411e-162
Kwal_26.94805.20ON7194305683e-62
YMR301C (ATM1)5.20ON6904005569e-61
Smik_13.5185.20ON6873975513e-60
Suva_13.4915.20ON6933965471e-59
Skud_13.4755.20ON6914025462e-59
KLTH0B09482g5.20ON6944335411e-58
SAKL0H00968g5.20ON7004595402e-58
KLLA0A10131g5.20ON7204175376e-58
KNAG0E013205.20ON6953785286e-57
KAFR0I025805.20ON7093915234e-56
TPHA0L022705.20ON7114105225e-56
TDEL0G004305.20ON6963915181e-55
YKL209C (STE6)1.527ON12905235221e-54
AGL335W5.20ON6914545111e-54
Ecym_56495.20ON6964005102e-54
NCAS0D024305.20ON7024265084e-54
CAGL0M13739g5.20ON7273915076e-54
NDAI0D015401.527ON12935105141e-53
Kpol_513.235.20ON7083835022e-53
ZYRO0D07106g5.20ON7094555023e-53
NDAI0I024405.20ON7304614953e-52
TBLA0C070005.20ON7254134953e-52
Suva_11.111.527ON12905275024e-52
Kpol_1018.1851.527ON12765224991e-51
NCAS0G035101.527ON12885204981e-51
TDEL0F003401.527ON12575034901e-50
KAFR0E002301.527ON12705154821e-49
TBLA0B100701.527ON12965134812e-49
AFR432W1.527ON12845094803e-49
KNAG0G001901.527ON12755184803e-49
TPHA0O001601.527ON12535044759e-49
Skud_11.111.527ON12955184732e-48
SAKL0A10208g1.527ON13105014687e-48
Smik_11.141.527ON13165244554e-46
ZYRO0G02244g1.527ON12735034473e-45
CAGL0K00363g1.527ON12274454455e-45
Ecym_36121.527ON13154984465e-45
KLLA0B14256g1.527ON12715354431e-44
KLTH0B01100g1.527ON12985514394e-44
TPHA0C009608.303ON15235164314e-43
Ecym_42658.303ON15055234172e-41
Kwal_33.155611.527ON12976154129e-41
NDAI0J011508.303ON15175064111e-40
SAKL0H16016g8.303ON14995054083e-40
KAFR0B056308.303ON15154914049e-40
Smik_4.3808.303ON15164944022e-39
Suva_2.2978.303ON15165174012e-39
KNAG0E011204.6ON17175314012e-39
Skud_4.3958.303ON15165073969e-39
NCAS0B034708.303ON15124873941e-38
Smik_12.484.52ON15575213914e-38
YDR135C (YCF1)8.303ON15155213914e-38
TDEL0E056104.52ON15355263904e-38
KNAG0J027304.52ON15375333871e-37
TDEL0F043008.303ON15144843834e-37
YHL035C (VMR1)4.6ON15925413816e-37
KLLA0F20075g8.303ON15165063817e-37
CAGL0L06402g8.303ON15355003781e-36
Kwal_56.238448.303ON14944973781e-36
Smik_8.64.6ON15855293782e-36
KLTH0G12716g8.303ON15004913753e-36
TBLA0G007104.6ON16915183753e-36
KNAG0I009908.303ON15355033745e-36
Skud_12.524.52ON15615323711e-35
NCAS0C059304.6ON16575353701e-35
CAGL0E03982g4.6ON16595293692e-35
NDAI0B006405.10ON14915423655e-35
ZYRO0D06160g8.303ON15255203648e-35
SAKL0H26026g4.6ON16535223612e-34
Kpol_1033.288.303ON15315123602e-34
Suva_8.164.6ON15995183602e-34
ZYRO0G07612g4.6ON16955103602e-34
YLL048C (YBT1)4.6ON16615103603e-34
CAGL0E03355g4.52ON15355343594e-34
ZYRO0G22176g4.52ON15704963575e-34
Kwal_34.157704.6ON14365063566e-34
Suva_10.594.52ON15615323567e-34
Ecym_84184.6ON16784833568e-34
Suva_10.60singletonON9905323549e-34
Suva_10.234.6ON16615153559e-34
KNAG0K001705.10ON14425423541e-33
AGR047W8.303ON14924843522e-33
CAGL0C03289g4.6ON16485283522e-33
KLTH0C09240gna 1ON15465323523e-33
KAFR0I013004.52ON15365283513e-33
KAFR0C065105.10ON14575313513e-33
TDEL0G018504.6ON16425133496e-33
Kpol_311.34.6ON16575173496e-33
KLTH0H16038g4.6ON16495063487e-33
NDAI0H001904.6ON16825113488e-33
Smik_12.114.6ON16615093433e-32
NCAS0E041605.10ON15062573415e-32
NCAS0J00160singletonON16545053415e-32
TBLA0A038008.303ON15465513381e-31
KAFR0L001904.6ON16535163381e-31
Skud_8.94.6ON15875253381e-31
Skud_12.224.6ON16615163372e-31
YLL015W (BPT1)4.52ON15595343372e-31
CAGL0G00242g5.10ON14775453352e-31
Suva_7.5775.10ON14782623353e-31
TPHA0F004104.52ON15705423353e-31
Skud_7.6145.10ON14775013335e-31
Kwal_56.22747na 1ON15385303317e-31
KLLA0D04059g4.52ON15685213319e-31
TPHA0F001804.6ON16465053254e-30
Smik_16.275.10ON14772593255e-30
KLLA0E00529g4.6ON16505183237e-30
YGR281W (YOR1)5.10ON14772623238e-30
TPHA0K023104.6ON16494983238e-30
KLTH0B00396gsingletonON15072493229e-30
SAKL0H00704g5.10ON14395293211e-29
Kpol_YGOB_1041.454.52ON15685333174e-29
Kpol_1041.45singletonOFF15965333175e-29
YKR104WsingletonON3062642978e-29
Smik_11.367na 2ON15955293131e-28
ACL072C4.6ON16275283103e-28
SAKL0H23958g4.52ON15582763094e-28
TPHA0A056205.10ON14775243061e-27
TDEL0G003305.10ON14655063041e-27
KLLA0C14234g5.10ON14545263041e-27
Kpol_1060.75.10ON14605103041e-27
Kwal_26.95325.10ON14715203004e-27
Skud_18.2singletonON15805312988e-27
KLTH0B09724g5.10ON14865272933e-26
Zrou_YGOB_Anc_5.105.10ON9925002889e-26
TBLA0A06840singletonON10582502791e-24
TBLA0C071005.10ON14855052782e-24
AGL346W5.10ON14005002656e-23
TBLA0C06400singletonON13775262658e-23
Ecym_56605.10ON15362412326e-19
YKR103W (NFT1)na 2ON12183122103e-16
ZYRO0A04114g3.220ON15182671915e-14
KAFR0C00820na 3ON15173241881e-13
Kpol_175.1singletonON13772741852e-13
ACR128C8.661ON8271921833e-13
NCAS0E016303.220ON15653091843e-13
KLTH0D10890g8.661ON8302001816e-13
SAKL0C11616g3.220ON14843231817e-13
SAKL0D10208g1.366ON7522371808e-13
ZYRO0D11858gna 4ON15033111809e-13
SAKL0H21010gsingletonON14472381791e-12
ZYRO0B14762gsingletonON15153161782e-12
Ecym_36043.220ON14743151782e-12
TDEL0D040403.220ON15003161772e-12
Kwal_26.87308.661ON8313141762e-12
Skud_4.2623.220ON15013231772e-12
Skud_14.404na 5ON14243161763e-12
NDAI0H035701.366ON7552201744e-12
ZYRO0D11880g5.500ON14982921754e-12
YNR070W (PDR18)na 5ON13332291744e-12
KAFR0C008303.220ON14843361746e-12
Ecym_24108.661ON8281971727e-12
KAFR0C05210na 4ON14933151737e-12
KNAG0C019601.366ON7522381727e-12
KAFR0C052205.500ON14992571728e-12
Suva_16.1638.661ON8702121728e-12
CAGL0I04862g3.220ON15072421728e-12
KAFR0A037908.661ON8762181718e-12
KNAG0I005301.427ON10472421719e-12
KAFR0C045401.366ON7522381701e-11
ZYRO0E04092g1.427ON10622481711e-11
Kwal_23.51613.220ON14893131711e-11
ZYRO0D11836gna 6ON14622341711e-11
NDAI0G018403.220ON15023401702e-11
KNAG0A029808.661ON8712081692e-11
YPL147W (PXA1)8.661ON8702091692e-11
TDEL0B057601.427ON10362961692e-11
TBLA0D043501.427ON11193051692e-11
KLTH0A01914g3.220ON14992281692e-11
ABR125C3.220ON14882321692e-11
KNAG0K013503.220ON15013001692e-11
TBLA0D01820singletonON15512691692e-11
KAFR0E03450na 4ON15532661683e-11
TPHA0D04700singletonON15102791664e-11
Smik_6.3448.661ON8702111664e-11
TBLA0C012201.366ON7512271654e-11
TBLA0D017805.500ON15952381655e-11
AFR232C3.534ON6072401646e-11
CAGL0K10472g1.366ON7522111646e-11
ZYRO0E08800g3.534ON6102441636e-11
TBLA0G028203.220ON15112741657e-11
NCAS0A120605.500ON15432421647e-11
KNAG0B038705.500ON15132211647e-11
AEL032W1.366ON7532301638e-11
Skud_16.1358.661ON8702081638e-11
KAFR0E03460na 6ON15462661648e-11
KNAG0K009503.133ON12842481639e-11
Kwal_34.162401.366ON7522451639e-11
Smik_4.2443.220ON15012361639e-11
Smik_14.399na 5ON14212861639e-11
Ecym_11943.534ON6092151629e-11
ZYRO0B05588g3.133ON12702331631e-10
YDR011W (SNQ2)3.220ON15012361631e-10
KLTH0H13442g1.366ON7522451621e-10
Suva_15.913.133ON13022541621e-10
SAKL0H06908g8.661ON8361891621e-10
ZYRO0G01144g1.366ON7522341611e-10
Smik_7.3131.366ON7522371611e-10
NDAI0G050201.427ON10973491611e-10
KLLA0D03432g3.220ON14832441612e-10
YFR009W (GCN20)1.366ON7522371602e-10
Smik_17.26singletonON15022561612e-10
NDAI0E012408.661ON8972571583e-10
NCAS0A085701.427ON10602561583e-10
SAKL0F01606g3.534ON6082151573e-10
Kpol_1043.431.366ON7522291583e-10
KAFR0E034405.500ON15492921593e-10
CAGL0F02717g5.500ON15422361593e-10
Kpol_1035.328.42ON2801731533e-10
CAGL0C02343g3.534ON7202431574e-10
KNAG0C045005.500ON15552171584e-10
TPHA0D011708.661ON9152041584e-10
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0F00396g
         (732 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON...  1429   0.0  
TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5...   962   0.0  
CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} simila...   911   0.0  
Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W (...   904   0.0  
YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}  MDL2Mitocho...   900   0.0  
Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON} (1930...   900   0.0  
TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON...   896   0.0  
NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {O...   894   0.0  
NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5      892   0.0  
Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)   892   0.0  
Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON...   892   0.0  
TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa] ...   866   0.0  
SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON...   853   0.0  
KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5...   842   0.0  
KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} simila...   835   0.0  
Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON...   836   0.0  
KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON...   832   0.0  
Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON} s...   814   0.0  
ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic ho...   781   0.0  
KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa] ...   770   0.0  
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...   550   0.0  
Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa] ...   550   0.0  
TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa] ...   547   0.0  
NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {O...   547   0.0  
SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} simila...   539   0.0  
YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}  MDL1Mitoc...   538   0.0  
Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188...   536   0.0  
KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} simila...   531   e-179
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...   531   e-179
TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa] ...   530   e-179
Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188...   526   e-178
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...   518   e-175
Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188...   519   e-175
Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188...   519   e-175
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...   516   e-173
KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} simila...   515   e-173
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...   494   e-165
CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar ...   482   e-162
Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa] ...   223   3e-62
YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON} ...   218   9e-61
Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {...   216   3e-60
Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {...   215   1e-59
Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {...   214   2e-59
KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {...   213   1e-58
SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly...   212   2e-58
KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {...   211   6e-58
KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.2...   207   6e-57
KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {O...   206   4e-56
TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {...   205   5e-56
TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20 ...   204   1e-55
YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}  ...   205   1e-54
AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homo...   201   1e-54
Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {O...   201   2e-54
NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20     200   4e-54
CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa...   199   6e-54
NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1....   202   1e-53
Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}...   197   2e-53
ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} simila...   197   3e-53
NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {O...   195   3e-52
TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa] ...   195   3e-52
Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON...   197   4e-52
Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON} (46...   196   1e-51
NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1....   196   1e-51
TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON...   193   1e-50
KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON...   190   1e-49
TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_...   189   2e-49
AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic...   189   3e-49
KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON...   189   3e-49
TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {O...   187   9e-49
Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON...   186   2e-48
SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} simil...   184   7e-48
Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON...   179   4e-46
ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} simil...   176   3e-45
CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {...   176   5e-45
Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} simila...   176   5e-45
KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON} sim...   175   1e-44
KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {O...   173   4e-44
TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8....   170   4e-43
Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar ...   165   2e-41
Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON} YKL...   163   9e-41
NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] ...   162   1e-40
SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} sim...   161   3e-40
KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa]...   160   9e-40
Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {O...   159   2e-39
Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {O...   159   2e-39
KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4....   159   2e-39
Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {O...   157   9e-39
NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {...   156   1e-38
Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015...   155   4e-38
YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON} ...   155   4e-38
TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_...   154   4e-38
KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] ...   153   1e-37
TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {...   152   4e-37
YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}  V...   151   6e-37
KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa...   151   7e-37
CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} high...   150   1e-36
Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] ...   150   1e-36
Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON} Y...   150   2e-36
KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} hig...   149   3e-36
TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4....   149   3e-36
KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8....   148   5e-36
Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015...   147   1e-35
NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_...   147   1e-35
CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} simil...   146   2e-35
NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10    145   5e-35
ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highl...   144   8e-35
SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} sim...   143   2e-34
Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {...   143   2e-34
Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON} ...   143   2e-34
ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] ...   143   2e-34
YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}  ...   143   3e-34
CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] ...   142   4e-34
ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} sim...   142   5e-34
Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {O...   141   6e-34
Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015...   141   7e-34
Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar ...   141   8e-34
Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W...   140   9e-34
Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON...   141   9e-34
KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {O...   140   1e-33
AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic h...   140   2e-33
CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} simil...   140   2e-33
KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] ...   140   3e-33
KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {...   139   3e-33
KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_...   139   3e-33
TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4....   139   6e-33
Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..104...   139   6e-33
KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} sim...   138   7e-33
NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON...   138   8e-33
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...   136   3e-32
NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10    135   5e-32
NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {O...   135   5e-32
TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {...   134   1e-31
KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {O...   134   1e-31
Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON} Y...   134   1e-31
Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON...   134   2e-31
YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC ...   134   2e-31
CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {O...   133   2e-31
Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR28...   133   3e-31
TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.5...   133   3e-31
Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR28...   132   5e-31
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...   132   7e-31
KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] ...   132   9e-31
TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON...   129   4e-30
Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON...   129   5e-30
KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {O...   129   7e-30
YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Pla...   129   8e-30
TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4...   129   8e-30
KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {O...   128   9e-30
SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar...   128   1e-29
Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 156...   126   4e-29
Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]...   126   5e-29
YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative tr...   119   8e-29
Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR10...   125   1e-28
ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON} ...   124   3e-28
SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa...   123   4e-28
TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_...   122   1e-27
TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON...   121   1e-27
KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} sim...   121   1e-27
Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {O...   121   1e-27
Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa]...   120   4e-27
Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (R...   119   8e-27
KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] ...   117   3e-26
Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 a...   115   9e-26
TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_...   112   1e-24
TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON}           111   2e-24
AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic hom...   106   6e-23
TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa]...   106   8e-23
Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {...    94   6e-19
YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}  NFT1Puta...    86   3e-16
ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] ...    78   5e-14
KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON}              77   1e-13
Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON} comp...    76   2e-13
ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON} S...    75   3e-13
NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {...    75   3e-13
KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {...    74   6e-13
SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa...    74   7e-13
SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {...    74   8e-13
ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} high...    74   9e-13
SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} sim...    74   1e-12
ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} sim...    73   2e-12
Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {...    73   2e-12
TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {...    73   2e-12
Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {O...    72   2e-12
Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W...    73   2e-12
Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR07...    72   3e-12
NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {O...    72   4e-12
ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} sim...    72   4e-12
YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}  PDR18Put...    72   4e-12
KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3....    72   6e-12
Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar t...    71   7e-12
KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON}            71   7e-12
KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {O...    71   7e-12
KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_...    71   8e-12
Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147...    71   8e-12
CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] ...    71   8e-12
KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {O...    70   8e-12
KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.42...    70   9e-12
KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {O...    70   1e-11
ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} simil...    70   1e-11
Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR0...    70   1e-11
ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} simil...    70   1e-11
NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {...    70   2e-11
KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.6...    70   2e-11
YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subun...    70   2e-11
TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON} Anc_...    70   2e-11
TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]...    70   2e-11
KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] ...    70   2e-11
ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON} ...    70   2e-11
KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] ...    70   2e-11
TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON}              70   2e-11
KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {...    69   3e-11
TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON}            69   4e-11
Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON...    69   4e-11
TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {O...    68   4e-11
TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {...    68   5e-11
AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON} S...    68   6e-11
CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} hig...    68   6e-11
ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {...    67   6e-11
TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3....    68   7e-11
NCAS0A12060 Chr1 (2388467..2393098) [4632 bp, 1543 aa] {ON} Anc_...    68   7e-11
KNAG0B03870 Chr2 complement(741637..746178) [4542 bp, 1513 aa] {...    68   7e-11
AEL032W Chr5 (572196..574457) [2262 bp, 753 aa] {ON} Syntenic ho...    67   8e-11
Skud_16.135 Chr16 (244860..247472) [2613 bp, 870 aa] {ON} YPL147...    67   8e-11
KAFR0E03460 Chr5 complement(695361..700001) [4641 bp, 1546 aa] {...    68   8e-11
KNAG0K00950 Chr11 complement(186381..190235) [3855 bp, 1284 aa] ...    67   9e-11
Kwal_34.16240 s34 (257762..260020) [2259 bp, 752 aa] {ON} YFR009...    67   9e-11
Smik_4.244 Chr4 (445916..450421) [4506 bp, 1501 aa] {ON} YDR011W...    67   9e-11
Smik_14.399 Chr14 (709641..713906) [4266 bp, 1421 aa] {ON} YNR07...    67   9e-11
Ecym_1194 Chr1 (393697..395526) [1830 bp, 609 aa] {ON} similar t...    67   9e-11
ZYRO0B05588g Chr2 (440556..444368) [3813 bp, 1270 aa] {ON} simil...    67   1e-10
YDR011W Chr4 (465919..470424) [4506 bp, 1501 aa] {ON}  SNQ2Plasm...    67   1e-10
KLTH0H13442g Chr8 complement(1175860..1178118) [2259 bp, 752 aa]...    67   1e-10
Suva_15.91 Chr15 complement(162469..166377) [3909 bp, 1302 aa] {...    67   1e-10
SAKL0H06908g Chr8 (605838..608348) [2511 bp, 836 aa] {ON} simila...    67   1e-10
ZYRO0G01144g Chr7 (89341..91599) [2259 bp, 752 aa] {ON} highly s...    67   1e-10
Smik_7.313 Chr7 (524077..526335) [2259 bp, 752 aa] {ON} YFR009W ...    67   1e-10
NDAI0G05020 Chr7 (1217458..1220751) [3294 bp, 1097 aa] {ON} Anc_...    67   1e-10
KLLA0D03432g Chr4 (287805..292256) [4452 bp, 1483 aa] {ON} simil...    67   2e-10
YFR009W Chr6 (162488..164746) [2259 bp, 752 aa] {ON}  GCN20Posit...    66   2e-10
Smik_17.26 Chr17 complement(23946..28454) [4509 bp, 1502 aa] {ON...    67   2e-10
NDAI0E01240 Chr5 (244737..247430) [2694 bp, 897 aa] {ON} Anc_8.661     65   3e-10
NCAS0A08570 Chr1 (1693304..1696486) [3183 bp, 1060 aa] {ON} Anc_...    65   3e-10
SAKL0F01606g Chr6 (133318..135144) [1827 bp, 608 aa] {ON} highly...    65   3e-10
Kpol_1043.43 s1043 complement(86642..88900) [2259 bp, 752 aa] {O...    65   3e-10
KAFR0E03440 Chr5 complement(684043..688692) [4650 bp, 1549 aa] {...    66   3e-10
CAGL0F02717g Chr6 (261361..265989) [4629 bp, 1542 aa] {ON}             66   3e-10
Kpol_1035.32 s1035 (76084..76926) [843 bp, 280 aa] {ON} (76084.....    64   3e-10
CAGL0C02343g Chr3 (236112..236391,236790..238672) [2163 bp, 720 ...    65   4e-10
KNAG0C04500 Chr3 complement(882896..887563) [4668 bp, 1555 aa] {...    65   4e-10
TPHA0D01170 Chr4 complement(245675..248422) [2748 bp, 915 aa] {O...    65   4e-10
KLLA0A10857g Chr1 complement(941784..944042) [2259 bp, 752 aa] {...    65   4e-10
KAFR0F01460 Chr6 (284981..288154) [3174 bp, 1057 aa] {ON} Anc_1....    65   4e-10
KLLA0D04554g Chr4 complement(385733..388801) [3069 bp, 1022 aa] ...    65   4e-10
Kwal_47.19116 s47 complement(1101559..1103382) [1824 bp, 607 aa]...    65   4e-10
YOR153W Chr15 (619840..624375) [4536 bp, 1511 aa] {ON}  PDR5Plas...    65   5e-10
Smik_15.333 Chr15 (575791..580323) [4533 bp, 1510 aa] {ON} YOR15...    65   5e-10
NCAS0E00480 Chr5 (81549..83381) [1833 bp, 610 aa] {ON}                 65   5e-10
TDEL0A03640 Chr1 (646252..650781) [4530 bp, 1509 aa] {ON} Anc_5....    65   5e-10
ZYRO0F07018g Chr6 complement(571276..573861) [2586 bp, 861 aa] {...    65   6e-10
Ecym_8014 Chr8 (37756..42309) [4554 bp, 1517 aa] {ON} similar to...    65   6e-10
NDAI0A04200 Chr1 complement(948224..952879) [4656 bp, 1551 aa] {...    65   6e-10
KNAG0A02100 Chr1 complement(177773..182290) [4518 bp, 1505 aa] {...    65   7e-10
TBLA0H03470 Chr8 (847762..852312) [4551 bp, 1516 aa] {ON} Anc_8....    65   7e-10
NDAI0G01850 Chr7 complement(409416..413918) [4503 bp, 1500 aa] {...    65   7e-10
ZYRO0D17710g Chr4 complement(1466189..1470649) [4461 bp, 1486 aa...    65   7e-10
Kpol_1036.28 s1036 (70446..70928,73046..77023) [4461 bp, 1486 aa...    65   7e-10
NCAS0F00410 Chr6 (70678..75273) [4596 bp, 1531 aa] {ON}                65   7e-10
KAFR0E03480 Chr5 complement(701160..705818) [4659 bp, 1552 aa] {...    65   7e-10
Suva_6.84 Chr6 complement(145289..147547) [2259 bp, 752 aa] {ON}...    64   8e-10
CAGL0M01760g Chr13 (203616..208115) [4500 bp, 1499 aa] {ON} high...    64   9e-10
Suva_7.3 Chr7 complement(6379..10671) [4293 bp, 1430 aa] {ON} YN...    64   9e-10
KLLA0D03476g Chr4 (296287..300969) [4683 bp, 1560 aa] {ON} simil...    64   1e-09
AGL142C Chr7 complement(434247..438740) [4494 bp, 1497 aa] {ON} ...    64   1e-09
YOL075C Chr15 complement(189658..193542) [3885 bp, 1294 aa] {ON}...    64   1e-09
Skud_4.680 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    64   1e-09
Skud_4.681 Chr4 (1201243..1205580) [4338 bp, 1445 aa] {ON} YDR40...    64   1e-09
Kwal_27.9666 s27 complement(9636..14060) [4425 bp, 1474 aa] {ON}...    64   1e-09
NCAS0E01640 Chr5 complement(313479..317987) [4509 bp, 1502 aa] {...    64   1e-09
NCAS0E01650 Chr5 complement(319448..323914) [4467 bp, 1488 aa] {...    64   1e-09
TBLA0I03330 Chr9 complement(806242..808074) [1833 bp, 610 aa] {O...    64   1e-09
Ecym_2714 Chr2 (1380718..1382964) [2247 bp, 748 aa] {ON} similar...    64   1e-09
KLLA0F11484g Chr6 (1052991..1055528) [2538 bp, 845 aa] {ON} simi...    64   1e-09
YDR406W Chr4 (1279210..1283799) [4590 bp, 1529 aa] {ON}  PDR15Pl...    64   2e-09
YER036C Chr5 complement(223367..225199) [1833 bp, 610 aa] {ON}  ...    63   2e-09
TPHA0A02310 Chr1 (483447..485705) [2259 bp, 752 aa] {ON} Anc_1.3...    63   2e-09
Kwal_0.327 s0 complement(154643..157702) [3060 bp, 1019 aa] {ON}...    63   2e-09
TDEL0D06020 Chr4 complement(1087102..1088934) [1833 bp, 610 aa] ...    63   2e-09
TBLA0A02440 Chr1 complement(582029..586894) [4866 bp, 1621 aa] {...    63   2e-09
Skud_6.95 Chr6 complement(175462..177720) [2259 bp, 752 aa] {ON}...    63   2e-09
KLTH0G01452g Chr7 (105741..107564) [1824 bp, 607 aa] {ON} highly...    62   2e-09
Suva_5.134 Chr5 complement(199609..201441) [1833 bp, 610 aa] {ON...    62   2e-09
Smik_15.84 Chr15 complement(153969..157856) [3888 bp, 1295 aa] {...    63   2e-09
TDEL0A06070 Chr1 complement(1064071..1066689) [2619 bp, 872 aa] ...    63   3e-09
NDAI0I03020 Chr9 complement(713821..715650) [1830 bp, 609 aa] {O...    62   3e-09
TPHA0A04220 Chr1 complement(948357..952811) [4455 bp, 1484 aa] {...    62   3e-09
KAFR0C01200 Chr3 (240350..244171) [3822 bp, 1273 aa] {ON} Anc_3....    62   3e-09
Suva_8.204 Chr8 (368920..373455) [4536 bp, 1511 aa] {ON} YOR153W...    62   4e-09
TPHA0A00840 Chr1 complement(163812..167750) [3939 bp, 1312 aa] {...    62   4e-09
Smik_5.159 Chr5 complement(228179..230011) [1833 bp, 610 aa] {ON...    62   4e-09
TDEL0B01210 Chr2 complement(219068..223606) [4539 bp, 1512 aa] {...    62   4e-09
SAKL0C08074g Chr3 complement(747926..751699) [3774 bp, 1257 aa] ...    62   4e-09
Suva_2.583 Chr2 (1030711..1035324) [4614 bp, 1537 aa] {ON} YDR40...    62   4e-09
Skud_5.145 Chr5 complement(221173..223005) [1833 bp, 610 aa] {ON...    62   4e-09
NCAS0H02420 Chr8 (477754..482316) [4563 bp, 1520 aa] {ON} Anc_5....    62   5e-09
Kpol_1053.48 s1053 complement(92949..93236,93239..96817) [3867 b...    62   5e-09
TPHA0L01500 Chr12 (311715..316274) [4560 bp, 1519 aa] {ON} Anc_8...    62   5e-09
SAKL0C11704g Chr3 (1050447..1054979) [4533 bp, 1510 aa] {ON} sim...    62   5e-09
TPHA0M00640 Chr13 complement(117604..122076) [4473 bp, 1490 aa] ...    62   5e-09
Skud_15.317 Chr15 (568579..573117) [4539 bp, 1512 aa] {ON} YOR15...    62   5e-09
KAFR0J02700 Chr10 complement(515978..517804) [1827 bp, 608 aa] {...    61   5e-09
NCAS0B01530 Chr2 complement(249743..252349) [2607 bp, 868 aa] {O...    62   6e-09
TPHA0A05890 Chr1 complement(1334117..1335949) [1833 bp, 610 aa] ...    61   6e-09
Kpol_1037.47 s1037 (114295..118818) [4524 bp, 1507 aa] {ON} (114...    62   6e-09
Smik_3.97 Chr3 complement(133624..136773) [3150 bp, 1049 aa] {ON...    61   7e-09
TBLA0I01760 Chr9 (392252..397147) [4896 bp, 1631 aa] {ON} Anc_3....    61   9e-09
ABR126W Chr2 (628624..633162) [4539 bp, 1512 aa] {ON} Non-synten...    61   9e-09
NDAI0B02870 Chr2 complement(726822..730625) [3804 bp, 1267 aa] {...    61   1e-08
Smik_4.678 Chr4 (1200036..1204637) [4602 bp, 1533 aa] {ON} YDR40...    61   1e-08
KLTH0H12760g Chr8 complement(1083450..1086512) [3063 bp, 1020 aa...    60   1e-08
NDAI0C01220 Chr3 (246762..251291) [4530 bp, 1509 aa] {ON} Anc_5....    60   1e-08
CAGL0L07744g Chr12 (851958..855125) [3168 bp, 1055 aa] {ON} simi...    60   1e-08
CAGL0M02387g Chr13 (280372..282942) [2571 bp, 856 aa] {ON} simil...    60   1e-08
SAKL0C06996g Chr3 complement(649424..654061) [4638 bp, 1545 aa] ...    60   1e-08
KAFR0A01180 Chr1 (225692..230218) [4527 bp, 1508 aa] {ON} Anc_8....    60   2e-08
NCAS0F00790 Chr6 complement(158502..162704) [4203 bp, 1400 aa] {...    60   2e-08
TPHA0O01000 Chr15 (185595..188630) [3036 bp, 1011 aa] {ON} Anc_1...    60   2e-08
YOR328W Chr15 (931803..936497) [4695 bp, 1564 aa] {ON}  PDR10ATP...    60   2e-08
YPL058C Chr16 complement(445842..450377) [4536 bp, 1511 aa] {ON}...    60   2e-08
KLLA0A01452g Chr1 (130078..131901) [1824 bp, 607 aa] {ON} highly...    59   2e-08
CAGL0M07293g Chr13 complement(733072..737619) [4548 bp, 1515 aa]...    60   3e-08
KLTH0E15796g Chr5 (1400194..1403937) [3744 bp, 1247 aa] {ON} sim...    59   3e-08
CAGL0F01419g Chr6 complement(142623..146819) [4197 bp, 1398 aa] ...    59   3e-08
Kpol_1050.26 s1050 complement(62452..64284) [1833 bp, 610 aa] {O...    59   3e-08
Smik_16.179 Chr16 complement(321239..325774) [4536 bp, 1511 aa] ...    59   3e-08
Kpol_1049.23 s1049 complement(67726..68058) [333 bp, 110 aa] {ON...    54   3e-08
SAKL0D09394g Chr4 complement(780019..783102) [3084 bp, 1027 aa] ...    59   3e-08
Kpol_1012.10 s1012 complement(20013..20741,21318..21326,21750..2...    59   4e-08
KLLA0F21692g Chr6 complement(2014152..2018729) [4578 bp, 1525 aa...    59   4e-08
YCR011C Chr3 complement(133724..136873) [3150 bp, 1049 aa] {ON} ...    59   4e-08
KNAG0L00680 Chr12 complement(105318..109460) [4143 bp, 1380 aa] ...    59   4e-08
Smik_15.508 Chr15 (881347..886047) [4701 bp, 1566 aa] {ON} YOR32...    59   4e-08
Kpol_1050.16 s1050 complement(38346..41489) [3144 bp, 1047 aa] {...    59   5e-08
KNAG0G01040 Chr7 (221426..225631) [4206 bp, 1401 aa] {ON}  YIL013C     59   5e-08
Suva_8.379 Chr8 (672487..677184) [4698 bp, 1565 aa] {ON} YPL058C...    59   6e-08
NCAS0D00580 Chr4 (96350..98611) [2262 bp, 753 aa] {ON} Anc_1.366       58   6e-08
NCAS0C03820 Chr3 complement(774039..774923) [885 bp, 294 aa] {ON...    57   6e-08
NDAI0E02950 Chr5 complement(620841..625379) [4539 bp, 1512 aa] {...    58   6e-08
KLLA0B09702g Chr2 complement(842245..846801) [4557 bp, 1518 aa] ...    58   7e-08
Ecym_3605 Chr3 (1148339..1152817) [4479 bp, 1492 aa] {ON} simila...    58   8e-08
KLTH0G19448g Chr7 (1676895..1681355) [4461 bp, 1486 aa] {ON} sim...    58   9e-08
Ecym_1500 Chr1 (1027467..1028318) [852 bp, 283 aa] {ON} similar ...    56   9e-08
KAFR0C02740 Chr3 complement(537867..539465) [1599 bp, 532 aa] {O...    57   9e-08
Skud_16.225 Chr16 complement(410106..414641) [4536 bp, 1511 aa] ...    58   9e-08
NCAS0B05300 Chr2 (980856..984677) [3822 bp, 1273 aa] {ON} Anc_3....    58   9e-08
Ecym_2737 Chr2 (1425670..1428726) [3057 bp, 1018 aa] {ON} simila...    57   1e-07
TBLA0C01780 Chr3 complement(421045..423711) [2667 bp, 888 aa] {O...    57   1e-07
Skud_15.495 Chr15 (871539..876233) [4695 bp, 1564 aa] {ON} YOR32...    57   1e-07
Kpol_513.9 s513 (23141..27682) [4542 bp, 1513 aa] {ON} (23141..2...    57   1e-07
SAKL0G08008g Chr7 complement(673391..678040) [4650 bp, 1549 aa] ...    57   1e-07
KLLA0C04477g Chr3 complement(409543..413304) [3762 bp, 1253 aa] ...    57   1e-07
AER190W Chr5 (994534..997569) [3036 bp, 1011 aa] {ON} Syntenic h...    57   1e-07
NDAI0H01280 Chr8 complement(308593..312771) [4179 bp, 1392 aa] {...    57   2e-07
NCAS0C02250 Chr3 complement(418244..422770) [4527 bp, 1508 aa] {...    57   2e-07
SAKL0H10670g Chr8 complement(918091..922620) [4530 bp, 1509 aa] ...    57   2e-07
SAKL0C05654g Chr3 complement(532258..536787) [4530 bp, 1509 aa] ...    56   3e-07
YIL013C Chr9 complement(328207..332442) [4236 bp, 1411 aa] {ON} ...    56   3e-07
CAGL0K12474g Chr11 (1218012..1218896) [885 bp, 294 aa] {ON} simi...    55   3e-07
Suva_16.256 Chr16 complement(448846..453387) [4542 bp, 1513 aa] ...    56   3e-07
Smik_9.181 Chr9 complement(302896..307125) [4230 bp, 1409 aa] {O...    56   3e-07
TBLA0A08720 Chr1 complement(2139184..2140668) [1485 bp, 494 aa] ...    55   3e-07
Smik_15.185 Chr15 (316883..321064) [4182 bp, 1393 aa] {ON} YNR07...    56   3e-07
Suva_3.37 Chr3 complement(47453..50614) [3162 bp, 1053 aa] {ON} ...    56   4e-07
ZYRO0F08866g Chr6 (709888..714450) [4563 bp, 1520 aa] {ON} highl...    56   4e-07
Kwal_27.12711 s27 (1342807..1346547) [3741 bp, 1246 aa] {ON} YOL...    56   4e-07
KAFR0C03470 Chr3 (707203..708039) [837 bp, 278 aa] {ON} Anc_8.42...    54   4e-07
KNAG0B00460 Chr2 (76565..78547) [1983 bp, 660 aa] {ON} Anc_3.534...    55   4e-07
YFL028C Chr6 complement(79344..80213) [870 bp, 289 aa] {ON}  CAF...    54   4e-07
Kwal_14.1242 s14 (250275..251084) [810 bp, 269 aa] {ON} YFL028C ...    54   5e-07
TBLA0D02530 Chr4 complement(629614..630444) [831 bp, 276 aa] {ON...    54   5e-07
Suva_9.192 Chr9 complement(316679..320920) [4242 bp, 1413 aa] {O...    55   8e-07
TPHA0H00120 Chr8 complement(11464..13092) [1629 bp, 542 aa] {ON}...    54   9e-07
KLTH0H07942g Chr8 complement(696683..698269) [1587 bp, 528 aa] {...    54   9e-07
CAGL0I08019g Chr9 complement(783133..786990) [3858 bp, 1285 aa] ...    54   1e-06
Skud_3.76 Chr3 complement(116029..119199) [3171 bp, 1056 aa] {ON...    54   1e-06
Skud_15.174 Chr15 (310212..314393) [4182 bp, 1393 aa] {ON} YALI0...    54   1e-06
TBLA0F01040 Chr6 (252002..255817) [3816 bp, 1271 aa] {ON} Anc_3....    54   1e-06
Suva_6.30 Chr6 complement(52879..53748) [870 bp, 289 aa] {ON} YF...    53   1e-06
Smik_6.50 Chr6 complement(94583..95452) [870 bp, 289 aa] {ON} YF...    53   1e-06
SAKL0B01518g Chr2 complement(148745..149542) [798 bp, 265 aa] {O...    52   1e-06
TDEL0D02370 Chr4 (460691..462952) [2262 bp, 753 aa] {ON} Anc_1.3...    54   2e-06
TDEL0B04340 Chr2 complement(764357..766018) [1662 bp, 553 aa] {O...    53   2e-06
ZYRO0F08888g Chr6 (716318..720880) [4563 bp, 1520 aa] {ON} highl...    54   2e-06
Suva_2.220 Chr2 (374470..376092) [1623 bp, 540 aa] {ON} YDR061W ...    53   2e-06
TDEL0C00680 Chr3 complement(110674..111519) [846 bp, 281 aa] {ON...    52   2e-06
Skud_6.42 Chr6 complement(82602..83471) [870 bp, 289 aa] {ON} YF...    52   2e-06
NCAS0A08760 Chr1 complement(1729600..1732737) [3138 bp, 1045 aa]...    53   2e-06
Skud_15.78 Chr15 complement(148836..152720) [3885 bp, 1294 aa] {...    53   3e-06
SAKL0H19294g Chr8 complement(1703651..1705213) [1563 bp, 520 aa]...    52   3e-06
NDAI0G03160 Chr7 complement(744284..745141) [858 bp, 285 aa] {ON...    51   3e-06
Skud_9.159 Chr9 complement(298165..302388) [4224 bp, 1407 aa] {O...    52   6e-06
YOR011W Chr15 (349679..353863) [4185 bp, 1394 aa] {ON}  AUS1Plas...    52   6e-06
YDR061W Chr4 (574164..575783) [1620 bp, 539 aa] {ON} Protein wit...    51   6e-06
KNAG0I01340 Chr9 complement(258887..262024) [3138 bp, 1045 aa] {...    51   1e-05
Suva_15.188 Chr15 (324904..329088) [4185 bp, 1394 aa] {ON} YOR01...    51   1e-05
NCAS0B04350 Chr2 complement(786960..788561) [1602 bp, 533 aa] {O...    50   1e-05
Kpol_1002.105 s1002 complement(266533..268176) [1644 bp, 547 aa]...    50   1e-05
TPHA0D00450 Chr4 complement(76541..77377) [837 bp, 278 aa] {ON} ...    49   2e-05
TDEL0E00840 Chr5 complement(172712..175192) [2481 bp, 826 aa] {O...    50   2e-05
Kpol_487.13 s487 complement(50878..54012) [3135 bp, 1044 aa] {ON...    50   2e-05
NDAI0A03750 Chr1 complement(849511..851118) [1608 bp, 535 aa] {O...    50   2e-05
Suva_10.346 Chr10 (604006..607140) [3135 bp, 1044 aa] {ON} YLR24...    49   3e-05
KNAG0D02010 Chr4 complement(335815..337413) [1599 bp, 532 aa] {O...    49   3e-05
Kwal_33.15623 s33 (1193685..1195373) [1689 bp, 562 aa] {ON} YFR0...    49   3e-05
YNL014W Chr14 (606319..609453) [3135 bp, 1044 aa] {ON}  HEF3Tran...    49   4e-05
CAGL0G05093g Chr7 complement(483230..484864) [1635 bp, 544 aa] {...    49   5e-05
Skud_14.314 Chr14 (573040..576174) [3135 bp, 1044 aa] {ON} YNL01...    49   5e-05
KAFR0I02110 Chr9 (433759..436896) [3138 bp, 1045 aa] {ON} Anc_1....    49   6e-05
ZYRO0F03234g Chr6 complement(273742..274569) [828 bp, 275 aa] {O...    47   7e-05
ZYRO0E05148g Chr5 complement(387268..390405) [3138 bp, 1045 aa] ...    48   7e-05
Skud_4.316 Chr4 (550218..551840) [1623 bp, 540 aa] {ON} YDR061W ...    48   9e-05
YLR249W Chr12 (636780..639914) [3135 bp, 1044 aa] {ON}  YEF3Gamm...    47   1e-04
NDAI0G05180 Chr7 complement(1254531..1257665) [3135 bp, 1044 aa]...    47   1e-04
Skud_12.330 Chr12 (583354..586488) [3135 bp, 1044 aa] {ON} YLR24...    47   2e-04
Smik_12.322 Chr12 (581596..584730) [3135 bp, 1044 aa] {ON} YLR24...    47   2e-04
KNAG0F01740 Chr6 (326444..329950) [3507 bp, 1168 aa] {ON} Anc_6....    47   2e-04
TDEL0B06150 Chr2 complement(1083103..1086237) [3135 bp, 1044 aa]...    47   2e-04
KNAG0E03270 Chr5 complement(655376..656218) [843 bp, 280 aa] {ON...    45   3e-04
Kwal_26.6702 s26 complement(29426..31279) [1854 bp, 617 aa] {ON}...    46   3e-04
SAKL0D08316g Chr4 (695101..698235) [3135 bp, 1044 aa] {ON} highl...    46   3e-04
ZYRO0E07634g Chr5 complement(593495..597025) [3531 bp, 1176 aa] ...    46   3e-04
KAFR0H03200 Chr8 complement(610545..613694) [3150 bp, 1049 aa] {...    46   3e-04
Kwal_YGOB_56.24219 s56 complement(908618..909109,909112..912147)...    46   3e-04
Suva_14.333 Chr14 (585838..588972) [3135 bp, 1044 aa] {ON} YNL01...    46   3e-04
TPHA0O00680 Chr15 (128579..131713) [3135 bp, 1044 aa] {ON} Anc_1...    46   4e-04
AAL028W Chr1 (291808..294942) [3135 bp, 1044 aa] {ON} Syntenic h...    46   4e-04
KLLA0F12210g Chr6 (1125630..1128764) [3135 bp, 1044 aa] {ON} hig...    46   4e-04
TBLA0D04410 Chr4 complement(1093035..1096169) [3135 bp, 1044 aa]...    46   4e-04
Suva_16.80 Chr16 (131166..134702) [3537 bp, 1178 aa] {ON} YPL226...    46   5e-04
NDAI0I00960 Chr9 complement(226758..230396) [3639 bp, 1212 aa] {...    46   5e-04
KLTH0H03300g Chr8 (295271..298801) [3531 bp, 1176 aa] {ON} simil...    46   5e-04
Smik_6.431 Chr6 complement(699005..702574) [3570 bp, 1189 aa] {O...    45   5e-04
Kwal_0.167 s0 (88989..92123) [3135 bp, 1044 aa] {ON} YNL014W (HE...    45   5e-04
YPL226W Chr16 (121767..125357) [3591 bp, 1196 aa] {ON}  NEW1ATP ...    45   5e-04
Skud_16.52 Chr16 (95317..98853) [3537 bp, 1178 aa] {ON} YPL226W ...    45   5e-04
Ecym_3232 Chr3 complement(431386..433830) [2445 bp, 814 aa] {ON}...    45   5e-04
TPHA0H01820 Chr8 complement(415382..418765) [3384 bp, 1127 aa] {...    45   6e-04
ZYRO0B13266g Chr2 (1074171..1076639) [2469 bp, 822 aa] {ON} simi...    45   6e-04
TBLA0A05970 Chr1 (1471379..1474975) [3597 bp, 1198 aa] {ON} Anc_...    45   7e-04
KLTH0H11902g Chr8 (1017096..1020230) [3135 bp, 1044 aa] {ON} hig...    45   8e-04
AER091W Chr5 (809767..812172) [2406 bp, 801 aa] {ON} Syntenic ho...    45   8e-04
CAGL0G08041g Chr7 complement(758811..760634) [1824 bp, 607 aa] {...    45   9e-04
KAFR0A07090 Chr1 complement(1427525..1431157) [3633 bp, 1210 aa]...    45   9e-04
CAGL0D00352g Chr4 complement(42946..45531) [2586 bp, 861 aa] {ON...    45   0.001
Ecym_1312 Chr1 complement(630006..633140) [3135 bp, 1044 aa] {ON...    45   0.001
Ecym_5557 Chr5 (1126965..1128539) [1575 bp, 524 aa] {ON} similar...    44   0.001
KLTH0G18326g Chr7 complement(1579374..1580183) [810 bp, 269 aa] ...    44   0.001
CAGL0D03674g Chr4 (370066..373626) [3561 bp, 1186 aa] {ON} highl...    44   0.001
CAGL0B03487g Chr2 complement(345399..348536) [3138 bp, 1045 aa] ...    44   0.001
SAKL0A03586g Chr1 (328346..331885) [3540 bp, 1179 aa] {ON} simil...    44   0.001
Kwal_56.23429 s56 complement(532382..533998) [1617 bp, 539 aa] {...    44   0.001
AFL131W Chr6 (186656..190225) [3570 bp, 1189 aa] {ON} Syntenic h...    44   0.001
Kpol_1048.72 s1048 complement(202581..205715) [3135 bp, 1044 aa]...    44   0.002
KLLA0C16115g Chr3 (1405766..1409317) [3552 bp, 1183 aa] {ON} sim...    44   0.002
NCAS0D03950 Chr4 (737216..740788) [3573 bp, 1190 aa] {ON} Anc_6....    44   0.002
Smik_4.299 Chr4 (540966..542588) [1623 bp, 540 aa] {ON} YDR061W ...    44   0.002
Kpol_1002.29 s1002 (89520..93068) [3549 bp, 1182 aa] {ON} (89520...    44   0.002
TBLA0G02050 Chr7 complement(537114..540098) [2985 bp, 994 aa] {O...    44   0.002
Smik_14.315 Chr14 (564639..567773) [3135 bp, 1044 aa] {ON} YNL01...    44   0.002
Kwal_YGOB_56.23429 s56 complement(532059..532313,532316..533998)...    44   0.002
KLLA0B02563g Chr2 complement(222951..225377) [2427 bp, 808 aa] {...    44   0.002
KLTH0D15246g Chr4 (1257193..1259589) [2397 bp, 798 aa] {ON} simi...    44   0.002
ZYRO0G09130g Chr7 (732487..734034) [1548 bp, 515 aa] {ON} simila...    43   0.002
Ecym_2164 Chr2 (314802..318317) [3516 bp, 1171 aa] {ON} similar ...    43   0.003
TDEL0F01870 Chr6 (348408..351950) [3543 bp, 1180 aa] {ON} Anc_6....    43   0.003
KAFR0G03410 Chr7 (702624..705056) [2433 bp, 810 aa] {ON} Anc_4.2...    43   0.003
Kwal_56.24221 s56 complement(908983..912147) [3165 bp, 1054 aa] ...    43   0.003
Kwal_23.4045 s23 complement(543590..545875) [2286 bp, 761 aa] {O...    43   0.003
YDR091C Chr4 complement(626708..628534) [1827 bp, 608 aa] {ON}  ...    43   0.003
TPHA0B01940 Chr2 (434881..437436) [2556 bp, 851 aa] {ON} Anc_4.2...    43   0.004
NCAS0A02680 Chr1 (510902..513559) [2658 bp, 885 aa] {ON} Anc_4.287     43   0.004
AFR152C Chr6 complement(710014..710826) [813 bp, 270 aa] {ON} Sy...    42   0.004
AGR125W Chr7 (987077..988900) [1824 bp, 607 aa] {ON} Syntenic ho...    42   0.004
SAKL0G16280g Chr7 (1408229..1410607) [2379 bp, 792 aa] {ON} simi...    42   0.005
KLLA0C17556g Chr3 complement(1544404..1546227) [1824 bp, 607 aa]...    42   0.005
KLTH0G14520g Chr7 (1276585..1278411) [1827 bp, 608 aa] {ON} high...    42   0.005
KLLA0F08833g Chr6 (822039..822860) [822 bp, 273 aa] {ON} similar...    41   0.006
Smik_4.334 Chr4 complement(592554..594380) [1827 bp, 608 aa] {ON...    42   0.006
NDAI0G00810 Chr7 (169366..172515) [3150 bp, 1049 aa] {ON} Anc_1....    42   0.008
YKL188C Chr11 complement(86225..88786) [2562 bp, 853 aa] {ON}  P...    42   0.008
Kwal_14.2052 s14 complement(589149..590720) [1572 bp, 523 aa] {O...    41   0.009
KNAG0D04550 Chr4 (824870..827338) [2469 bp, 822 aa] {ON} Anc_4.2...    41   0.010
Suva_51.1 Chr51 (3..968) [966 bp, 322 aa] {ON} YDR011W (REAL)          40   0.011
Skud_11.38 Chr11 complement(72504..75071) [2568 bp, 855 aa] {ON}...    41   0.011
Skud_4.351 Chr4 complement(602770..604596) [1827 bp, 608 aa] {ON...    41   0.013
Kpol_1055.54 s1055 complement(131851..134565) [2715 bp, 904 aa] ...    41   0.013
NCAS0A06310 Chr1 complement(1243683..1246823) [3141 bp, 1046 aa]...    41   0.014
KAFR0A02430 Chr1 (508632..510455) [1824 bp, 607 aa] {ON} Anc_8.2...    40   0.016
NDAI0D04610 Chr4 (1084921..1087599) [2679 bp, 892 aa] {ON} Anc_4...    40   0.018
Ecym_1222 Chr1 complement(458018..462082) [4065 bp, 1354 aa] {ON...    40   0.019
Suva_11.36 Chr11 complement(70977..73538) [2562 bp, 853 aa] {ON}...    40   0.020
Smik_11.42 Chr11 complement(71610..74165) [2556 bp, 851 aa] {ON}...    40   0.021
TDEL0A01370 Chr1 (248469..250292) [1824 bp, 607 aa] {ON} Anc_8.2...    40   0.021
KNAG0H02970 Chr8 complement(548970..550802) [1833 bp, 610 aa] {O...    39   0.051
Suva_2.252 Chr2 complement(426492..428318) [1827 bp, 608 aa] {ON...    39   0.063
KLLA0D02156g Chr4 complement(184520..186085) [1566 bp, 521 aa] {...    38   0.074
TBLA0F03760 Chr6 complement(924333..926159) [1827 bp, 608 aa] {O...    38   0.084
ZYRO0B11616g Chr2 complement(910480..912303) [1824 bp, 607 aa] {...    37   0.15 
KAFR0G03010 Chr7 (623976..628094) [4119 bp, 1372 aa] {ON}  YIL013C     37   0.18 
SAKL0H17996g Chr8 (1607260..1609323) [2064 bp, 687 aa] {ON} high...    37   0.23 
CAGL0G08712g Chr7 complement(824549..827584) [3036 bp, 1011 aa] ...    36   0.38 
Ecym_5560 Chr5 complement(1134384..1136207) [1824 bp, 607 aa] {O...    36   0.46 
TBLA0C02340 Chr3 complement(554335..557685) [3351 bp, 1116 aa] {...    35   0.61 
Smik_5.82 Chr5 (117408..121802) [4395 bp, 1464 aa] {ON} YEL022W ...    35   0.61 
Smik_5.344 Chr5 complement(529147..535632) [6486 bp, 2161 aa] {O...    35   0.62 
NCAS0B04030 Chr2 (730062..731888) [1827 bp, 608 aa] {ON} Anc_8.2...    35   0.62 
TPHA0A01980 Chr1 (400671..402494) [1824 bp, 607 aa] {ON} Anc_8.2...    34   1.2  
Kpol_1032.48 s1032 complement(108249..110072) [1824 bp, 607 aa] ...    34   1.5  
TBLA0A01150 Chr1 (262829..266992) [4164 bp, 1387 aa] {ON}              34   1.8  
NCAS0B02520 Chr2 (422176..422730) [555 bp, 184 aa] {ON} Anc_8.47...    33   2.2  
TDEL0A01260 Chr1 (211170..217724) [6555 bp, 2184 aa] {ON} Anc_8....    33   2.4  
NCAS0I00670 Chr9 (111140..115240) [4101 bp, 1366 aa] {ON}              33   2.9  
Kwal_27.12817 s27 (1386470..1389226) [2757 bp, 919 aa] {ON} YDR4...    33   3.5  
NCAS0C04460 Chr3 complement(914189..915700) [1512 bp, 503 aa] {O...    32   5.9  
SAKL0H01210g Chr8 complement(127235..133099) [5865 bp, 1954 aa] ...    32   6.6  

>ZYRO0F00396g Chr6 complement(39330..41528) [2199 bp, 732 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 732

 Score = 1429 bits (3699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 702/717 (97%), Positives = 702/717 (97%)

Query: 16  SKSQLRPLSYIRPLNIVRPQISLISIRIGVRWNSQLSPSQEENRPKPVKQILEPIQKKES 75
           SKSQLRPLSYIRPLNIVRPQISLISIRIGVRWNSQLSPSQEENRPKPVKQILEPIQKKES
Sbjct: 16  SKSQLRPLSYIRPLNIVRPQISLISIRIGVRWNSQLSPSQEENRPKPVKQILEPIQKKES 75

Query: 76  SYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVN 135
           SYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVN
Sbjct: 76  SYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVN 135

Query: 136 MDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQ 195
           MDDLGPIAFGLTIYQ               NFARIVMLRILSERVVARLRSGVMNKTLHQ
Sbjct: 136 MDDLGPIAFGLTIYQFLGVFAGLLLVGTAANFARIVMLRILSERVVARLRSGVMNKTLHQ 195

Query: 196 DSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVL 255
           DSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVL
Sbjct: 196 DSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVL 255

Query: 256 LFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYN 315
           LFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYN
Sbjct: 256 LFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYN 315

Query: 316 GAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYT 375
           GAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYT
Sbjct: 316 GAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYT 375

Query: 376 EYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFS 435
           EYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFS
Sbjct: 376 EYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFS 435

Query: 436 YPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISK 495
           YPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISK
Sbjct: 436 YPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISK 495

Query: 496 VNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDG 555
           VNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDG
Sbjct: 496 VNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDG 555

Query: 556 YDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKS 615
           YDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKS
Sbjct: 556 YDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKS 615

Query: 616 GSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDG 675
           GSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDG
Sbjct: 616 GSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDG 675

Query: 676 NDSLPPPPPNATQDKVVEQIAEKILERFPEAGQSPDATVKEIFKDVSSEGKPIKITP 732
           NDSLPPPPPNATQDKVVEQIAEKILERFPEAGQSPDATVKEIFKDVSSEGKPIKITP
Sbjct: 676 NDSLPPPPPNATQDKVVEQIAEKILERFPEAGQSPDATVKEIFKDVSSEGKPIKITP 732

>TDEL0G04660 Chr7 (850475..852694) [2220 bp, 739 aa] {ON} Anc_6.5
           YPL270W
          Length = 739

 Score =  962 bits (2486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 495/722 (68%), Positives = 586/722 (81%), Gaps = 30/722 (4%)

Query: 26  IRPLNIVRPQISLISIRIGVRWNSQLSP-SQ---EENRP-----KPVKQILEPIQKKE-- 74
           +R L IV+P     S+R  +    QLSP SQ   +  RP         ++L+    KE  
Sbjct: 32  VRRLPIVQP-----SVRSVISKRCQLSPLSQIQFQTTRPLTRSFTSSVRLLQAKSPKEAE 86

Query: 75  --SSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIE---GK 129
             S  KD VRL  LAK DW+LL  AI LLT+SC IGM+IPKVIG++LDVL+ G+E   GK
Sbjct: 87  QKSGLKDVVRLLMLAKPDWKLLVIAITLLTVSCGIGMTIPKVIGMILDVLKTGLETNEGK 146

Query: 130 DLQNVNMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVM 189
           D   ++M D+ PI  G +IY+               N+ RIV+LRILSERVVARLR+ V+
Sbjct: 147 D-GPISMADVPPIFMGYSIYEFLGGFAALMVFGIVANYGRIVLLRILSERVVARLRANVI 205

Query: 190 NKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISP 249
            KT+HQDSEF+D HKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVG+GMMVSISP
Sbjct: 206 KKTIHQDSEFFDRHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGVGMMVSISP 265

Query: 250 ELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQR 309
           +LSG+LL F PP+L+SAS+FG+KIR TS DLQEATGQLTRV+EEQLSGV+TVQSFVAEQ+
Sbjct: 266 QLSGLLLLFTPPVLFSASIFGRKIRDTSTDLQEATGQLTRVSEEQLSGVRTVQSFVAEQK 325

Query: 310 ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLT 369
           E+HRY+ AIR I+NVG++AA+INA+FFT+T+ LGD+SF+VVL YGSYLVLQG LTIGDLT
Sbjct: 326 EIHRYSHAIRDIFNVGKRAAYINAQFFTATSSLGDISFLVVLAYGSYLVLQGGLTIGDLT 385

Query: 370 AFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEF 429
           AFMLYTEYTGSSVFGLT+FYSELMQGVGAA+RLF+LTD + SI PT G+K++PGKG+I F
Sbjct: 386 AFMLYTEYTGSSVFGLTSFYSELMQGVGAATRLFELTDRVPSIKPTTGKKFVPGKGEIVF 445

Query: 430 KNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVD 489
           K+V+FSYPTRP N IF+D++IK+P GSNVC+VGPSGRGKSTIALLLLR+YNP++GQI +D
Sbjct: 446 KDVTFSYPTRPGNVIFRDMDIKIPAGSNVCVVGPSGRGKSTIALLLLRFYNPSSGQIFID 505

Query: 490 GQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFI 549
           GQDISK+N K+LRRHIGLVQQEP+LMSGT+RDNITYGL E  +KEEIR VAKQCFCHNFI
Sbjct: 506 GQDISKLNIKSLRRHIGLVQQEPVLMSGTLRDNITYGLTETPSKEEIRMVAKQCFCHNFI 565

Query: 550 TKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTF 609
            KFP GYDT+IG QGALLSGGQ+QRIAIARALIKKP ILVLDEATSALDVESEGAINYTF
Sbjct: 566 VKFPHGYDTVIGPQGALLSGGQKQRIAIARALIKKPTILVLDEATSALDVESEGAINYTF 625

Query: 610 GQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEK 669
           GQLMKS S+TIVSIAHRLSTI+RSEN+IVLG DGSV+E GKFKELFA+P+SEL KLL EK
Sbjct: 626 GQLMKSKSVTIVSIAHRLSTIRRSENIIVLGNDGSVVETGKFKELFADPSSELSKLLNEK 685

Query: 670 SSRSDGNDSLPPPPPNATQDKVVEQIAEKILERFPEAGQSPDATVKEIFKDVSSEGKPIK 729
           SSRS+ + S   P  +   +    Q      +  PE  ++ D +V+EI KDV++EGKPIK
Sbjct: 686 SSRSENSSSSYSPNASEQPEDEANQ------KNAPE--EAHDDSVEEILKDVTAEGKPIK 737

Query: 730 IT 731
           I+
Sbjct: 738 IS 739

>CAGL0A01133g Chr1 (112037..114442) [2406 bp, 801 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 801

 Score =  911 bits (2354), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/737 (62%), Positives = 560/737 (75%), Gaps = 30/737 (4%)

Query: 21  RPLSYIRPLNIVRPQISLISIRIGVRWNSQLSPSQEENRPKPVKQILEPIQKKE--SSYK 78
           RP +  R LN    + +  +    V+  S      EE+R    K+  E  + KE  S ++
Sbjct: 62  RPFTAHRALN---NEYNTTAGNASVKSQSATKEKNEEDRKYSKKEKEEQSETKENHSEFR 118

Query: 79  DAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGK--DLQNVNM 136
           D VRL  L +RDW+LL  A+ LLTISC IGM+IPKVIGL+LD L+  +     D Q V++
Sbjct: 119 DIVRLMLLVRRDWKLLLTAVGLLTISCSIGMTIPKVIGLILDQLKNALAANSVDGQPVSI 178

Query: 137 DDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQD 196
           D L PI FGL+ Y+               N+ RI++LR+LSER+VARLR+ V+ KT+HQD
Sbjct: 179 DKLPPIVFGLSFYEFLGGFALALLVGIAANYGRIILLRVLSERLVARLRATVIKKTIHQD 238

Query: 197 SEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLL 256
           +EF+DTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICG VGIGMM+++SP+LS +LL
Sbjct: 239 AEFFDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGSVGIGMMLALSPQLSCLLL 298

Query: 257 FFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNG 316
            F PP++ SASVFGK+I  TS++LQEATG LT+VAEEQLSG+KTVQSFVAEQRE++RYN 
Sbjct: 299 VFTPPVILSASVFGKQISTTSRELQEATGHLTKVAEEQLSGIKTVQSFVAEQREINRYNF 358

Query: 317 AIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTE 376
           AIR I+N+G+KAA INA+FF+ST+ +GD+SF+ VL +GSYLVLQ SLTIGDLTAFM+YTE
Sbjct: 359 AIRDIFNIGKKAAVINAKFFSSTSAMGDLSFLTVLGFGSYLVLQNSLTIGDLTAFMMYTE 418

Query: 377 YTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSY 436
           YTG+S+FGL+TFYSE+MQG GAASRLF+LTD + SIS TKG KY PG G+IEFKNVSF+Y
Sbjct: 419 YTGNSIFGLSTFYSEIMQGAGAASRLFELTDRVPSISTTKGVKYKPGNGEIEFKNVSFAY 478

Query: 437 PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKV 496
           PTRP N IFK++N K+  GSNVCIVGPSGRGKST+ALLL +YY P++G+IL+DGQ+I+ +
Sbjct: 479 PTRPSNMIFKNLNFKIEAGSNVCIVGPSGRGKSTVALLLEKYYKPSSGEILIDGQNINDL 538

Query: 497 NCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGY 556
           N K+LRRHIGLVQQEPILMSGTIRDNI YGL E  TK+EIR VAKQCFCHNFIT+F   Y
Sbjct: 539 NSKSLRRHIGLVQQEPILMSGTIRDNIVYGLTEMPTKDEIRQVAKQCFCHNFITRFQSSY 598

Query: 557 DTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG 616
           DT+IG  G LLSGGQ+QRIAIARALIKKP IL+LDEATSALDVESEGAINYTFGQLMK  
Sbjct: 599 DTVIGPHGTLLSGGQKQRIAIARALIKKPRILILDEATSALDVESEGAINYTFGQLMKKK 658

Query: 617 SMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS-RSDG 675
            MTIVSIAHRLSTI+RSENVIVLG DGSV+E GKFKEL+ +P SEL +LL EKS+     
Sbjct: 659 EMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELWDDPTSELSQLLNEKSTPHQTT 718

Query: 676 NDSLPPPPPN------------ATQDKVVEQ----------IAEKILERFPEAGQSPDAT 713
           N ++ PPP              A  + V+E           ++E   E      +  + T
Sbjct: 719 NITVTPPPTTMAEKVVEEVVENAEPETVIEDPGSPPMYISTVSEVSAEGHELINEQIEDT 778

Query: 714 VKEIFKDVSSEGKPIKI 730
           ++ + KDV+SE KP+K+
Sbjct: 779 IENVMKDVTSERKPLKL 795

>Suva_16.35 Chr16 (46072..48375) [2304 bp, 767 aa] {ON} YPL270W
           (REAL)
          Length = 767

 Score =  904 bits (2335), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/741 (63%), Positives = 562/741 (75%), Gaps = 37/741 (4%)

Query: 16  SKSQLRPLSYI--RPLNIVRPQISLISIRIGVRWNSQLSPSQEENRPKPV----KQILEP 69
           S S L P+ ++  RP  I +  +S       VR+NS  + +Q++  P P     KQ  +P
Sbjct: 38  SSSHLIPIHHLCTRPAPISKSLLSQF-----VRFNS--TKTQQDIPPLPSTSASKQPAKP 90

Query: 70  -IQKKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEG 128
             Q K   YKD +RLF LAKRDW+LL  AI LLTISC IGMSIPKVIG+VLD L+    G
Sbjct: 91  AYQSKSDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTS-SG 149

Query: 129 KDLQNVNMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGV 188
            D  ++ +    PI F L +Y+               NF R ++LRILSERVVARLR+ V
Sbjct: 150 SDFFDLKI----PI-FSLPLYEFLSFFTVALLIGCVANFGRFILLRILSERVVARLRAHV 204

Query: 189 MNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSIS 248
           + KTLHQD+EF+D HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VG+GMM S+S
Sbjct: 205 IKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLS 264

Query: 249 PELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQ 308
           P+LS +LLFF PP+L+SASVFGK+IR+TSKDLQEATGQLTRVAEEQLSG+KTVQSFVAE 
Sbjct: 265 PQLSVLLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEG 324

Query: 309 RELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDL 368
            EL RYN AIR I+ VG+ AAF NA+FFT+T++LGD+SF+ VL YGSYLVLQ  L+IGDL
Sbjct: 325 NELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDL 384

Query: 369 TAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIE 428
           TAFMLYTEYTG++VFGL+TFYSE+MQG GAASRLF+LTD   SISPT G KY P +G IE
Sbjct: 385 TAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIE 444

Query: 429 FKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILV 488
           FK+VSFSYPTRP  QIFK +N K+ PGS+VCIVGPSGRGKSTIALLLLRYYNPT G I++
Sbjct: 445 FKDVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMI 504

Query: 489 DGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNF 548
           D QDI+K+NCK+LRRHIG+VQQEP+LMSGTIRDNITYGL    TKEEIRSVAKQCFCHNF
Sbjct: 505 DNQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNF 564

Query: 549 ITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYT 608
           ITKFP+ YDT+IG  G LLSGGQ+QRIAIARALIKKP +L+LDEATSALDVESEGAINYT
Sbjct: 565 ITKFPNTYDTVIGPNGTLLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYT 624

Query: 609 FGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTE 668
           FGQLMKS SMTIVSIAHRLSTI+RSENVIVLG DGSV+E GKFKEL++NP S L +LL E
Sbjct: 625 FGQLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYSNPTSALSQLLNE 684

Query: 669 KSS--------RSDGNDSLPPPPPNATQDKVVE---------QIAEKILERFPEAGQSPD 711
           +++        + + ++    P  +   D+  E             K LE   +     +
Sbjct: 685 RTAPVPSEQQQQVEKDNEKEEPNEDENHDQRNEGDDGSNHDNDSNNKPLESKDKKSDDIE 744

Query: 712 ATVKEIFKDVSSEGKPIKITP 732
            +V+ + KD + E  PIK++P
Sbjct: 745 ESVEHVLKDAAKEANPIKLSP 765

>YPL270W Chr16 (30482..32803) [2322 bp, 773 aa] {ON}
           MDL2Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, required for respiratory
           growth at high temperature; similar to human TAP1 and
           TAP2 implicated in bare lymphocyte syndrome and
           Wegener-like granulomatosis
          Length = 773

 Score =  900 bits (2327), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/692 (67%), Positives = 534/692 (77%), Gaps = 46/692 (6%)

Query: 71  QKKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKD 130
           Q K   YKD +RLF LAKRDW+LL  AI LLTISC IGMSIPKVIG+VLD L+    G D
Sbjct: 96  QSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTS-SGSD 154

Query: 131 LQNVNMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMN 190
             ++ +    PI F L +Y+               NF R ++LRILSERVVARLR+ V+ 
Sbjct: 155 FFDLKI----PI-FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRANVIK 209

Query: 191 KTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPE 250
           KTLHQD+EF+D HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VG+GMM S+SP+
Sbjct: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVGMMCSLSPQ 269

Query: 251 LSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRE 310
           LS +LLFF PP+L+SASVFGK+IR+TSKDLQEATGQLTRVAEEQLSG+KTVQSFVAE  E
Sbjct: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329

Query: 311 LHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTA 370
           L RYN AIR I+ VG+ AAF NA+FFT+T++LGD+SF+ VL YGSYLVLQ  L+IGDLTA
Sbjct: 330 LSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 389

Query: 371 FMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFK 430
           FMLYTEYTG++VFGL+TFYSE+MQG GAASRLF+LTD   SISPT G KY P +G IEFK
Sbjct: 390 FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYKPDRGVIEFK 449

Query: 431 NVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDG 490
           +VSFSYPTRP  QIFK++N K+ PGS+VCIVGPSGRGKSTIALLLLRYYNPT G I +D 
Sbjct: 450 DVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTITIDN 509

Query: 491 QDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFIT 550
           QDISK+NCK+LRRHIG+VQQEP+LMSGTIRDNITYGL    TKEEIRSVAKQCFCHNFIT
Sbjct: 510 QDISKLNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT 569

Query: 551 KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFG 610
           KFP+ YDT+IG  G LLSGGQ+QRIAIARALIKKP IL+LDEATSALDVESEGAINYTFG
Sbjct: 570 KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFG 629

Query: 611 QLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKS 670
           QLMKS SMTIVSIAHRLSTI+RSENVIVLG DGSV+E GKFKEL+ANP S L +LL EK+
Sbjct: 630 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANPTSALSQLLNEKA 689

Query: 671 SRSDGNDSLPPPPPNATQDKVVEQIAEKILERFPEAGQ--------------------SP 710
           +          P P+  Q ++ + I ++ L    E                       SP
Sbjct: 690 A----------PGPSDQQLQIEKVIEKEDLNESKEHDDQKKDDNDDNDNNHDNDSNNQSP 739

Query: 711 DA----------TVKEIFKDVSSEGKPIKITP 732
           +           +V+ + KD + E  PIKITP
Sbjct: 740 ETKDNNSDDIEKSVEHLLKDAAKEANPIKITP 771

>Kpol_1045.83 s1045 (193070..195316) [2247 bp, 748 aa] {ON}
           (193072..195318) [2247 nt, 749 aa]
          Length = 748

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/654 (66%), Positives = 532/654 (81%), Gaps = 14/654 (2%)

Query: 79  DAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDD 138
           D  RL  LAKRDW+LL  AI+LL++SC+IGMS+PK+IG+VLD L++ +   D     +DD
Sbjct: 101 DLKRLARLAKRDWKLLLTAISLLSVSCLIGMSLPKIIGIVLDELKQIMSNPDF---TVDD 157

Query: 139 LGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQDSE 198
           +  IAFGL +Y+               N+ R+++LR+LSERVVARLR+ V+ KT+HQD+E
Sbjct: 158 VPEIAFGLNLYEFISLVGVSLLVGTAANYGRVILLRVLSERVVARLRANVIKKTMHQDAE 217

Query: 199 FYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFF 258
           F+D +KVGDLISRL SDAYVVSRS+TQKVSDGFKA++CG VGIGMM+SISP+LS  LLF 
Sbjct: 218 FFDNNKVGDLISRLSSDAYVVSRSLTQKVSDGFKAMLCGSVGIGMMISISPQLSAFLLFL 277

Query: 259 APPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAI 318
            PP++ SAS FG+ IR+ S+DLQEATG LT+VAEEQ SG+KTVQSFVAEQ+E+ RYN AI
Sbjct: 278 TPPVMLSASYFGRLIRNNSRDLQEATGSLTKVAEEQFSGIKTVQSFVAEQKEIKRYNHAI 337

Query: 319 RGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYT 378
           R I+NVG+++AFINA+FF+ T +LGDMSF+VVL YGSYLVL GSL+IGDLTA+M+YTEYT
Sbjct: 338 RHIFNVGKQSAFINAKFFSLTAVLGDMSFLVVLAYGSYLVLHGSLSIGDLTAYMMYTEYT 397

Query: 379 GSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPT 438
           GSS+FGL+TFYSE+MQG GAASRLF+LTD I SISPT G+K++P KG+IEFKNVSFSYPT
Sbjct: 398 GSSIFGLSTFYSEIMQGAGAASRLFELTDRIPSISPTLGKKFVPNKGEIEFKNVSFSYPT 457

Query: 439 RPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNC 498
           R  NQIFK+++ K+  GSNVCIVGPSGRGKSTIA LLLRYYNPT GQI VDGQDISKV+ 
Sbjct: 458 RASNQIFKNLSFKIDAGSNVCIVGPSGRGKSTIASLLLRYYNPTTGQIFVDGQDISKVSS 517

Query: 499 KTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDT 558
           K+LRRH+ +VQQEP+LMSGTIRDNITYGL E  T++E+RS+ K+CFCHNFITKFP+ YDT
Sbjct: 518 KSLRRHMSIVQQEPVLMSGTIRDNITYGLVEKPTQDEVRSITKKCFCHNFITKFPNSYDT 577

Query: 559 MIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSM 618
           ++G  G LLSGGQ+QRIAIARALIKKP IL+LDEATSALDVESEGAINYTFG+LMKS S+
Sbjct: 578 ILGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFGKLMKSKSI 637

Query: 619 TIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDS 678
           TI+SIAHRLSTI+RSENVIVLG DGSV E GKFKEL+A+P SEL KLL EK++RS+    
Sbjct: 638 TIISIAHRLSTIRRSENVIVLGNDGSVAEVGKFKELYADPGSELSKLLHEKATRSERQQ- 696

Query: 679 LPPPPPNATQDKVVE-QIAEKILERFPEAGQSPDAT---VKEIFKDVSSEGKPI 728
                 N  +D+ ++ +    I    PE+  + +     +KE   DV+++ KPI
Sbjct: 697 ------NTAEDQEIDPEETINIENSTPESDITQELLENPIKEAIMDVAADNKPI 744

>TPHA0J00220 Chr10 complement(51873..54095) [2223 bp, 740 aa] {ON}
           Anc_6.5 YPL270W
          Length = 740

 Score =  896 bits (2316), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/718 (62%), Positives = 547/718 (76%), Gaps = 27/718 (3%)

Query: 21  RPLSYIRPLNIVRPQISLISIRIGVRWNSQLSPSQEENRPKPVKQILEPIQKKESSYKDA 80
           R LS+ R + I   ++ +       RW+S  + + +   PK             +   D 
Sbjct: 30  RKLSF-RAITIKPNEVKIACTITTKRWSSSKTTAPQVRVPK-----------SRNDGNDI 77

Query: 81  VRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGI---EGKDLQNVNMD 137
            RL SLAK+DW+LLC A+ LLT+SC IGMS+PKVIG+VLD+L+  I   E  +L + ++ 
Sbjct: 78  KRLLSLAKKDWKLLCIAVGLLTVSCTIGMSLPKVIGMVLDLLKNAISKSEDAELGSADLS 137

Query: 138 ----DLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTL 193
               +L PIAFGL++Y+               NF R+V+LR+LSERVVARLRS V+ KT+
Sbjct: 138 IESSELPPIAFGLSLYEFLGCIGAALLIGTAANFGRVVLLRVLSERVVARLRSQVIKKTI 197

Query: 194 HQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSG 253
           HQD+EF+D +KVGDLISRLGSDAYVVSRSMTQKVSDGFKAL+CGGVG+GMMVSISPELS 
Sbjct: 198 HQDAEFFDNNKVGDLISRLGSDAYVVSRSMTQKVSDGFKALLCGGVGVGMMVSISPELSA 257

Query: 254 VLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHR 313
            LLFF PP++ S+  FG+ IR  S+ LQEATGQLTRV+EEQ SGVKTVQ+FVAEQRE+ R
Sbjct: 258 FLLFFTPPVMLSSMYFGRLIRDNSRKLQEATGQLTRVSEEQFSGVKTVQAFVAEQREIKR 317

Query: 314 YNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFML 373
           YN  I+ +YNVG+++AFINA+ FT T+ LGDMSF++VL YGSYLVL G L+IGDLTA+M+
Sbjct: 318 YNNVIKDVYNVGKESAFINAKLFTITSSLGDMSFLLVLAYGSYLVLHGGLSIGDLTAYMM 377

Query: 374 YTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVS 433
           YTE TGS+VFGL++FYSE+MQGVGAASRLF+LTD I  ISPT G+KYIPGKG+IEFKNVS
Sbjct: 378 YTELTGSAVFGLSSFYSEIMQGVGAASRLFELTDRIPMISPTTGKKYIPGKGEIEFKNVS 437

Query: 434 FSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDI 493
           F+YPTRP +QIFK +N K+ PGSNVCIVGPSGRGKSTIA LLL+YY PT G I VDGQDI
Sbjct: 438 FAYPTRPGSQIFKSLNFKIEPGSNVCIVGPSGRGKSTIASLLLKYYKPTAGTITVDGQDI 497

Query: 494 SKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFP 553
           SK+N K+LRRHIG+VQQEPILMSG+IRDNITYGL   AT EEIR V KQCFCHNFITKFP
Sbjct: 498 SKLNSKSLRRHIGIVQQEPILMSGSIRDNITYGLTYEATAEEIRRVTKQCFCHNFITKFP 557

Query: 554 DGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLM 613
           D Y T++G  G LLSGGQ+QRIAIARAL+KKPN+L+LDEATSALDVESE AINYTFG+LM
Sbjct: 558 DQYQTILGPNGTLLSGGQKQRIAIARALLKKPNVLILDEATSALDVESESAINYTFGKLM 617

Query: 614 KSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRS 673
           K   +TI+SIAHRLSTI+RSE VIVLG DGSV+E GKFK LF NP SEL +LL EKS+ +
Sbjct: 618 KKKEVTIISIAHRLSTIRRSEIVIVLGNDGSVVEIGKFKTLFGNPLSELSQLLNEKSTIN 677

Query: 674 DGN-DSLPPPPP------NATQDKVVEQI-AEKILERFPEAGQSPDATVKEIFKDVSS 723
           + N +  P   P      NA  + +V+ +  E+IL+    +    D   K+ F D SS
Sbjct: 678 ERNPNEKPAETPEQESQKNAANESIVDVVLEEEILQNDIRSQDEKDILDKQPFPDKSS 735

>NDAI0I02730 Chr9 complement(640429..642927) [2499 bp, 832 aa] {ON}
           Anc_6.5
          Length = 832

 Score =  894 bits (2311), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/719 (62%), Positives = 546/719 (75%), Gaps = 35/719 (4%)

Query: 42  RIGVRWNSQL---------SPSQEENRPKPVKQILEPIQKKESSYKDAVRLFSLAKRDWR 92
           ++ +R+NS           + S E  +       +EP Q  ES++KD  RLF L K+D++
Sbjct: 117 KVALRFNSTTNTTDTIPPHTESTESTKASTEPNEIEPDQG-ESNFKDVFRLFLLVKKDYK 175

Query: 93  LLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDDLGP---IAFGLTIY 149
           LL  ++ LLTISC IGM IPK+IGL+LD L+      D          P   I FGLT+Y
Sbjct: 176 LLIVSLTLLTISCTIGMMIPKIIGLILDALKSVATTPD------GGSSPPPTIMFGLTLY 229

Query: 150 QXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLI 209
           +               N+ R+++LRILSER+VARLRS VM  TLHQDSEF+D HKVGDLI
Sbjct: 230 EFLGGFSVALFIGCAANYGRLILLRILSERLVARLRSVVMKHTLHQDSEFFDVHKVGDLI 289

Query: 210 SRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVF 269
           SRLG+D+Y+VSRS+TQK+SDG K+LICGGVGIGMM+ +S +LS VL+ F  P++ SAS+F
Sbjct: 290 SRLGADSYIVSRSITQKISDGVKSLICGGVGIGMMLELSMDLSSVLVCFVIPVVLSASIF 349

Query: 270 GKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAA 329
           GK+IR  S++LQ+ATGQLTRV+EEQL+GV+TVQSFVAEQRE+ R+N +IR I++VG++AA
Sbjct: 350 GKQIRINSRELQDATGQLTRVSEEQLNGVRTVQSFVAEQREIKRFNHSIREIFDVGKRAA 409

Query: 330 FINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFY 389
           FINA+FFTST+++GD+SF+ VL+YGSYLVL GSLTIGDLTAFMLYTEYTG+++FGL+TFY
Sbjct: 410 FINAKFFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNAIFGLSTFY 469

Query: 390 SELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDIN 449
           SE+MQG GAASRLF+LTD + +I PT G+ Y PGKG+IEFKNVSF+YPTRP NQIFK +N
Sbjct: 470 SEIMQGAGAASRLFELTDRVPTIRPTLGKTYTPGKGEIEFKNVSFAYPTRPSNQIFKSLN 529

Query: 450 IKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQ 509
            K+ PGSNVCIVGPSG+GKSTIALLLL YYNPT+GQIL+DGQDI+K+N K+LRR I +VQ
Sbjct: 530 FKIKPGSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKLNSKSLRRQIAVVQ 589

Query: 510 QEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSG 569
           QEP+LMSGTIRDNITYGL E  TKEEIR+VAKQCFCHNFI KFP  YDT IG  G LLSG
Sbjct: 590 QEPVLMSGTIRDNITYGLTEEPTKEEIRTVAKQCFCHNFIVKFPYTYDTYIGPHGTLLSG 649

Query: 570 GQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLST 629
           GQ+QRIAIARALIKKPNIL+LDEATSALDVESEGAINYTFGQLMKS SMTIVSIAHRLST
Sbjct: 650 GQKQRIAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAHRLST 709

Query: 630 IKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSD--------------- 674
           I+RSEN+IVLG DGSV+E GKFKELFA+P SEL KLL EKSSR                 
Sbjct: 710 IRRSENIIVLGNDGSVVEMGKFKELFADPTSELSKLLNEKSSRKKVVTKTVPPVSSTSVS 769

Query: 675 -GNDSLPPPPPNATQDKVVEQIAEKILERFPEAGQSPDATVKEIFKDVSSEGKPIKITP 732
             N S         ++   ++  E          Q  + +++ +  DVS+E KPIK++P
Sbjct: 770 SANGSSIHHEGTILEEDHAQEDHESEAPPTIITTQQLEDSIESVLNDVSAESKPIKLSP 828

>NCAS0D02210 Chr4 (410709..413030) [2322 bp, 773 aa] {ON} Anc_6.5
          Length = 773

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/701 (65%), Positives = 553/701 (78%), Gaps = 21/701 (2%)

Query: 37  SLISIRIGVRWNSQLSPSQEENR-PKPVKQILEPIQKKESSYKDAVRLFSLAKRDWRLLC 95
           SL S     R NS +S   ++N+ P      L   ++ +S++ D +RLF L K DW+LL 
Sbjct: 83  SLTSQLTITRLNSTVSTQSKDNKQPSLQGNPLSTSEEPKSNFSDVIRLFLLVKTDWKLLL 142

Query: 96  AAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDDLGPIA-FGLTIYQXXXX 154
            A+ LLTISCVIGM IPKVIG++LD L+        Q+   +   PI  FGLTIY+    
Sbjct: 143 VALTLLTISCVIGMMIPKVIGIILDSLKVQTA---TQSEGEEAPPPIMMFGLTIYEFLGG 199

Query: 155 XXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGS 214
                      NF R+++LRILSER+VARLRS V+ +T+HQD++FYD HK GDLISRLG+
Sbjct: 200 FSIALLAGCMANFGRLILLRILSERLVARLRSTVIKRTIHQDAQFYDIHKTGDLISRLGA 259

Query: 215 DAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIR 274
           DAY+VSRS+TQK+SDGFK+LICGGVG+GMM S+S +LS VL     P++ SAS+FGK+IR
Sbjct: 260 DAYIVSRSITQKISDGFKSLICGGVGVGMMCSLSLDLSAVLGVLIIPVVISASIFGKQIR 319

Query: 275 HTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAE 334
             S++LQ+ATGQLTRV+EEQL+GVKTVQSFVAEQRE+ R+N AIR I++VG+++AFINA+
Sbjct: 320 INSRELQDATGQLTRVSEEQLNGVKTVQSFVAEQREIKRFNEAIRNIFHVGKRSAFINAK 379

Query: 335 FFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQ 394
           FFTST+++GD+SF+ VL+YGSYLVL GSLTIGDLTAFMLYTEYTG+S+FGL+TFYSE+MQ
Sbjct: 380 FFTSTSLVGDLSFLTVLVYGSYLVLHGSLTIGDLTAFMLYTEYTGNSIFGLSTFYSEIMQ 439

Query: 395 GVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPP 454
           G GAASRLF+LTD++  I PT G+ Y+PGKG+IEFKNVSFSYPTRP+NQIFK++N K+ P
Sbjct: 440 GAGAASRLFELTDYVPEIRPTLGKTYLPGKGEIEFKNVSFSYPTRPQNQIFKNLNFKIEP 499

Query: 455 GSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPIL 514
           GSNVCIVGPSG+GKSTIALLLL YYNPT+GQIL+DGQDI+K+N K+LRR +G+VQQEP+L
Sbjct: 500 GSNVCIVGPSGKGKSTIALLLLHYYNPTSGQILIDGQDITKMNSKSLRRKLGIVQQEPVL 559

Query: 515 MSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQR 574
           MSG+IRDNITYGL    TKEEIR VAKQCFCHNFITKFP  YDT IG  G LLSGGQ+QR
Sbjct: 560 MSGSIRDNITYGLTYTPTKEEIRKVAKQCFCHNFITKFPHTYDTQIGPSGTLLSGGQKQR 619

Query: 575 IAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSE 634
           IAIARALIKKPNIL+LDEATSALDVESEGAINYTFGQLMK+ SMTIVSIAHRLSTI+RSE
Sbjct: 620 IAIARALIKKPNILILDEATSALDVESEGAINYTFGQLMKTKSMTIVSIAHRLSTIRRSE 679

Query: 635 NVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSR----SDGNDSLPPPPPNATQDK 690
           NVIVLG DGSVIE GKFKELF++P+SEL KLL EKSSR    SD   S P    +AT + 
Sbjct: 680 NVIVLGNDGSVIEMGKFKELFSDPSSELSKLLNEKSSRKKTKSDPISSAPEVDADATGEP 739

Query: 691 VVEQIAEKILERFPEAGQSPDATVKEIFKDVSSEGKPIKIT 731
            VE I   I           +  +  +  DV+SE KPIK++
Sbjct: 740 -VEPIDPAI-----------EDALHSVLNDVTSESKPIKMS 768

>Skud_16.7 Chr16 (9624..11945) [2322 bp, 773 aa] {ON} YPL270W (REAL)
          Length = 773

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/698 (65%), Positives = 535/698 (76%), Gaps = 42/698 (6%)

Query: 63  VKQILEPIQKKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVL 122
           VK    P + K   YKD +RLF LAKRDW+LL  AI LLTISC IGMSIPKVIG+VLD L
Sbjct: 88  VKPARPPQRSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTL 147

Query: 123 RKGIEGKDLQNVNMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVA 182
           +    G D   + +    PI F L +Y+               NF R ++LRILSERVVA
Sbjct: 148 KTS-SGSDFFELKI----PI-FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVA 201

Query: 183 RLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIG 242
           RLR+ V+ KTLHQD+EF+D HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VG+G
Sbjct: 202 RLRAHVIKKTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGVVGVG 261

Query: 243 MMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQ 302
           MM S+SP+LS +LLFF PP+L+SASVFGK+IR+TSKDLQEATGQLTRVAEEQLSG+KTVQ
Sbjct: 262 MMCSLSPQLSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQ 321

Query: 303 SFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGS 362
           SFVAE  EL RYN AIR I+ VG+ AAF NA+FFT+T++LGD+SF+ VL YGSYLVLQ  
Sbjct: 322 SFVAEGNELSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQ 381

Query: 363 LTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIP 422
           L+IGDLTAFMLYTEYTG++VFGL+TFYSE+MQG GAASRLF+LTD   SISPT G KY P
Sbjct: 382 LSIGDLTAFMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTAGHKYKP 441

Query: 423 GKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPT 482
            +G +EFK+VSFSYPTRP  QIFK++N K+ PGS+VCIVGPSGRGKSTIALLLLRYYNP+
Sbjct: 442 HRGVVEFKDVSFSYPTRPSVQIFKNLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPS 501

Query: 483 NGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQ 542
            G I++D QDI+K+NCK+LRRHIG+VQQEP+LMSGTIRDNITYGL    TKEEIRSVAKQ
Sbjct: 502 TGTIMIDDQDITKMNCKSLRRHIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQ 561

Query: 543 CFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESE 602
           CFCHNFITKFP+ YDT+IG++G LLSGGQ+QRIAIARALIKKP IL+LDEATSALDVESE
Sbjct: 562 CFCHNFITKFPNTYDTVIGSRGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESE 621

Query: 603 GAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSEL 662
           GAINYTFG LMKS SMTI+SIAHRLSTI+RSENVIVLG DGSV+E GKFK+L+ANP S L
Sbjct: 622 GAINYTFGHLMKSKSMTIISIAHRLSTIRRSENVIVLGHDGSVVEMGKFKKLYANPTSAL 681

Query: 663 CKLLTEKSSRSDGNDSLPPPPPNATQDKVVEQIAEKILERFP------------------ 704
            +LL E+++        P P     Q +   +  E   E+ P                  
Sbjct: 682 SQLLNERAA--------PGPSDQQQQIEKDNENEESTEEKAPDHSNKNDNDDNDNNHDND 733

Query: 705 EAGQSPDAT----------VKEIFKDVSSEGKPIKITP 732
              QS + T          V+ + +D + E  PIK+TP
Sbjct: 734 SNKQSQEVTHKNSDDIEESVEHLLRDAAKEATPIKLTP 771

>Smik_6.478 Chr6 complement(788399..790720) [2322 bp, 773 aa] {ON}
           YPL270W (REAL)
          Length = 773

 Score =  892 bits (2304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/690 (66%), Positives = 532/690 (77%), Gaps = 42/690 (6%)

Query: 71  QKKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKD 130
           Q K   YKD +RLF LAKRDW+LL  AI LLTISC IGMSIPKVIG+VLD L+    G D
Sbjct: 96  QSKTDDYKDIIRLFMLAKRDWKLLLTAILLLTISCSIGMSIPKVIGIVLDTLKTS-SGSD 154

Query: 131 LQNVNMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMN 190
             ++ +    PI F L +Y+               NF R ++LRILSERVVARLR+ V+ 
Sbjct: 155 FFDLKI----PI-FSLPLYEFLSFFTVALLIGCAANFGRFILLRILSERVVARLRAHVIK 209

Query: 191 KTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPE 250
           KTLHQD+EF+D HKVGDLISRLGSDAYVVSRSMTQKVSDG KALICG VG+GMM S+SP+
Sbjct: 210 KTLHQDAEFFDNHKVGDLISRLGSDAYVVSRSMTQKVSDGVKALICGIVGVGMMCSLSPQ 269

Query: 251 LSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRE 310
           LS +LLFF PP+L+SASVFGK+IR+TSKDLQEATGQLTRVAEEQLSG+KTVQSFVAE  E
Sbjct: 270 LSILLLFFTPPVLFSASVFGKQIRNTSKDLQEATGQLTRVAEEQLSGIKTVQSFVAEGNE 329

Query: 311 LHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTA 370
           L RYN AIR I+ VG+ AAF NA+FFT+T++LGD+SF+ VL YGSYLVLQ  L+IGDLTA
Sbjct: 330 LSRYNVAIRDIFQVGKTAAFTNAKFFTTTSLLGDLSFLTVLAYGSYLVLQSQLSIGDLTA 389

Query: 371 FMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFK 430
           FMLYTEYTG++VFGL+TFYSE+MQG GAASRLF+LTD   SISPT G KY P +G IEFK
Sbjct: 390 FMLYTEYTGNAVFGLSTFYSEIMQGAGAASRLFELTDRKPSISPTVGHKYQPERGVIEFK 449

Query: 431 NVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDG 490
           +VSFSYPTRP  QIFK +N K+ PGS+VCIVGPSGRGKSTIALLLLRYYNPT G I++D 
Sbjct: 450 DVSFSYPTRPSVQIFKSLNFKIAPGSSVCIVGPSGRGKSTIALLLLRYYNPTTGTIMIDN 509

Query: 491 QDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFIT 550
           QDI+K+NCK+LRR IG+VQQEP+LMSGTIRDNITYGL    TKEEIRSVAKQCFCHNFIT
Sbjct: 510 QDITKLNCKSLRRQIGIVQQEPVLMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFIT 569

Query: 551 KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFG 610
           KFP+ YDT+IG  G LLSGGQ+QRIAIARALIKKP IL+LDEATSALDVESEGAINYTFG
Sbjct: 570 KFPNTYDTVIGPHGTLLSGGQKQRIAIARALIKKPTILILDEATSALDVESEGAINYTFG 629

Query: 611 QLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKS 670
           QLMKS SMTIVSIAHRLSTI+RSENVIVLG DGSV+E GKFKEL+AN  S L +LL E++
Sbjct: 630 QLMKSKSMTIVSIAHRLSTIRRSENVIVLGHDGSVVEMGKFKELYANSTSALSQLLNERA 689

Query: 671 SRSDGNDSLPPPPPNATQDKVVEQIAE----------------------------KILER 702
           +        P P     Q + VE+  +                            + LE 
Sbjct: 690 A--------PGPSDQQLQIEKVEEKEDTNEGEKHDQQNKQDDDNSHNNHDNDSNNQSLEV 741

Query: 703 FPEAGQSPDATVKEIFKDVSSEGKPIKITP 732
             +  ++ + +V+ + KD + E  PIK+TP
Sbjct: 742 KDKNSENIEESVEHLLKDAAKEANPIKLTP 771

>TBLA0A07190 Chr1 complement(1792994..1795378) [2385 bp, 794 aa]
           {ON} Anc_6.5 YPL270W
          Length = 794

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/675 (64%), Positives = 531/675 (78%), Gaps = 9/675 (1%)

Query: 60  PKPVKQILEPIQKKESSYK-DAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLV 118
           P P K    P  + E   + +  RL  +  RDW+LL  AI LLTISC IGM+IPKVIGLV
Sbjct: 127 PPPNKTNYSPRAEDEKKGRSELARLVLMTLRDWKLLLLAITLLTISCSIGMAIPKVIGLV 186

Query: 119 LDVLRKGIEGKDLQNVNMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSE 178
           LD L K +      ++   DL PIAFGLT+Y                N+ R ++LR+LSE
Sbjct: 187 LDAL-KNVMTDSPSSLETSDLPPIAFGLTLYPFLGAFAGALVIGTMCNYGRYILLRLLSE 245

Query: 179 RVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGG 238
           RVVARLRS V+ KTLHQD+EF+D +KVGDLISRLGSDAYVVSRS+TQKVSDGFKA++CGG
Sbjct: 246 RVVARLRSHVIKKTLHQDAEFFDQNKVGDLISRLGSDAYVVSRSLTQKVSDGFKAILCGG 305

Query: 239 VGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGV 298
            GIGMM+SISP+LS  L+ FAP ++ SAS+FGKKIR  S  LQEATGQLTRV+EEQL+GV
Sbjct: 306 AGIGMMISISPQLSSFLVIFAPAVVISASIFGKKIRDISTILQEATGQLTRVSEEQLNGV 365

Query: 299 KTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLV 358
           KTVQSFVAEQ+E+ RYN AIR IYN+G+ +A +N++F TST+++GDMSF+VVL YGSYLV
Sbjct: 366 KTVQSFVAEQKEIRRYNNAIRDIYNIGKMSAVVNSKFSTSTSVIGDMSFLVVLAYGSYLV 425

Query: 359 LQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQ 418
           L GSLTIGDLTAFMLYT+YT +S+FGL+ FYSE+MQGVGAA RLFDLTD I +I PT G+
Sbjct: 426 LHGSLTIGDLTAFMLYTDYTANSIFGLSNFYSEIMQGVGAAKRLFDLTDRIPAIRPTIGE 485

Query: 419 KYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRY 478
           K+IPG G IEF+N+ F+YPTRPENQ+FK++N K+ PG++VCIVGPSGRGKSTIALLLLRY
Sbjct: 486 KFIPGDGCIEFRNLGFAYPTRPENQVFKNLNFKIEPGTSVCIVGPSGRGKSTIALLLLRY 545

Query: 479 YNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRS 538
           YNP++GQIL+D QDI K+N K+LR+++G+VQQEP+LMSG+IRDNITYGL   AT +EIR 
Sbjct: 546 YNPSSGQILIDNQDIMKLNPKSLRQYMGIVQQEPVLMSGSIRDNITYGLKREATPDEIRE 605

Query: 539 VAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALD 598
           V+KQCFCHNFITKFPD Y+T+IG  G LLSGGQ+QRIAIARALIKKP IL+LDEATSALD
Sbjct: 606 VSKQCFCHNFITKFPDAYETIIGPHGTLLSGGQKQRIAIARALIKKPKILILDEATSALD 665

Query: 599 VESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANP 658
           VESEGAINYTFG+LMKS S+TIVSIAHRLSTI+RSE +IVLG DGSV+E GKFKEL+A+P
Sbjct: 666 VESEGAINYTFGKLMKSKSVTIVSIAHRLSTIRRSEYIIVLGNDGSVVETGKFKELYADP 725

Query: 659 NSELCKLLTEKSSRSDGNDSLPPPPPNATQDKVVEQIAEKILERFPEAGQS-PDATVKEI 717
            SEL KLL EK SR++  ++  PP  +       E          P +  S  +  V ++
Sbjct: 726 TSELSKLLNEKQSRANKKEAPLPPQSDGENGDDFEGNGT------PASPPSLHNNLVTDV 779

Query: 718 FKDVSSEGKPIKITP 732
            K+VS +  P+KI P
Sbjct: 780 LKEVSDDSSPLKIAP 794

>SAKL0E00748g Chr5 complement(50683..53007) [2325 bp, 774 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 774

 Score =  853 bits (2204), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/653 (64%), Positives = 516/653 (79%), Gaps = 24/653 (3%)

Query: 71  QKKE---------SSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDV 121
           QKKE         + YK+  RLF LA+ DW+LL  AI+LLTISC IGM++PKVIG+VLDV
Sbjct: 109 QKKEQESTSGNSGAGYKEIFRLFRLARHDWKLLLVAISLLTISCSIGMAVPKVIGMVLDV 168

Query: 122 LRKGIEGKDLQNVNMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVV 181
            +  I   D +  ++ DL P+ +GL +Y                NF R+V+LRIL E++V
Sbjct: 169 AKNAITS-DEKPKDLRDLPPVVWGLGLYDFLAVFAGALVLSTFANFGRVVLLRILGEKLV 227

Query: 182 ARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGI 241
           ARLRS V+ KT+HQD+EF+D +KVGDLISRL SDAYVVSRSMTQ +SDGFKA+ICGGVGI
Sbjct: 228 ARLRSNVIKKTIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNISDGFKAIICGGVGI 287

Query: 242 GMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTV 301
           GMM  IS  L+  L  FAPP+L  A+++G+KIR  S+DLQ++TG LT+VAEEQLSGVKTV
Sbjct: 288 GMMFHISSTLATALFLFAPPLLVGATIYGRKIRSISRDLQQSTGNLTKVAEEQLSGVKTV 347

Query: 302 QSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQG 361
           QSFVAEQ+E+ RYN AIR +++VG++ A  NA FF+ST++LGD SF++VL YGS+LVLQG
Sbjct: 348 QSFVAEQKEIKRYNHAIRKVFDVGKREALTNATFFSSTSVLGDFSFLIVLAYGSHLVLQG 407

Query: 362 SLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYI 421
           SL+IGDLTAFMLYTEY+GS+VFGL+ FYSELM+G GAASRLF+LTDH  SI  TKG  Y+
Sbjct: 408 SLSIGDLTAFMLYTEYSGSAVFGLSNFYSELMKGAGAASRLFELTDHQPSIYATKGVPYV 467

Query: 422 PGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNP 481
           PGKG+I+F+NVSFSYPTR  NQIF ++N  +  GSNVC+VGPSGRGKSTIA LLL+YYNP
Sbjct: 468 PGKGEIKFENVSFSYPTRSANQIFNNLNFTIDSGSNVCVVGPSGRGKSTIASLLLKYYNP 527

Query: 482 TNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAK 541
           T+G+I +DGQDISK++ K+LRRH+G+VQQEPILMSG+IRDNITYG+    T +EIRSV+K
Sbjct: 528 TSGRITIDGQDISKISAKSLRRHLGVVQQEPILMSGSIRDNITYGVPYTPTIDEIRSVSK 587

Query: 542 QCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVES 601
           +CFCHNFITKF DGY+T+IG +GALLSGGQ+QRIAIARALIKKPNIL+LDEATSALDVES
Sbjct: 588 KCFCHNFITKFSDGYETVIGPKGALLSGGQKQRIAIARALIKKPNILILDEATSALDVES 647

Query: 602 EGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSE 661
           EGAINYT GQLMKS  +TI+SIAHRLSTI+RSENVIVLG DGSV+E GKFKEL+A+  S+
Sbjct: 648 EGAINYTLGQLMKSRDITIISIAHRLSTIRRSENVIVLGDDGSVVEMGKFKELYASKESK 707

Query: 662 LCKLLTEKSSRS---------DGNDSLPPPPPNATQDKVVEQ---IAEKILER 702
           L KLL EK+  +         + ND  P P      D+  E+   I E++L +
Sbjct: 708 LYKLLNEKAKDTTSKMNAETVEKND--PSPKTEKLNDEEKEEQRRIEEQVLNQ 758

>KNAG0E02800 Chr5 (562361..564586) [2226 bp, 741 aa] {ON} Anc_6.5
           YPL270W
          Length = 741

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/718 (59%), Positives = 542/718 (75%), Gaps = 40/718 (5%)

Query: 28  PLNIVRPQISLISIRIGVRWNSQLSPSQEENRPKPVKQILEPIQKKESSYKDAVRLFSLA 87
           PL+ V+ +  LI  R  V +++ ++P + E +P  V   + P  + E +YKD  RLF L 
Sbjct: 45  PLHFVK-RSPLIPRR--VLYSTDVTPKEPEKQPAVV---VHPKPEDEGTYKDIWRLFLLV 98

Query: 88  KRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDDLGPIAFGLT 147
           K DW+LL +A+ LLT+SC IGM IPKVIG VLD L K I+GK+   + + D+       +
Sbjct: 99  KSDWKLLMSALTLLTVSCGIGMCIPKVIGTVLDSL-KDIQGKEFSELMIWDM-------S 150

Query: 148 IYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGD 207
           +                 N+ R+++LRILSE +VA+LR+ V+   +HQD++F+DT+KVGD
Sbjct: 151 LKHFFYGLSGLLLLGCGANYVRVILLRILSENLVAKLRANVIKHIIHQDAQFFDTYKVGD 210

Query: 208 LISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELS-GVLLFFAPPILWSA 266
           LISR+G+DA++VSRS+TQK+SDG KA+  G  G+GMM+SIS  LS  +L+    P+L SA
Sbjct: 211 LISRVGNDAFIVSRSITQKISDGVKAVFIGSAGVGMMLSISIPLSCSILILMGSPLLLSA 270

Query: 267 SVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGR 326
            VFGK+IR  SK LQE T  LTRV+EEQ +G+KT+QSFVAEQ E+H++NG+IR I+ VG+
Sbjct: 271 KVFGKQIRDNSKKLQEVTANLTRVSEEQFNGIKTIQSFVAEQSEMHKFNGSIRKIFAVGK 330

Query: 327 KAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLT 386
           +AAFINA+FFT+ +++GD+SF+VVL YGS+LV Q  L++GDLTAFMLYTEYTG+++F L+
Sbjct: 331 EAAFINAKFFTTASIIGDLSFLVVLSYGSWLVFQQQLSVGDLTAFMLYTEYTGNAIFNLS 390

Query: 387 TFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKG-DIEFKNVSFSYPTRPENQIF 445
            F+SE+MQG GAASR+F+LTD    I+PT+G K+IP KG +IEFKNVSF+YPTRP   IF
Sbjct: 391 GFFSEIMQGAGAASRIFELTDLKPRINPTRGSKFIPAKGGEIEFKNVSFNYPTRPTVPIF 450

Query: 446 KDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHI 505
           +++N K+  GSNVCIVGPSG+GKSTIA LLL YYNP+ GQIL+DGQDIS ++ K+LRRHI
Sbjct: 451 RNLNFKIEQGSNVCIVGPSGKGKSTIAWLLLHYYNPSQGQILIDGQDISALSTKSLRRHI 510

Query: 506 GLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGA 565
           G+VQQEPILMSGTIRDNITYGL    TKEEIRSVAKQCFCHNFIT+FPD YDT IG  G 
Sbjct: 511 GIVQQEPILMSGTIRDNITYGLTYTPTKEEIRSVAKQCFCHNFITRFPDTYDTAIGPHGT 570

Query: 566 LLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625
           LLSGGQ+QRIAIARALIKKP +L+LDEATSALDVESEGAINYTFGQLMKS SMTIVSIAH
Sbjct: 571 LLSGGQKQRIAIARALIKKPTVLILDEATSALDVESEGAINYTFGQLMKSKSMTIVSIAH 630

Query: 626 RLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPPPN 685
           RLSTI+RSENVIVLG DGSV+E GKFKELFANP SEL KLL EKSS   GN++ P   P 
Sbjct: 631 RLSTIRRSENVIVLGNDGSVVEQGKFKELFANPASELSKLLREKSS---GNNAAPEIQP- 686

Query: 686 ATQDKVVEQIAEKILERFPEAGQSPDA-------------TVKEIFKDVSSEGKPIKI 730
                  ++I++ I E    +G++  A             T+ E+ KD+S+EGKP+KI
Sbjct: 687 -------QEISQTIEEDPSFSGEATPASSVTGFKAETEAETINEVLKDISTEGKPLKI 737

>KLTH0C11616g Chr3 (956011..958233) [2223 bp, 740 aa] {ON} similar
           to uniprot|P33311 Saccharomyces cerevisiae YPL270W MDL2
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane
          Length = 740

 Score =  835 bits (2158), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/629 (63%), Positives = 506/629 (80%), Gaps = 5/629 (0%)

Query: 71  QKKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKD 130
           +K +++Y++ +RL  LA+ DW+LL  AI LLTIS  +GM+IPKVIG+VLD + K   G  
Sbjct: 100 EKSKTNYREILRLIRLARHDWKLLSVAIGLLTISSTVGMTIPKVIGIVLDAV-KNASGGF 158

Query: 131 LQNVNMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMN 190
              + ++DL PI +GL ++                NF RIV+LR+L E++VARLRS V+ 
Sbjct: 159 SGPMTLEDLPPIIYGLGMFDFLAIFAGILVFGTIANFGRIVLLRVLGEKLVARLRSNVIK 218

Query: 191 KTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPE 250
           K +HQD+EF+D +KVGDLISRL SDAYVVSRSMTQ VSDGFKA+ICGGVGIGMM++IS  
Sbjct: 219 KIIHQDAEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMINISAS 278

Query: 251 LSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRE 310
           L+  L  FAPP+L  A ++GKKIR  S++LQE+TG LT+V+EEQLSGVKT+Q+FVAE +E
Sbjct: 279 LTSALFLFAPPLLVGALIYGKKIRMISRELQESTGNLTKVSEEQLSGVKTIQAFVAEGKE 338

Query: 311 LHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTA 370
           LHRYN AIR +++ G+K A  NA FF+ST +LGD+SF++VL YGS+LVLQG L++GDLTA
Sbjct: 339 LHRYNNAIRKVFSFGKKEALTNATFFSSTGILGDLSFLIVLAYGSHLVLQGGLSVGDLTA 398

Query: 371 FMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFK 430
           FMLYTEYTGS+VFGL+ FYSELM+G GAASRLF++TDH S I P+ G+ Y+P  G+I+F+
Sbjct: 399 FMLYTEYTGSAVFGLSNFYSELMKGAGAASRLFEMTDHTSQIKPSSGKPYVPSWGEIKFE 458

Query: 431 NVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDG 490
           +VSFSYPTRP NQIF  +N  + PGSNVC+VGPSGRGKSTIA LLLRYY+P +G+I++DG
Sbjct: 459 DVSFSYPTRPGNQIFNKLNFTIEPGSNVCVVGPSGRGKSTIASLLLRYYDPNSGRIMIDG 518

Query: 491 QDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFIT 550
           Q+ISK++CK+LRRH+G+VQQEP+LMSG+IR N+TYG+    T +EIRSVAK+CFCH FIT
Sbjct: 519 QNISKLSCKSLRRHLGVVQQEPMLMSGSIRYNLTYGMNSEVTMDEIRSVAKKCFCHGFIT 578

Query: 551 KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFG 610
           KFP+GY+T+IG +GA LSGGQ+QRIAIARALIKKP IL+LDEATSALDVESEGAINYT G
Sbjct: 579 KFPEGYETVIGPRGASLSGGQKQRIAIARALIKKPKILILDEATSALDVESEGAINYTLG 638

Query: 611 QLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKS 670
           +LM+S  +TI+SIAHRLSTI+RSENVIVLG DGSV+E GKFKEL+AN  SEL KLL +K 
Sbjct: 639 RLMRSRELTIISIAHRLSTIRRSENVIVLGNDGSVVEMGKFKELYANDQSELFKLLNDKK 698

Query: 671 S---RSDGNDSLPPPPPNATQDKVVEQIA 696
               +S   +S+     N   D+V+EQ+A
Sbjct: 699 PTQLQSQSRNSV-ETKENEVDDQVLEQVA 726

>Kwal_56.22329 s56 complement(50448..52778) [2331 bp, 776 aa] {ON}
           YPL270W (MDL2) - ATP-binding cassette (ABC) transporter
           family member [contig 186] FULL
          Length = 776

 Score =  836 bits (2160), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/628 (64%), Positives = 494/628 (78%), Gaps = 2/628 (0%)

Query: 77  YKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNM 136
           YK+ +RLF LA  DW+LL  AI LL IS VIGMSIPKVIG+VLD + K         V +
Sbjct: 139 YKEVIRLFKLATHDWKLLTFAIGLLAISSVIGMSIPKVIGMVLDAI-KNTYSSATGPVGL 197

Query: 137 DDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQD 196
           DDL PI   L++Y+               NF RIV+LR+L E++VARLRS V+ K +HQD
Sbjct: 198 DDLPPIVNDLSMYEFLGIFAGALVIGTVANFGRIVLLRVLGEKLVARLRSNVIRKIIHQD 257

Query: 197 SEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLL 256
           +EF+D +KVGDLISRL SDAYVVSRSMTQ VSDGFKA+ICGGVGIGMMV+IS  L+  LL
Sbjct: 258 AEFFDRNKVGDLISRLSSDAYVVSRSMTQNVSDGFKAIICGGVGIGMMVNISISLTSALL 317

Query: 257 FFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNG 316
            FAPP+L  A ++GK+IR  S+DLQE+TG LTRV+EEQLSGVKT+QSFVAE +EL RYN 
Sbjct: 318 MFAPPLLIGALIYGKRIRMISRDLQESTGNLTRVSEEQLSGVKTIQSFVAEGKELQRYNT 377

Query: 317 AIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTE 376
           AIR ++  G+K A  NA FF+ST +LGD+SF++VL YGS+LVLQG LT+GDLTAFMLYTE
Sbjct: 378 AIRKVFLYGKKEALTNATFFSSTNVLGDLSFLIVLAYGSHLVLQGGLTVGDLTAFMLYTE 437

Query: 377 YTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSY 436
           YTGS+VFGL+ FYSELM+G GAASRLF++TDH  SI PT G+ Y+PG G I FK+VSFSY
Sbjct: 438 YTGSAVFGLSNFYSELMKGAGAASRLFEMTDHAPSIKPTAGKPYVPGSGKISFKDVSFSY 497

Query: 437 PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKV 496
           PTRP NQIF  +N  + PGSNVCIVGPSGRGKSTI  LLLRYYNP++GQI +D QDIS++
Sbjct: 498 PTRPGNQIFNKLNFTIEPGSNVCIVGPSGRGKSTITSLLLRYYNPSSGQITIDDQDISRL 557

Query: 497 NCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGY 556
           +CK+LRRH+G+VQQEP+LMSG+I+ N+TYGL    + +EIRSVAK+CFCH F+TKFP+GY
Sbjct: 558 SCKSLRRHLGVVQQEPMLMSGSIKYNLTYGLQSEVSMDEIRSVAKKCFCHGFVTKFPNGY 617

Query: 557 DTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG 616
           DT+IG +GA LSGGQ+QRIAIARAL+KKP IL+LDEATSALDVESEGAINYT G+LMKS 
Sbjct: 618 DTIIGPRGASLSGGQKQRIAIARALMKKPKILILDEATSALDVESEGAINYTLGKLMKSK 677

Query: 617 SMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGN 676
            +TI+SIAHRLSTI+RSENVIVLG DGSV+E GKFK+L+A+  SEL KLL +K       
Sbjct: 678 ELTIISIAHRLSTIRRSENVIVLGNDGSVVEVGKFKDLYADQQSELYKLLNDKKRDKPTP 737

Query: 677 DSLPPPPPNATQDKVVE-QIAEKILERF 703
                P  +  Q+  ++ Q+ E++   F
Sbjct: 738 RVQSDPEKDREQEHQIDNQVREQVANDF 765

>KLLA0D00748g Chr4 complement(69839..72208) [2370 bp, 789 aa] {ON}
           similar to uniprot|P33311 Saccharomyces cerevisiae
           YPL270W MDL2 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane
          Length = 789

 Score =  832 bits (2150), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/675 (60%), Positives = 512/675 (75%), Gaps = 28/675 (4%)

Query: 22  PLSYIRPLNIVR------------PQISLISIRIGVRWNSQLS------PSQEENRPKPV 63
           P+S IR LN               P   + S  I +R  ++ S        QE     P 
Sbjct: 39  PISSIRTLNYAVNRFGEMKGNQRFPSAGIRSFSITLRNRNEASDVGGNGKHQEGEDKTPD 98

Query: 64  KQILEPIQKKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLR 123
           K+  +P         D  RLF LA+ DW++L  A++LLT+SC IGM++PKVIGLVLD  +
Sbjct: 99  KKTNKPSSTVSGGLADVKRLFYLARHDWKMLVLAVSLLTVSCTIGMAVPKVIGLVLDATK 158

Query: 124 KGIEG----------KDLQNVNMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVML 173
             + G          +D +++ +DDL PI   + +Y                NF R+V+L
Sbjct: 159 NALSGSNTNNGNGGLEDSKSLTLDDLPPIVGDIQLYDFFLLFGGALLIGTMANFGRVVLL 218

Query: 174 RILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKA 233
           +IL ER+VARLRS V+ KT+H D EFYD +KVGDL+SRLG+DAY+VSRSMTQ +SDGFKA
Sbjct: 219 KILGERLVARLRSNVIKKTMHHDMEFYDRNKVGDLLSRLGADAYIVSRSMTQNISDGFKA 278

Query: 234 LICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEE 293
           LICGGVGIGMM  IS  L+ VL  FAPP+L  A+++G KIR  S++LQ+A+G LT+VAEE
Sbjct: 279 LICGGVGIGMMFHISSTLASVLFLFAPPLLVGATIYGNKIRAISRELQQASGNLTKVAEE 338

Query: 294 QLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLY 353
           QLSG+KTVQSFVAE +E+HRYN A+R ++NVG+K AF NA FF+ST +LGD SF++VL Y
Sbjct: 339 QLSGIKTVQSFVAEGKEVHRYNNAVRQVFNVGKKEAFTNATFFSSTNVLGDFSFLLVLAY 398

Query: 354 GSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSIS 413
           GS+LVLQG+LTIGDLTAFMLYTEYTGS+VFGL+TFYSELM+G GAA+RLF+L D+  +I 
Sbjct: 399 GSHLVLQGNLTIGDLTAFMLYTEYTGSAVFGLSTFYSELMKGAGAATRLFELLDYKPTIK 458

Query: 414 PTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIAL 473
            T G+ + P  G +EF++VSFSYPTR  NQIFKD+N  + PGSNVCIVGPSGRGKSTIA 
Sbjct: 459 STTGKAFKPLNGKVEFQHVSFSYPTRKTNQIFKDLNFTIEPGSNVCIVGPSGRGKSTIAS 518

Query: 474 LLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATK 533
           LLLRYYNPT+G+ILVDGQDI+K++ K+LRR +G+VQQEPILMSGTIR+NITYG++   + 
Sbjct: 519 LLLRYYNPTSGKILVDGQDITKLSSKSLRRQLGVVQQEPILMSGTIRENITYGVSRQPSM 578

Query: 534 EEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEA 593
           EEIRSVAK+CFCH FI+KFP+GY+T+IG +GALLSGGQ+QRIAIARAL+ KP IL+LDEA
Sbjct: 579 EEIRSVAKKCFCHAFISKFPNGYETIIGPRGALLSGGQKQRIAIARALLNKPKILILDEA 638

Query: 594 TSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKE 653
           TSALDVESEGAINYT G+LMKS  +TI+SIAHRLSTI+RSENVIVLG DGSV+E GKFK+
Sbjct: 639 TSALDVESEGAINYTLGRLMKSKELTIISIAHRLSTIRRSENVIVLGIDGSVVEMGKFKD 698

Query: 654 LFANPNSELCKLLTE 668
           L+AN +S L KLLTE
Sbjct: 699 LYANHDSALHKLLTE 713

>Ecym_3007 Chr3 complement(14335..16644) [2310 bp, 769 aa] {ON}
           similar to Ashbya gossypii ACR022W
          Length = 769

 Score =  814 bits (2103), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/687 (58%), Positives = 505/687 (73%), Gaps = 30/687 (4%)

Query: 70  IQKKES-SYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEG 128
           +QK+ S  +++ +RL SLAK DW+LL  AI LL++SC IGM++PKVIGLVLD  +  ++ 
Sbjct: 89  VQKETSVGWREVLRLCSLAKHDWKLLAVAIGLLSVSCTIGMAVPKVIGLVLDATKNTLKS 148

Query: 129 ------KDLQNVN-------------MDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFAR 169
                 +DL+ VN             +D L PI   L+I Q               NF R
Sbjct: 149 SYEKGSQDLEGVNEDKESLIAGPIASLDALPPIVGTLSITQFVGIFAGALVVGATANFGR 208

Query: 170 IVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSD 229
           +V+L+I+ ER+V+RLRS V+ +T+H D EF+D +KVGDLISR GSDAYVVSRSMTQ VSD
Sbjct: 209 VVLLKIIGERLVSRLRSQVIKRTMHHDIEFFDRNKVGDLISRFGSDAYVVSRSMTQNVSD 268

Query: 230 GFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTR 289
           GFKA+ICGGVG+GMM  IS  L+ V+L FAPP+L  A ++GKKI   S+ LQ+++G LTR
Sbjct: 269 GFKAIICGGVGMGMMFHISSTLTSVMLLFAPPLLVGAFIYGKKISAISRQLQQSSGNLTR 328

Query: 290 VAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIV 349
           VAEEQL+G++T++SFVAE++E+ RYN AIR ++ VG++ AF NA FF+STT+LGDMSF++
Sbjct: 329 VAEEQLNGIRTIKSFVAEKKEIRRYNDAIRQLFYVGKREAFTNATFFSSTTILGDMSFVI 388

Query: 350 VLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHI 409
           VLLYG+ LVLQG+L+IGDLTAFMLYTEYTGSSVFGL+TFYSELM+G GAASRLF+L DH 
Sbjct: 389 VLLYGANLVLQGALSIGDLTAFMLYTEYTGSSVFGLSTFYSELMKGAGAASRLFELMDHK 448

Query: 410 SSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKS 469
           +S+         P +G IEF++VSFSYPTRP NQIFK ++  + PGSNVCIVGPSG+GKS
Sbjct: 449 NSVRSNISHALTPTQGKIEFRDVSFSYPTRPSNQIFKHMSFTIEPGSNVCIVGPSGKGKS 508

Query: 470 TIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAE 529
           TI  LLLR+Y+P  G IL+D  DISK   K+LRRH+G+VQQEP LMSGTIRDNITYGL+ 
Sbjct: 509 TITSLLLRFYDPNYGSILIDNHDISKFTTKSLRRHLGVVQQEPTLMSGTIRDNITYGLSY 568

Query: 530 PATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV 589
             T +EIR V+KQCFCH FITKFPDGYDT+IG +GA LSGGQRQRIAIARALIKKP IL+
Sbjct: 569 TPTMDEIRVVSKQCFCHGFITKFPDGYDTVIGPRGASLSGGQRQRIAIARALIKKPKILI 628

Query: 590 LDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAG 649
           LDEATSALDVESEGAINYT G LM+S  +TI+SIAHRLSTI+RSEN+IV+G DGSV+E G
Sbjct: 629 LDEATSALDVESEGAINYTLGTLMRSKELTIISIAHRLSTIRRSENIIVVGNDGSVVEVG 688

Query: 650 KFKELFANPNSELCKLLTEKS----SRSDGNDSLPPPPPNATQDKVVEQIAEKILERFPE 705
           KF +L+ N  SEL KLL EK     S+S+    +PP  P       +E +  +      +
Sbjct: 689 KFDKLYRNEESELFKLLNEKDHDLVSKSENTSDIPPDSPKNDDASGLEHLVAE------D 742

Query: 706 AGQSPDATVKEIFKDVSSEGKPIKITP 732
                D  VK +  D++ +     + P
Sbjct: 743 VASINDKVVKNVLNDITHDKNSSTLRP 769

>ACR022W Chr3 (395427..397691) [2265 bp, 754 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL270W (MDL2)
          Length = 754

 Score =  781 bits (2016), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/706 (55%), Positives = 516/706 (73%), Gaps = 14/706 (1%)

Query: 31  IVRPQISLISIRIGVRWNSQLSPSQEENRPKPVKQILEPIQK---KESSYKDAVRLFSLA 87
           + R   +  + R+G          + E   K  K+  EP +    K + + +  RL  L 
Sbjct: 54  VCRQSRAYSAARVGGEGTPSPRDKEHEQERKVEKRPAEPSRAQPAKPAGWHEVFRLLRLV 113

Query: 88  KRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQN----VNMDDLGPIA 143
           K DW+LL AA+ LLTISC IGM++PKVIGLVLD  +  +   +       +++ D+  I 
Sbjct: 114 KPDWKLLLAALGLLTISCSIGMAVPKVIGLVLDATKDAVAQAEKNETGAPMSLLDMPSII 173

Query: 144 FGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTH 203
              T+                 NF R+ +L++L ER+VARLR+ V+ KTLH D+EF+D +
Sbjct: 174 GNFTLVDVLAAFAGALLVGSAANFGRMFLLKMLGERLVARLRAQVIKKTLHHDAEFFDRN 233

Query: 204 KVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPIL 263
           KVGDLISRLGSDAY+VSRSMT  +SDG KA +CGGVG+GMM  IS  L+  ++ FAPP+L
Sbjct: 234 KVGDLISRLGSDAYIVSRSMTHNISDGVKAALCGGVGVGMMFHISSTLTSAMIMFAPPLL 293

Query: 264 WSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN 323
            +A+++GK+IR  S++LQ++TG LTRV+EEQ +G+KT++SFVAE +E+ RYN A+R ++N
Sbjct: 294 IAATIYGKRIRAISRELQQSTGNLTRVSEEQFNGIKTIKSFVAEGKEMRRYNTAVRRLFN 353

Query: 324 VGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVF 383
           V ++    +A FF+ T +LGD+SF++VL YGS+LVLQG L++G LTAFMLYTEYTGSSVF
Sbjct: 354 VAKREGITSATFFSGTNVLGDVSFLLVLAYGSHLVLQGELSLGSLTAFMLYTEYTGSSVF 413

Query: 384 GLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQ 443
           GL+ FYSELM+G GAASRLF+LTD+  S+  T GQ ++P  G IEFK+VSFSYPTRP +Q
Sbjct: 414 GLSNFYSELMKGAGAASRLFELTDYKKSVPSTVGQTFVPRDGRIEFKDVSFSYPTRPTSQ 473

Query: 444 IFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRR 503
           IFK + + + PGSNVCIVGPSGRGKSTIA LLLR+Y+  +G IL+DGQDISKV+ K+LR+
Sbjct: 474 IFKKLRLTITPGSNVCIVGPSGRGKSTIASLLLRFYDANSGTILIDGQDISKVSAKSLRK 533

Query: 504 HIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQ 563
           H+G+VQQEP+LMSGTIRDNITYGL+   + +EIR+VAK+CFCHNFITKFPDGYDT+IG +
Sbjct: 534 HLGVVQQEPVLMSGTIRDNITYGLSYTPSMDEIRAVAKKCFCHNFITKFPDGYDTVIGPR 593

Query: 564 GALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSI 623
           GALLSGGQRQRIAIARALIKKP IL+LDEATSALDVESEGAINYT G+LM+S  +TIVSI
Sbjct: 594 GALLSGGQRQRIAIARALIKKPKILILDEATSALDVESEGAINYTLGRLMRSKEITIVSI 653

Query: 624 AHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPP 683
           AHRLSTI+RSEN++VLG DGSVIEAGKF +L+ + +SEL KLL E +S     ++ P P 
Sbjct: 654 AHRLSTIRRSENIVVLGNDGSVIEAGKFADLYRDEDSELFKLLNEHASEPAKPEASPAP- 712

Query: 684 PNATQDKVVEQIAEKILERFPEAG--QSPDATVKEIFKDVSSEGKP 727
             A ++    Q A+  + R  E G  +  +  +K + +D +    P
Sbjct: 713 --AQEEASAPQAAD--IPRDIEGGNLRLNEEVIKHVLEDTARAPMP 754

>KAFR0B06480 Chr2 complement(1344413..1346668) [2256 bp, 751 aa]
           {ON} Anc_6.5 YPL270W
          Length = 751

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/706 (57%), Positives = 509/706 (72%), Gaps = 33/706 (4%)

Query: 53  PSQEENRPKPVKQILEPIQKKE-------SSYKDAVRLFSLAKRDWRLLCAAIALLTISC 105
           PS+    P+ + Q L P +  +       SS++D  RL  L K+D +LL  AI LLTISC
Sbjct: 52  PSRTNFIPRTLPQFLVPHRTLKTASTDNGSSWRDLKRLTVLIKKDIKLLVLAIVLLTISC 111

Query: 106 VIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDDLGPIA-FGLTIYQXXXXXXXXXXXXXX 164
            IGM+IPK+IG +LD LR   E       N+  L  I    + +                
Sbjct: 112 SIGMAIPKIIGTILDTLRNNYE-------NLTSLSQIKILNIPLSTFLMGVGITLIFGCF 164

Query: 165 XNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMT 224
            NF R+V+LRI+SER+V+RLRS V+   +H+D EF+DT KVGDL+SR+G+DA+VVSRS+T
Sbjct: 165 ANFGRVVILRIISERLVSRLRSQVVKNIIHKDLEFFDTFKVGDLMSRVGNDAFVVSRSIT 224

Query: 225 QKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEAT 284
            KV+DG ++   G  GIG+M+++S EL+G L    PPI+W  SVFGK+IR  SK LQ+ T
Sbjct: 225 HKVADGVRSGFIGIFGIGLMLTLSRELTGALFAILPPIIWCTSVFGKQIRMNSKKLQDVT 284

Query: 285 GQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGD 344
           G LTRV EEQ +G++TVQ FVAE+ E+ R+N  +R I+ VG+++AFIN +FFTS +++GD
Sbjct: 285 GDLTRVTEEQFNGIRTVQGFVAERNEIKRFNNVLREIFQVGKESAFINGKFFTSASLIGD 344

Query: 345 MSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFD 404
           + F++VL YGSYLV+ GS++IGDLTAFMLYTEYTG+++FGL++FYSELMQGVGAASR+F+
Sbjct: 345 LGFLIVLTYGSYLVMHGSMSIGDLTAFMLYTEYTGNAIFGLSSFYSELMQGVGAASRIFE 404

Query: 405 LTDHISSISPTKGQ-KYIP----GKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVC 459
           + D    I  T G+ K+ P    G  +IEFKNVSF YPTRP NQIFK++N KVP GSNVC
Sbjct: 405 INDKEPKIKSTTGEAKFKPLNEVGGCEIEFKNVSFFYPTRPTNQIFKNLNFKVPAGSNVC 464

Query: 460 IVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTI 519
           IVGPSGRGKSTIA LLL +YN  +GQIL+DGQDI+ +N K+LRR IG+VQQEPILMSGTI
Sbjct: 465 IVGPSGRGKSTIASLLLHHYNAVSGQILIDGQDIATLNTKSLRRKIGIVQQEPILMSGTI 524

Query: 520 RDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYD--TMIGAQGALLSGGQRQRIAI 577
           RDNITYGL E  +KEEIR VAKQCFCHNFITKFPD YD     G+ G  LSGGQ+QRIAI
Sbjct: 525 RDNITYGLTEEPSKEEIRLVAKQCFCHNFITKFPDTYDTTIGSGSSGTSLSGGQKQRIAI 584

Query: 578 ARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVI 637
           ARALIKKPNIL+LDEATSALDVESEGAINYTFGQ+MKS SMTIVSIAHRLSTI+R E+VI
Sbjct: 585 ARALIKKPNILILDEATSALDVESEGAINYTFGQIMKSKSMTIVSIAHRLSTIRRFEDVI 644

Query: 638 VLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPPP------NATQDKV 691
           VLG DGSV+E GKFKEL+ NP SEL KLL EKSS  +       PPP      N  + K 
Sbjct: 645 VLGNDGSVVEMGKFKELYDNPTSELSKLLNEKSSTKEATPQPVNPPPFIDLQTNPEEKKE 704

Query: 692 VEQIAEKILERFPEAGQS---PD--ATVKEIFKDVSSEGKPIKITP 732
            +  +E+   +  ++ +    PD   +  +  K+  +EG PIKITP
Sbjct: 705 ADNASEENGAKLDDSKEDVSVPDNMTSSDDSLKEAVNEGGPIKITP 750

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
           Ashbya gossypii AFR683C
          Length = 683

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/669 (44%), Positives = 432/669 (64%), Gaps = 22/669 (3%)

Query: 23  LSYIRPLNIVRPQISLIS-IRIGVRWNSQLS-----PSQEENRPKPVKQILEPIQKKESS 76
           LS + P+     Q+ L S I +  RW + ++     PS+  NR + ++  L     KE  
Sbjct: 22  LSGLSPIRGRLSQVVLKSEIHVQRRWQNSINVRGVPPSEASNRLQVLR--LSGADSKEYG 79

Query: 77  YKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRK---GIEGKDLQN 133
           +K+  RLF LA+ + + L  A+ L+ IS  + M+IP VIG +LD+ ++   G +G + Q 
Sbjct: 80  FKNVRRLFQLARPEAKSLAFALLLIVISGAVSMTIPSVIGKLLDISKEKEAGGDGDEEQE 139

Query: 134 VNMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTL 193
             +       +GLT  Q               N  RIV+L++  E++VARLR+  M   L
Sbjct: 140 TRI-------YGLTEKQFYTALGGVFVIGACANVGRIVILKVTGEKLVARLRTKTMKAAL 192

Query: 194 HQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSG 253
            QD+ F D ++VGDLISRL SDA +VS+S+TQ  SDG +A+I G VG GMM  IS +L+G
Sbjct: 193 QQDAAFLDYNRVGDLISRLSSDASIVSKSITQNTSDGARAVIQGMVGFGMMGYISAQLTG 252

Query: 254 VLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHR 313
           V+L  APP++  A V+G++IR+ +++LQ   G LT+VAEEQL+  +T+QS+  E++E+ R
Sbjct: 253 VMLLLAPPLVLMAMVYGRRIRNLTRELQTRVGGLTKVAEEQLNATRTIQSYCGERKEIRR 312

Query: 314 YNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFML 373
           Y   +R ++ VG + A  +  FF +T ++G+M+ + +LL G+ ++  G++T+G+L++FM+
Sbjct: 313 YAEEVRSVFRVGLREAVTSGAFFGTTGLMGNMALLALLLTGTSMIRSGAITVGELSSFMM 372

Query: 374 YTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIP-GKGDIEFKNV 432
           Y  YTGSS+FGL++FYSELM+G GAASR+F+L D +  I PTKG+  I     +IEFKNV
Sbjct: 373 YAVYTGSSLFGLSSFYSELMKGAGAASRVFELNDRVPLIHPTKGKDPISLAAKEIEFKNV 432

Query: 433 SFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQD 492
            FSYP+R  + +F ++N+K+ PG +VC+VGPSG GKSTI+ LLLR+Y+  +G I + GQ+
Sbjct: 433 KFSYPSRSNHTVFTELNLKIIPGEHVCVVGPSGGGKSTISSLLLRFYDVDSGVITIGGQN 492

Query: 493 ISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEP--ATKEEIRSVAKQCFCHNFIT 550
           I   N +  RR +G+VQQEP+L +G+I+DNI Y L     + K  +    +   C  FI+
Sbjct: 493 IKDFNLRKYRRSLGIVQQEPLLFNGSIKDNICYALPPHIISDKHRVNRALEAANCTRFIS 552

Query: 551 KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFG 610
            FPDG DTM+G +G  LSGGQ+QRIAIARA I  P+IL+LDEATSALD +SE  I     
Sbjct: 553 NFPDGLDTMVGPRGTQLSGGQKQRIAIARAFILDPSILILDEATSALDSQSEDIIAQALR 612

Query: 611 QLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKS 670
              +SG +TI SIAHR+STI+ S  VIVL ++G V E G F +L   PNS L KLL+++ 
Sbjct: 613 ARSESGKITI-SIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQPNSNLNKLLSKEH 671

Query: 671 SRSDGNDSL 679
              D +D L
Sbjct: 672 ELQDVHDQL 680

>Kpol_2000.79 s2000 complement(175048..177171) [2124 bp, 707 aa]
           {ON} complement(175048..177171) [2124 nt, 708 aa]
          Length = 707

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/654 (44%), Positives = 420/654 (64%), Gaps = 27/654 (4%)

Query: 45  VRWNSQLS---------PSQEENRPKPVK-QILEPIQKKESSYKDAVRLFSLAKRDWRLL 94
           VRW S +S          +QE     P K Q L P +   S +KD  RLF LA+ +   +
Sbjct: 55  VRWTSNISDASSTVNAVAAQERELKIPPKIQKLTPDESGRSGFKDVKRLFELARPETFYI 114

Query: 95  CAAIALLTISCVIGMSIPKVIGLVLDVLR---------KGIEGKDLQNVNMDDLGPIAFG 145
             A+ L+ IS  + M +P VIG +LD+ +         KG+  K  +  + D      +G
Sbjct: 115 SIALLLIFISSAVSMVVPSVIGKLLDIAKPPSADEENGKGVSEKLKEKEDEDKK---IYG 171

Query: 146 LTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKV 205
           LT  Q               N  RI++L++  ER+VARLR+  M   L Q++ F D++KV
Sbjct: 172 LTALQFYTALGVVFTVGALANTGRIIILKVTGERLVARLRTRTMKAALEQEAAFLDSNKV 231

Query: 206 GDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWS 265
           GDLISRL +DA +V++S+TQ VSDG +A++ G VG GMM  IS +L+ V+L   PP+   
Sbjct: 232 GDLISRLSTDASIVAKSVTQNVSDGTRAILQGFVGFGMMSYISWQLTSVMLLLIPPLGAM 291

Query: 266 ASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVG 325
           A ++G+KIR+ S+ LQ + G LT+VAEEQL+  +T+Q++  E++E+HRY   +R ++++G
Sbjct: 292 AIIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKKEIHRYATEVRNVFDIG 351

Query: 326 RKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGL 385
            K A  +  FF ST ++G+ + + +L+ G+ ++  G+LT+G+L++FM+Y  YTGSS+FGL
Sbjct: 352 YKEAVTSGLFFGSTGLVGNTALLSLLVVGTNMISSGALTVGELSSFMMYAVYTGSSLFGL 411

Query: 386 TTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGD-IEFKNVSFSYPTRPENQI 444
           +TFYSELM+G GAA+R+F+L+D   +I PT G+  I   G  +EFKNVSF YPTRP+ QI
Sbjct: 412 STFYSELMKGAGAAARVFELSDRKPAIKPTIGKDPITLFGKTVEFKNVSFWYPTRPKQQI 471

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           F+D +IK+ PG +VC VGPSG GKST++ LLLRYY+   G ILV G+DI   + +  RR 
Sbjct: 472 FQDFSIKIEPGEHVCFVGPSGSGKSTVSSLLLRYYDVAKGSILVGGEDIKNFSLRKYRRL 531

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKE--EIRSVAKQCFCHNFITKFPDGYDTMIGA 562
           +G+VQQEP+L +GTI +NI Y + E    E   I    +   C  F+  FPDG +T++G 
Sbjct: 532 LGVVQQEPMLFNGTILENILYSVPEEIANEPGRIERAIESANCSKFLNNFPDGLNTLVGP 591

Query: 563 QGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVS 622
           +G  LSGGQ+QRIA+AR  +  P+IL+LDEATSALD +SE  I        + G  TI S
Sbjct: 592 RGTQLSGGQKQRIALARTFLLDPSILILDEATSALDSQSEDIIAQNLQARNEKGQTTI-S 650

Query: 623 IAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLT-EKSSRSDG 675
           IAHRLSTIK S  V+VLGK+G V+E G F+EL +NP+S L  LLT E+SS ++G
Sbjct: 651 IAHRLSTIKHSSRVVVLGKNGCVVETGTFQELISNPSSGLNILLTQEESSANEG 704

>TDEL0C06350 Chr3 complement(1159576..1161657) [2082 bp, 693 aa]
           {ON} Anc_1.67 YLR188W
          Length = 693

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/648 (45%), Positives = 419/648 (64%), Gaps = 12/648 (1%)

Query: 29  LNIVRPQISLISIRIGVRWNSQLSPSQEENRPKPVKQI----LEPIQKKESSYKDAVRLF 84
           +  V P+I L ++   VRWNS        N    V  +    L P     S +KD  RLF
Sbjct: 39  MKTVAPKIQL-TVERQVRWNSTQRAPVNVNSNASVTAVKEAKLSPSDLNGSGFKDIKRLF 97

Query: 85  SLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDDLGPIAF 144
            LAK +   +  A+ L+ IS  + M+IP ++G +LD+ +   + KD  +   DD GP  F
Sbjct: 98  RLAKPETLQIALALVLILISSAVSMTIPTIVGKLLDIAK---DRKDADDTTEDDEGPKIF 154

Query: 145 GLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHK 204
           G+T  Q               N  RIV+L+I  ER+VARLR+  M   L QD+ F DT++
Sbjct: 155 GMTTKQFCTALLAVFLVGAAANAGRIVILKITGERLVARLRTRTMKAALDQDATFLDTNR 214

Query: 205 VGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILW 264
           VGDLIS L SDA +V++S+TQ VSDG +A+I G VG GMM  IS +L+ V++   PP+  
Sbjct: 215 VGDLISCLSSDASIVAKSVTQNVSDGTRAVIQGFVGFGMMGYISWQLTSVMILMIPPLGI 274

Query: 265 SASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNV 324
            A V+G+KIR+ S+ LQ + G LT+V+EEQL  VKT+QS+V E++E+HRY   +R ++N+
Sbjct: 275 MAVVYGRKIRNLSRQLQTSVGGLTKVSEEQLGAVKTIQSYVGEKKEIHRYATEVRNVFNI 334

Query: 325 GRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFG 384
           G K A  +  FF ST ++G++S + +L+ G+ ++  G +T+GDL++FM+Y  YTGSS+FG
Sbjct: 335 GLKEALTSGVFFGSTGLVGNISLLALLMVGTNMIQNGLITVGDLSSFMMYAVYTGSSMFG 394

Query: 385 LTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIP-GKGDIEFKNVSFSYPTRPENQ 443
           L++FYSELM+G GAA+R+F+L D    I PT GQ  +      I F+NVSF+YPTR   +
Sbjct: 395 LSSFYSELMKGAGAAARVFELKDRKPLIPPTIGQDPVTLANKTIRFENVSFTYPTRLNQK 454

Query: 444 IFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRR 503
           IF  ++I V PG +VCIVGPSG GKST+A LLLRYY+   G+I++   +I+  N +  RR
Sbjct: 455 IFDGLDITVEPGEHVCIVGPSGSGKSTVASLLLRYYDTNEGRIMIGDHNINSFNVRKYRR 514

Query: 504 HIGLVQQEPILMSGTIRDNITYGL-AEPATKEEIRSVA-KQCFCHNFITKFPDGYDTMIG 561
            +G+VQQEP L +GTI DNI Y +  E A  +++ S A  Q  C  F+  FPDG  T++G
Sbjct: 515 LLGIVQQEPQLFNGTILDNILYTVPPERADNDDLISTAIGQANCSKFLANFPDGLQTLVG 574

Query: 562 AQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIV 621
            +GA LSGGQ+QRIA+ARA +  P++L+LDEATSALD +SE  +  T    ++ G +T +
Sbjct: 575 PRGAQLSGGQKQRIALARAFLLDPSLLILDEATSALDSQSEEIVAQTLRVRVQRG-LTTI 633

Query: 622 SIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEK 669
           SIAHRLSTIK    V+VLGK G V+E+G F+EL  NP SEL  LL+++
Sbjct: 634 SIAHRLSTIKNCTRVVVLGKCGQVVESGPFEELLRNPLSELSILLSQQ 681

>NDAI0A00560 Chr1 complement(100930..103074) [2145 bp, 714 aa] {ON}
           Anc_1.67
          Length = 714

 Score =  547 bits (1410), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/658 (44%), Positives = 423/658 (64%), Gaps = 16/658 (2%)

Query: 39  ISIRIGVRWNSQLSPSQEENRPKPVKQILEPIQ------KKESSYKDAVRLFSLAKRDWR 92
           ++IR  + WNS  + S   N  KP   I+  I+       K S +KD  RLFSLA+ + R
Sbjct: 52  VTIRSQLCWNS--TKSNHNNILKPENDIVPDIKGQMLRDSKSSGFKDIQRLFSLARPELR 109

Query: 93  LLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDDLGPIAFGLTIYQXX 152
            +  A+  + IS  + M++P +IG +LD  +KG +  + ++          FGLT  Q  
Sbjct: 110 YIALALLFILISSSVSMTVPSIIGKLLDAAKKGQKENEEEDSKTIVPDITFFGLTRTQFY 169

Query: 153 XXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRL 212
                        N  RI++L++  ER+VARLR+  M   L QD+ F D ++VGDLISRL
Sbjct: 170 TALGVLFLVGAIANTGRIIILKVTGERLVARLRTRTMKAALDQDATFLDANRVGDLISRL 229

Query: 213 GSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKK 272
            SDA +VS+++TQ VSDG +A+I G VG GMM  +S +L+GV++   PP+   A V+G+K
Sbjct: 230 SSDAAIVSKAVTQNVSDGTRAIIQGFVGFGMMGYLSWKLTGVMMLMVPPLGIMALVYGRK 289

Query: 273 IRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFIN 332
           IR+ SK LQE+ G L++VAEEQL+  KT+Q++V E+ E+HRY   +R ++ +G K A  +
Sbjct: 290 IRNLSKQLQESVGGLSKVAEEQLNATKTIQAYVGERLEIHRYATEVRNVFRIGLKEAVTS 349

Query: 333 AEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSEL 392
             FF ST ++G+++ I +LL G+ ++  G+LT+G+L++FM+Y  YTGSS+FGL++FYSEL
Sbjct: 350 GLFFGSTGLVGNIAMISLLLVGTNMIQSGTLTVGELSSFMMYAVYTGSSLFGLSSFYSEL 409

Query: 393 MQGVGAASRLFDLTDHISSISPTKG--QKYIPGKGDIEFKNVSFSYPTRPENQIFKDINI 450
           M+G GAASR+F+L D    I  T G   K + GK  I+F+NVSF+YP+RP ++IF ++N+
Sbjct: 410 MKGAGAASRVFELNDRKPLIKSTVGIDPKTLFGK-SIKFENVSFTYPSRPNHKIFDNLNL 468

Query: 451 KVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQ 510
           ++ PG +VCIVG SG GKSTIA LLLRYY+  NG I +   DI   + +  RR IG VQQ
Sbjct: 469 EINPGEHVCIVGFSGSGKSTIASLLLRYYDVNNGSIRIGDNDIRNFSLRKYRRLIGTVQQ 528

Query: 511 EPILMSGTIRDNITYGLAEPATKEE----IRSVAKQCFCHNFITKFPDGYDTMIGAQGAL 566
           EP L +G+I DNI Y +    T E+    ++   KQ  C+ F+ KFPDG  T++G +GA 
Sbjct: 529 EPSLFNGSILDNIIYAIPPELTSEKQHERVQLAIKQANCNIFLGKFPDGLQTLVGPRGAQ 588

Query: 567 LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHR 626
           LSGGQ+QRIA+ARA +  P +L+LDE+TSALD  SE  +  T  Q   +  +T +SIAHR
Sbjct: 589 LSGGQKQRIALARAFLLDPTLLILDESTSALDSLSEELVAKTL-QARSARGLTTISIAHR 647

Query: 627 LSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPPP 684
           LSTIK S  VIV+GK GSV+E+G F  L  NP SEL  LL++++   D + S     P
Sbjct: 648 LSTIKHSSRVIVIGKYGSVVESGPFDRLIDNPKSELNMLLSQQNEHIDEDPSQEKQEP 705

>SAKL0C02244g Chr3 (201281..203419) [2139 bp, 712 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 712

 Score =  539 bits (1389), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/642 (44%), Positives = 412/642 (64%), Gaps = 18/642 (2%)

Query: 46  RWNSQLSPSQEENRPKPVKQI-LEPIQKKESSYKDAVRLFSLAKRDWRLLCAAIALLTIS 104
           R N+  S  Q++   + +K + L P   K S +KD  RLF LAK +   +  A+  + IS
Sbjct: 72  RLNT--STEQDQKTLQTLKTLKLSPHDSKASGFKDIKRLFLLAKPETNSMILALVFILIS 129

Query: 105 CVIGMSIPKVIGLVLDVLRKG-----------IEGKDLQNVNMDDLGPIAFGLTIYQXXX 153
             + M+IP VIG +LD  ++G           +   D  +   D    + +GLT  Q   
Sbjct: 130 GAVSMTIPSVIGKLLDAAKEGHLAGVSASGEGVGSSDSSDNQEDSSDRLIYGLTFPQFYT 189

Query: 154 XXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLG 213
                       N  RIV+L++  E++VARLR+  M   L QD+ F D ++VGDLISRL 
Sbjct: 190 ALGTIFVVGAFANMGRIVLLKVTGEKLVARLRTRTMKAALQQDATFLDNNRVGDLISRLS 249

Query: 214 SDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKI 273
           SDA +VS+S+TQ +SDG +A+I G VG GMM  IS +L+ V+   APP+   A V+GKKI
Sbjct: 250 SDASIVSKSVTQNLSDGARAVIQGAVGFGMMSFISWKLTCVMTLMAPPLAVMAMVYGKKI 309

Query: 274 RHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINA 333
           R+ S+ LQ + G LT+VAEEQLS  +TVQ++  E++E+ RY G +R ++N+G K A  + 
Sbjct: 310 RNLSRQLQTSVGGLTKVAEEQLSAARTVQAYGGEKQEIRRYAGEVRNVFNIGLKEALTSG 369

Query: 334 EFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELM 393
            FF  T  +G+++ + +LL G+ ++  G++T+GDL++FM+Y  YTGSS+FGL++FYSELM
Sbjct: 370 VFFGVTGFVGNVALLALLLTGTSMIRSGAITVGDLSSFMMYAVYTGSSLFGLSSFYSELM 429

Query: 394 QGVGAASRLFDLTDHISSISPTKGQKYIPGKGD-IEFKNVSFSYPTRPENQIFKDINIKV 452
           +G GAA+R+F+L D    I PTKG   +  +G  IEF+NV+F+YPTR EN+IF  +++ +
Sbjct: 430 KGAGAAARVFELNDRKPLIHPTKGVDPVTLQGKTIEFRNVAFAYPTRRENRIFDGLSLDI 489

Query: 453 PPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEP 512
            PG +VCIVGPSG GKSTIA LLLRYY+   G+I + GQDI + N +  RR +G+VQQEP
Sbjct: 490 QPGEHVCIVGPSGGGKSTIASLLLRYYDVDAGRIAIGGQDIRRFNLRKYRRLLGVVQQEP 549

Query: 513 ILMSGTIRDNITYGLAEPATKEEIR--SVAKQCFCHNFITKFPDGYDTMIGAQGALLSGG 570
           +L +GTI DNITY +      ++ R      Q  C  F+  FPDG +T++G +GA +SGG
Sbjct: 550 LLFNGTILDNITYAVPGELAGDDSRVSRAIGQANCTKFLANFPDGLETLVGPRGAQMSGG 609

Query: 571 QRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTI 630
           Q+QRIA+ARA +  P +L+LDEATSALD +SE  +  +     + G  T VSIAHRLSTI
Sbjct: 610 QKQRIALARAFLLDPAVLILDEATSALDSQSEEVVAQSLRSRSRRGK-TTVSIAHRLSTI 668

Query: 631 KRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSR 672
           + S  VIVL + G V E G F+EL ++P+S L +LL ++  R
Sbjct: 669 QHSSRVIVLDRHGGVGETGSFRELISDPDSHLTQLLLKEEER 710

>YLR188W Chr12 (528300..530387) [2088 bp, 695 aa] {ON}
           MDL1Mitochondrial inner membrane half-type ATP-binding
           cassette (ABC) transporter, mediates export of peptides
           generated upon proteolysis of mitochondrial proteins,
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 695

 Score =  538 bits (1385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/658 (44%), Positives = 426/658 (64%), Gaps = 14/658 (2%)

Query: 16  SKSQLRPLSYIRP-LNIVRPQISLISIRIGVRWNSQLSPSQEENRPKPVKQILEPIQKKE 74
           +KS  +P  Y +  +N++ P      +R  +R  S ++  ++  +P      L     K 
Sbjct: 28  TKSLFKPPMYQKAEINLIIPHRKHFLLR-SIRLQSDIAQGKKSTKPTLK---LSNANSKS 83

Query: 75  SSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNV 134
           S +KD  RLF L+K + + +  A+ L+ IS  + M++P VIG +LD+  +  +G+D +  
Sbjct: 84  SGFKDIKRLFVLSKPESKYIGLALLLILISSSVSMAVPSVIGKLLDLASES-DGEDEEGS 142

Query: 135 NMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLH 194
             + L    +G T  Q               N +RI++L++  ER+VARLR+  M   L 
Sbjct: 143 KSNKL----YGFTKKQFFTALGAVFIIGAVANASRIIILKVTGERLVARLRTRTMKAALD 198

Query: 195 QDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGV 254
           QD+ F DT++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM  +S +L+ V
Sbjct: 199 QDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCV 258

Query: 255 LLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRY 314
           ++  APP+   A ++G+KIR+ S+ LQ + G LT+VAEEQL+  +T+Q++  E+ E+ RY
Sbjct: 259 MMILAPPLGAMALIYGRKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVRRY 318

Query: 315 NGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLY 374
              +R ++++G K A  +  FF ST ++G+ + + +LL G+ ++  GS+T+G+L++FM+Y
Sbjct: 319 AKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTSMIQSGSMTVGELSSFMMY 378

Query: 375 TEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIP-GKGDIEFKNVS 433
             YTGSS+FGL++FYSELM+G GAA+R+F+L D    I PT G+  +   +  I FKNVS
Sbjct: 379 AVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIRPTIGKDPVSLAQKPIVFKNVS 438

Query: 434 FSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDI 493
           F+YPTRP++QIFKD+NI + PG +VC VGPSG GKSTIA LLLRYY+  +G I    +DI
Sbjct: 439 FTYPTRPKHQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFGDEDI 498

Query: 494 SKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEE--IRSVAKQCFCHNFITK 551
              N +  RR IG VQQEP+L +GTI DNI Y +     +++  IR    +  C  F+  
Sbjct: 499 RNFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIPPEIAEQDDRIRRAIGKANCTKFLAN 558

Query: 552 FPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQ 611
           FPDG  TM+GA+GA LSGGQ+QRIA+ARA +  P +L+LDEATSALD +SE  +     +
Sbjct: 559 FPDGLQTMVGARGAQLSGGQKQRIALARAFLLDPAVLILDEATSALDSQSEEIVAKNLQR 618

Query: 612 LMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEK 669
            ++ G  T +SIAHRLSTIK S  VIVLGK GSV+E G F++L A PNSEL  LL E+
Sbjct: 619 RVERG-FTTISIAHRLSTIKHSTRVIVLGKHGSVVETGSFRDLIAIPNSELNALLAEQ 675

>Skud_12.253 Chr12 (474886..476964) [2079 bp, 692 aa] {ON} YLR188W
           (REAL)
          Length = 692

 Score =  536 bits (1382), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/650 (45%), Positives = 424/650 (65%), Gaps = 19/650 (2%)

Query: 31  IVRPQISLISI--------RIGVRWNSQLSPSQEENRPKPVKQILEPIQKKESSYKDAVR 82
           IV P++ L SI           +R  S ++  +   +P  +K  L     K S +KD  R
Sbjct: 35  IVCPKVRLNSIISHKKALLSQSIRLQSSIAEGKASTKP-TLK--LSDANSKSSGFKDIKR 91

Query: 83  LFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDDLGPI 142
           LF L++ + + +  A+ L+ IS  + M++P VIG +LDV  +  + +D +      L   
Sbjct: 92  LFVLSRPESKYIGLALLLILISSSVSMAVPSVIGKLLDVASESDDEEDEEKARDSKL--- 148

Query: 143 AFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDT 202
            +GLT  Q               N +RI++L+I  ER+VARLR+  M   L QD+ F DT
Sbjct: 149 -YGLTKKQFFTALGLVFVIGAVANASRIIILKITGERLVARLRTRTMKAALDQDATFLDT 207

Query: 203 HKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPI 262
           ++VGDLISRL SDA +V++S+TQ VSDG +A+I G VG GMM  +S +L+ V++  APP+
Sbjct: 208 NRVGDLISRLSSDASIVAKSVTQNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMLLAPPL 267

Query: 263 LWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIY 322
              A V+GKKIR+ S+ LQ + G LT+VAEEQL+  +T+Q++  E+ E+HRY   +R ++
Sbjct: 268 GAMALVYGKKIRNLSRQLQTSVGGLTKVAEEQLNATRTIQAYGGEKNEVHRYAKEVRNVF 327

Query: 323 NVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSV 382
           ++G K A  +  FF ST ++G+ + + +LL G+ ++  G +TIG+L++FM+Y  YTGSS+
Sbjct: 328 HIGLKEAVTSGLFFGSTGLVGNTAMLSLLLVGTNMIQSGVMTIGELSSFMMYAVYTGSSL 387

Query: 383 FGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIP-GKGDIEFKNVSFSYPTRPE 441
           FGL++FYSELM+G GAA+R+F+L D    I PT G+  I      + FKNVSF+YPTRP+
Sbjct: 388 FGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPISLAHKPVVFKNVSFTYPTRPK 447

Query: 442 NQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTL 501
           +QIFKD+NI + PG +VC VGPSG GKSTIA LLLRYY+  +G I  D +D+   N +  
Sbjct: 448 HQIFKDLNITIKPGEHVCAVGPSGSGKSTIASLLLRYYDVNSGSIEFDDEDVRNFNLRKY 507

Query: 502 RRHIGLVQQEPILMSGTIRDNITYGL-AEPATKEE-IRSVAKQCFCHNFITKFPDGYDTM 559
           RR IG VQQEP+L +GTI DNI Y + +E A +E+ +    +Q  C  F+  FPDG  TM
Sbjct: 508 RRLIGYVQQEPLLFNGTILDNILYCIPSEIAEREDRVARAIEQANCTKFLANFPDGLQTM 567

Query: 560 IGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMT 619
           +GA+GA LSGGQ+QRIA+ARA +  P +L+LDEATSALD +SE  +     + ++ G +T
Sbjct: 568 VGARGAQLSGGQKQRIALARAFLLDPALLILDEATSALDSQSEEIVAKNLQKRVERG-LT 626

Query: 620 IVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEK 669
            +SIAHRLSTIK S  +IVLGK GSV+E G F++L A P+SEL  LL E+
Sbjct: 627 TISIAHRLSTIKHSTRIIVLGKHGSVVETGSFRDLIAIPDSELNALLAEQ 676

>KLLA0C01991g Chr3 (160778..162898) [2121 bp, 706 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 706

 Score =  531 bits (1368), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 292/657 (44%), Positives = 419/657 (63%), Gaps = 18/657 (2%)

Query: 22  PLSYIR-PLNIVR--PQISLISIRIGVRWNSQLSPSQEENRPKPVKQI----LEPIQKKE 74
           P + +R P+N+ +  P IS  S R   R +  L  ++++ +P     +    L P   K 
Sbjct: 22  PSTILRYPINLGKRSPLISFQS-RSFARCSIALQAAKKQGKPSLTATVKGLRLSPHDSKA 80

Query: 75  SSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNV 134
           S ++D  RLF LAK + R +  A+ L+ +S  + M++P VIG +LD+ R+  E  + +  
Sbjct: 81  SGWQDIKRLFLLAKPETRSMFIALILIILSSAVSMAVPTVIGKLLDIAREEHEQPETEKE 140

Query: 135 NMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLH 194
            M       FGLT  Q               N  RIV+L++  ER+VARLR+  M   L 
Sbjct: 141 TM------IFGLTSTQFYTALGGVFVVGALANVGRIVILKVTGERLVARLRTRTMKAALE 194

Query: 195 QDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGV 254
           QD+ F D ++VGDLISRL SDA +VS+S+TQ +SDG +A+I G VG GMM  IS +L+ V
Sbjct: 195 QDATFLDHNRVGDLISRLSSDAGIVSKSVTQNLSDGTRAVIQGFVGFGMMSFISWKLTCV 254

Query: 255 LLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRY 314
           ++  APP+   A V+GK+IR+ S+ LQ + G+LT+V+EEQLS  KT+Q++  E++E+HRY
Sbjct: 255 MMLLAPPLGVMALVYGKRIRNLSRQLQTSVGELTKVSEEQLSATKTIQAYCGEKKEIHRY 314

Query: 315 NGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLY 374
              +R +++VG K A  +  FF  T  +G+++ + +LL G+ ++  G +T+GDL++FM+Y
Sbjct: 315 ADEVRKVFHVGLKEALTSGAFFGVTGFVGNVALLALLLTGTSMIKTGLMTVGDLSSFMMY 374

Query: 375 TEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKG-DIEFKNVS 433
             YTGSS+FGL++FYSELM+G GAA+R+F+L D    I PT G+  +  +   I F +V 
Sbjct: 375 AVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRKPLIHPTIGKDPVTLENKSIHFNHVK 434

Query: 434 FSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDI 493
           FSYPTRP++ IF+D+N  V PG +VCIVGPSG GKST+A LLLRYY+  +G+I +   +I
Sbjct: 435 FSYPTRPQHHIFEDLNFTVRPGEHVCIVGPSGGGKSTVASLLLRYYDIGSGEIKLGNDNI 494

Query: 494 SKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIR--SVAKQCFCHNFITK 551
              N +  RR +G+VQQEP+L SGTI DNITY + +    +E R      Q  C  F+  
Sbjct: 495 RDFNLRKYRRLLGVVQQEPMLFSGTILDNITYAVPQELVNDETRISRAIGQANCTKFLAN 554

Query: 552 FPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQ 611
           FPDG  T +G +G  LSGGQ+QRIA+ARA +  P+IL+LDEATSALD +SE  +  +  Q
Sbjct: 555 FPDGLQTTVGPRGTQLSGGQKQRIALARAFLLDPSILILDEATSALDSQSEEVVAQSLQQ 614

Query: 612 LMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTE 668
               G  TI SIAHR+STI+ S  VIVL + G+V E G F +L A P+S L KLL++
Sbjct: 615 RSARGKTTI-SIAHRVSTIQHSSRVIVLNRHGTVAETGSFDKLIAIPDSSLNKLLSK 670

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score =  531 bits (1368), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 291/655 (44%), Positives = 420/655 (64%), Gaps = 18/655 (2%)

Query: 27  RPLNIVRPQISLISIRIGVRWNSQL-SPSQEENRPKPVKQI--LEPIQKKESSYKDAVRL 83
           +PL I R  +    IR   RWNS +    ++ + P P  ++  L     K +  KD  RL
Sbjct: 46  QPLGIRRKTLE---IR---RWNSSIVDVKKKRSSPPPSIEVQKLSNEVSKSNGMKDIKRL 99

Query: 84  FSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDDLGPIA 143
           F LAK + + +  A+  + IS  + M+IP +IG +LD L K     +  + N      + 
Sbjct: 100 FKLAKPEAKYILLALLFIVISSSVSMTIPTIIGKLLD-LAKADNDDEDGDNNAKKEKLMI 158

Query: 144 FGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTH 203
           FGLT  Q               N +RIV+L++  ER+VARLR+  M   L+QD+ F DT+
Sbjct: 159 FGLTKPQFYTALGGLFLAGAIANASRIVILKVTGERLVARLRTRTMKAALYQDASFLDTN 218

Query: 204 KVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPIL 263
           +VGDLISRL SDA +V++++TQ VSDG +A+I G VG GMM  IS +L+ V++   PP+ 
Sbjct: 219 RVGDLISRLSSDASIVAKAVTQNVSDGSRAVIQGFVGFGMMSFISWKLTCVMMIMVPPLG 278

Query: 264 WSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN 323
             A V+G+KIR  S+ LQ + G LT+VAEEQL+  +T+Q++  E  E+HRY   +R +++
Sbjct: 279 VMALVYGRKIRTLSRQLQASVGGLTKVAEEQLNATRTIQAYGGEALEIHRYATEVRKVFD 338

Query: 324 VGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVF 383
           VG K A  +  FF ST ++G+++ I +LL G+ ++  G+LT+GDL++FM+Y  YTGSS+F
Sbjct: 339 VGLKEAVTSGLFFGSTGLVGNIAMISLLLVGTSMIQYGTLTVGDLSSFMMYAVYTGSSLF 398

Query: 384 GLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQ--KYIPGKGDIEFKNVSFSYPTRPE 441
           GL+ FYSELM+G GAA+R+F+L D    I PT G   K + GK  IEF+NVSF+YPTRP 
Sbjct: 399 GLSGFYSELMKGAGAATRVFELNDRKPLIKPTIGYDPKSLLGK-SIEFQNVSFAYPTRPT 457

Query: 442 NQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTL 501
           + I  +++I + PG +VCIVGPSG GKST++ LLLRYY+ + G I +DGQ+I + N +  
Sbjct: 458 HSILNNLSISIQPGEHVCIVGPSGSGKSTVSSLLLRYYDVSTGSIKIDGQNIKEFNLRKY 517

Query: 502 RRHIGLVQQEPILMSGTIRDNITYGLAE----PATKEEIRSVAKQCFCHNFITKFPDGYD 557
           RR +G+VQQEP+L +GTI DNI Y +       A   +++   +Q  C  F+  FP+G +
Sbjct: 518 RRLLGVVQQEPMLFNGTILDNILYAVLSKETLTANSPDVKRALEQANCTKFLKNFPEGVN 577

Query: 558 TMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGS 617
           T++G +G  LSGGQ+QRIA+ARA +  P +L+LDEATSALD +SE  +     + ++ G 
Sbjct: 578 TLVGPRGTQLSGGQKQRIALARAFLLHPALLILDEATSALDSQSEEIVAKNLSERVELG- 636

Query: 618 MTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSR 672
           +T +SIAHRLSTIK S  VIVL K GSV+E G F+EL     SEL  LL+++  +
Sbjct: 637 LTTISIAHRLSTIKHSTRVIVLDKSGSVVETGPFEELVDYSRSELNMLLSQQHKK 691

>TPHA0B04620 Chr2 complement(1085725..1087887) [2163 bp, 720 aa]
           {ON} Anc_1.67 YLR188W
          Length = 720

 Score =  530 bits (1365), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 283/638 (44%), Positives = 412/638 (64%), Gaps = 15/638 (2%)

Query: 46  RWNSQLSPSQEEN-RPKPVKQILEPIQKKESS---YKDAVRLFSLAKRDWRLLCAAIALL 101
           R+NS    S+  N +    +Q LE +  +ES+   +KD  RLF+LAK +   +  A+ L+
Sbjct: 58  RFNSTNESSKGINTKLTETQQKLEKLSSEESTNTGFKDVKRLFTLAKPETAYIVLALVLI 117

Query: 102 TISCVIGMSIPKVIGLVLDVLRK-------GIEGKDLQNVNMDDLGPIAFGLTIYQXXXX 154
            IS  + M +P VIG +LD+            + K+  +   D      +G T  Q    
Sbjct: 118 LISSTVSMVVPSVIGKLLDLSSNTSNDDTGDAKSKEKVDNKEDRDNNTIYGFTHTQFFAG 177

Query: 155 XXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGS 214
                      N  RIV+L++  E++VARLR+  M   L QD+ F D+++VGDLISRL S
Sbjct: 178 LGIVFVIGAIANTGRIVILKVTGEKLVARLRTRTMKAALDQDATFLDSNRVGDLISRLSS 237

Query: 215 DAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIR 274
           DA +V++S+T  VSDG +A++ G VG  MM  IS +L+ V++   PP+   A V+GKKIR
Sbjct: 238 DASIVAKSVTMNVSDGTRAILQGFVGFSMMSYISFKLTSVMVLLIPPLGIMALVYGKKIR 297

Query: 275 HTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAE 334
           + S+ LQ A G LT+VAEEQL+  KT+Q++  E++E+ RY   +R +++VG K A  +  
Sbjct: 298 NLSRQLQTAVGGLTKVAEEQLNATKTIQAYGGEKKEIRRYASEVRDVFDVGLKEAITSGI 357

Query: 335 FFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQ 394
           FF ST ++G+ + + +LL G+ ++  GSLT+GDL++FM+Y  YTGSS+FGL++FYSELM+
Sbjct: 358 FFGSTGLVGNAALLSLLLVGTNMISSGSLTVGDLSSFMMYAVYTGSSLFGLSSFYSELMK 417

Query: 395 GVGAASRLFDLTDHISSISPTKGQKYIPGKGD-IEFKNVSFSYPTRPENQIFKDINIKVP 453
           G GAA+R+F+L D    I PT G+  +  KG  I F++VSF YPTRP +++F  I+ K+ 
Sbjct: 418 GAGAAARVFELDDRKPLIKPTIGKDPVTLKGKAIIFQDVSFHYPTRPNHRVFNKISFKIE 477

Query: 454 PGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPI 513
           PG ++C VGPSG GKST++ LLLRYY+ T G IL+   +I  ++ +  R+ +G+VQQEP+
Sbjct: 478 PGEHICFVGPSGSGKSTVSQLLLRYYDATEGNILIGEDNIKSLSLRKYRKLLGVVQQEPM 537

Query: 514 LMSGTIRDNITYGLAE--PATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQ 571
           L +GTI DNI Y + +   + K ++    K+  C  F+  FPDG +T++G +G  LSGGQ
Sbjct: 538 LFNGTIIDNILYNVPDEIASQKNKVDLAIKKSNCTKFLANFPDGLNTIVGPRGTQLSGGQ 597

Query: 572 RQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIK 631
           +QRIAIAR+ +  P+IL+LDEATSALD +SE  I  T  +    G +T +SIAHRLSTIK
Sbjct: 598 KQRIAIARSFLLDPSILLLDEATSALDTQSEDIIAMTLKKREAEG-LTTISIAHRLSTIK 656

Query: 632 RSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEK 669
            S  V+VL K+GSV+E GKF EL ANP SEL  LL+++
Sbjct: 657 YSSRVVVLNKNGSVVETGKFTELIANPTSELNLLLSKE 694

>Smik_12.248 Chr12 (475233..477323) [2091 bp, 696 aa] {ON} YLR188W
           (REAL)
          Length = 696

 Score =  526 bits (1356), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 286/623 (45%), Positives = 409/623 (65%), Gaps = 9/623 (1%)

Query: 50  QLSPSQEENRPKPVKQILEPIQKKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGM 109
           Q S S+ +   KP  + L     K S +KD  RLF L+K + + +  A+ L+ IS  + M
Sbjct: 60  QSSVSEGKTFTKPTLK-LSDANSKSSGFKDIKRLFVLSKPESKYIGLALLLILISSSVSM 118

Query: 110 SIPKVIGLVLDVLRKGIEGKDLQNVNMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFAR 169
           ++P VIG +LD+  +  + +  +    + L    +GLT  Q               N +R
Sbjct: 119 AVPSVIGKLLDLASETEDEEKEEKAKSNKL----YGLTKRQFFTALGLVFIIGAVANASR 174

Query: 170 IVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSD 229
           I++L++  ER+VARLR+  M   L QD+ F DT++VGDLISRL SDA +V++S+TQ VSD
Sbjct: 175 IIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVTQNVSD 234

Query: 230 GFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTR 289
           G +A+I G VG GMM  +S +L+ V++  APP+   A ++G+KIR+ S+ LQ + G LT+
Sbjct: 235 GTRAIIQGFVGFGMMSFLSWKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSVGGLTK 294

Query: 290 VAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIV 349
           VAEEQL+  +T+Q++  E+ E+ RY   +R ++++G K A  +  FF ST ++G+ + + 
Sbjct: 295 VAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHIGLKEAVTSGLFFGSTGLVGNTAMLS 354

Query: 350 VLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHI 409
           +LL G+ ++  GS+T+G+L++FM+Y  YTGSS+FGL++FYSELM+G GAA+R+F+L D  
Sbjct: 355 LLLVGTSMIQSGSMTVGELSSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFELNDRK 414

Query: 410 SSISPTKGQKYIP-GKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGK 468
             I PT G+  +   +  I FKNVSF+YPTRP++QIFKD+NI + PG +VC VGPSG GK
Sbjct: 415 PLIRPTIGKDPVSLAQKPIVFKNVSFTYPTRPKHQIFKDLNITINPGEHVCAVGPSGSGK 474

Query: 469 STIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLA 528
           STIA LLLRYY+  +G I    +DI   N +  RR IG VQQEP+L +GTI DNI Y + 
Sbjct: 475 STIASLLLRYYDVNSGSIEFGDEDIRSFNLRKYRRLIGYVQQEPLLFNGTILDNILYCIP 534

Query: 529 EPATKEEIR--SVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPN 586
               ++E R      Q  C  F+  FPDG  T +GA+GA LSGGQ+QRIA+ARA +  P 
Sbjct: 535 PEIAEQEDRIGRAIGQANCTKFLANFPDGLQTTVGARGAQLSGGQKQRIALARAFLLDPA 594

Query: 587 ILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVI 646
           +L+LDEATSALD +SE  +     + ++ G +T +SIAHRLSTIK S  V+VLGK GSV+
Sbjct: 595 VLILDEATSALDSQSEEIVAKNLQRRVERG-LTTISIAHRLSTIKHSTRVVVLGKHGSVV 653

Query: 647 EAGKFKELFANPNSELCKLLTEK 669
           E G F++L A PNSEL  LL E+
Sbjct: 654 ETGSFQDLIAIPNSELNALLAEQ 676

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR188W
           (MDL1)
          Length = 677

 Score =  518 bits (1335), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 275/636 (43%), Positives = 403/636 (63%), Gaps = 10/636 (1%)

Query: 40  SIRIGVRWNSQLSP-SQEENRPKPVKQILEPIQKKESSYKDAVRLFSLAKRDWRLLCAAI 98
           S RI  R NS  +P +  E +P   +  L       S  KD  RLF LA+ + + L  A+
Sbjct: 44  STRIQTRLNSTANPRASTEEKPHQERLELSTATGNASGAKDVRRLFQLARPELKSLVCAL 103

Query: 99  ALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDDLGPIAFGLTIYQXXXXXXXX 158
            L+ IS  + M+IP VIG +LDV R+     D++  + D+   + +GL   Q        
Sbjct: 104 VLIVISGAVSMTIPSVIGKLLDVARE-----DVEQESGDEEEAVLYGLPEKQFYLALSGI 158

Query: 159 XXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYV 218
                  N  RIV+L+   ER+VARLR+  M   L Q+  F D+++VGDLISRL SDA +
Sbjct: 159 FAVGALANMGRIVVLKTTGERLVARLRTRTMKAALEQEGAFLDSNRVGDLISRLSSDASI 218

Query: 219 VSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSK 278
           VS+S+TQ  SDG +A+I G VG GMM  IS +L+ V+   APP++  A+ +G+++R+ S+
Sbjct: 219 VSKSITQNTSDGARAVIQGAVGFGMMSYISWQLTAVMTLLAPPLVLMAAFYGRRVRNLSR 278

Query: 279 DLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTS 338
           +LQ   G LT+VAEEQL+  +TVQ++  E+RE+ RY   +R +++VG K A I+  FF +
Sbjct: 279 ELQTKVGGLTKVAEEQLNATRTVQAYCGERREIRRYATEVRNVFDVGLKEALISGSFFGA 338

Query: 339 TTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGA 398
           T  +G+ + + +LL G+ ++  G +++G+L++FM+Y  YTGSS+F L++FYSELM+G GA
Sbjct: 339 TGFVGNATLLALLLTGTSMIKGGGISVGELSSFMMYAVYTGSSLFNLSSFYSELMKGAGA 398

Query: 399 ASRLFDLTDHISSISPTKGQKYIPGKGD-IEFKNVSFSYPTRPENQIFKDINIKVPPGSN 457
           A R+F+L D    I PT G+  +   G  I F +V+F+YPTRP +Q+F  +++ + PG +
Sbjct: 399 AVRVFELNDRKPLIHPTIGKDPVSLTGKTIAFNSVNFAYPTRPHHQVFAGMDLSICPGEH 458

Query: 458 VCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSG 517
           VCIVGPSG GKST+A LLLR+Y+P +G I + G+DI   N    RR +G+VQQEP+L + 
Sbjct: 459 VCIVGPSGGGKSTVASLLLRFYDPISGSITIGGEDIRLFNLSKYRRMMGIVQQEPVLFNA 518

Query: 518 TIRDNITYGLAEPATKEEIR--SVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRI 575
           +I +NITY L    TK+  R     +   C  F+  FP+G  T +G +G  LSGGQ+QR+
Sbjct: 519 SILENITYALPLHLTKDPARIDRALRLSNCSAFVGSFPEGLQTAVGPRGTQLSGGQKQRV 578

Query: 576 AIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSEN 635
           A+ARA ++ P IL+LDEATSALD +SE  +  T  Q  +   +TI SIAHR STI+ S  
Sbjct: 579 ALARAFLQDPAILILDEATSALDSKSEDIVASTLLQRCQEAKITI-SIAHRKSTIQHSTR 637

Query: 636 VIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
           VIVL K G V+E G +++L  +P S L  LL+++ S
Sbjct: 638 VIVLDKLGHVLETGTYQQLIGDPGSSLSGLLSKEHS 673

>Suva_10.284 Chr10 (500972..503053) [2082 bp, 693 aa] {ON} YLR188W
           (REAL)
          Length = 693

 Score =  519 bits (1337), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 287/637 (45%), Positives = 413/637 (64%), Gaps = 11/637 (1%)

Query: 45  VRWNSQLSPSQEENRPKPVKQILEPIQKKESSYKDAVRLFSLAKRDWRLLCAAIALLTIS 104
           +R+ S +   ++   P      L     K S +KD  RLF L++ +   +  A+ L+ IS
Sbjct: 53  IRFQSSIIDGKKTASPDSPTLKLSDADSKSSGFKDIKRLFVLSRPESGYIGLALLLILIS 112

Query: 105 CVIGMSIPKVIGLVLDVLRKGIEGKDLQNVNMDDLGPIAFGLTIYQXXXXXXXXXXXXXX 164
             + M++P VIG +LD+     + +D +    + L    +GL+  Q              
Sbjct: 113 SSVSMAVPSVIGKLLDLASDDDDEEDAKETKDNKL----YGLSKRQFFTALGAVFLIGAI 168

Query: 165 XNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMT 224
            N +RI++L++  ER+VARLR+  M   L QD+ F DT++VGDLISRL SDA +V++S+T
Sbjct: 169 ANASRIIILKVTGERLVARLRTRTMKAALDQDATFLDTNRVGDLISRLSSDASIVAKSVT 228

Query: 225 QKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEAT 284
           Q VSDG +A+I G VG GMM  +S +L+ V++  APP+   A ++G+KIR+ S+ LQ + 
Sbjct: 229 QNVSDGTRAIIQGFVGFGMMSFLSWKLTCVMMVLAPPLGAMALIYGRKIRNLSRQLQTSV 288

Query: 285 GQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGD 344
           G LT+VAEEQL+  +T+Q++  E+ E+ RY   +R +++VG K A  +  FF ST ++G+
Sbjct: 289 GGLTKVAEEQLNATRTIQAYGGEKNEVRRYAKEVRNVFHVGLKEAVTSGLFFGSTGLVGN 348

Query: 345 MSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFD 404
            + + +LL G+ ++  G++T+G+LT+FM+Y  YTGSS+FGL++FYSELM+G GAA+R+F+
Sbjct: 349 AAMLSLLLVGTNMIQSGAMTVGELTSFMMYAVYTGSSLFGLSSFYSELMKGAGAAARVFE 408

Query: 405 LTDHISSISPTKGQKYIP-GKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGP 463
           L D    I PT G+  +      I FK+VSF+YPTRP++QIFKD+NI + PG +VC VGP
Sbjct: 409 LNDRKPLIRPTIGKDPVSLAHKPIVFKDVSFTYPTRPKHQIFKDLNITIKPGEHVCAVGP 468

Query: 464 SGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNI 523
           SG GKSTIA LLLRYY+ + G I    +DI   N +  RR +G VQQEP+L +GTI DNI
Sbjct: 469 SGSGKSTIASLLLRYYDTSAGSIDFGDEDIKNFNLRKYRRLMGYVQQEPLLFNGTILDNI 528

Query: 524 TYGLAEPATKEEIRSVAK---QCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARA 580
            Y +     ++E R VA+   Q  C  F+  FPDG  TM+GA+GA LSGGQ+QRIA+ARA
Sbjct: 529 LYCIPPEIAEQEDR-VARAIGQANCTKFLANFPDGLQTMVGARGAQLSGGQKQRIALARA 587

Query: 581 LIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLG 640
            +  P +L+LDEATSALD +SE  +     + +K G +T +SIAHRLSTIK S  VIVLG
Sbjct: 588 FLLDPAVLILDEATSALDSQSEEVVAKNLQRRVKRG-LTTISIAHRLSTIKHSTRVIVLG 646

Query: 641 KDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGND 677
           K GSV+E G F++L + P SEL  LL E+    +G D
Sbjct: 647 KHGSVVETGSFQDLISIPGSELNALLAEQQD-DEGKD 682

>Kwal_33.13308 s33 (166479..168599) [2121 bp, 706 aa] {ON} YLR188W
           (MDL1) - ATP-binding cassette (ABC) transporter family
           member [contig 118] FULL
          Length = 706

 Score =  519 bits (1337), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 291/690 (42%), Positives = 427/690 (61%), Gaps = 29/690 (4%)

Query: 21  RPLSYIRPLNI---------VRPQISLISIRIGVRWNSQLSPSQEENRPKPVKQILEPIQ 71
           +  S +RPL +         V+P ISLI +   +RWN       E  +P      L P +
Sbjct: 28  KAFSSVRPLTLTTVPCKSAWVKP-ISLIHVSRQIRWNHA-----ESRQPSST---LTPEE 78

Query: 72  KKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDL 131
              SS+KD  RLF LA+ + R +  A+AL+ IS  + M +P VIG ++D  +   +   L
Sbjct: 79  HNSSSWKDIKRLFQLARPESRSMFFALALIIISSSVSMLVPGVIGKLMDAAKDDQQASKL 138

Query: 132 -----QNVNMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRS 186
                     D  G   FGLT+ Q               N  RIV+L++  E++VARLR+
Sbjct: 139 VENDSDAAAPDADGRQIFGLTMPQFYGVLFSVFVVGAAANMGRIVILKVTGEKLVARLRT 198

Query: 187 GVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVS 246
             +  +L QD+ F D +KVGDLISRL SDA +VS+S+TQ +SDG ++LI G VG GMM  
Sbjct: 199 RTLKASLQQDASFLDNNKVGDLISRLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMMSY 258

Query: 247 ISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVA 306
           IS +L+ V++  APP+   A ++GK+IR+ S+ LQ + G LT+ AEEQLS  +T+Q++  
Sbjct: 259 ISWKLTCVMMLLAPPLAAMALIYGKRIRNLSRTLQASVGGLTKAAEEQLSATRTIQAYGG 318

Query: 307 EQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIG 366
           E+  +H+Y   +R +Y VG K A  +  FF  T ++G+++ + +LL G+ ++  G++T+G
Sbjct: 319 EKHAIHQYAKEVRQVYQVGLKEALTSGAFFGLTGLVGNVAVLALLLTGTSMIRTGAMTLG 378

Query: 367 DLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGD 426
           DL++FM+Y  YTGSS+FG+++FYSELM+G GAA+R+F+L D   +I PT+G   +   G 
Sbjct: 379 DLSSFMIYAVYTGSSLFGMSSFYSELMKGAGAAARVFELNDRRPAIHPTRGIDPVSLAGK 438

Query: 427 -IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQ 485
            +EF+NV F+YPTR ++ IF+++  ++  G +VCIVGPSG GKST+A LLLR+Y+   G 
Sbjct: 439 PVEFQNVKFAYPTRHQHTIFENLTFRINAGEHVCIVGPSGGGKSTVASLLLRFYDVDTGA 498

Query: 486 ILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAK---Q 542
           I + GQ I+  N +  RR +G+VQQEP+L +GTI DNI Y + +    +E R VA+   Q
Sbjct: 499 ITIGGQSIASFNLRKYRRMLGVVQQEPMLFNGTILDNIVYSVPQSLLNDENR-VARAIGQ 557

Query: 543 CFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESE 602
             C  F++ FPDG  T++G +G  LSGGQ+QRIA+ARA +  P++L+LDEATSALD  SE
Sbjct: 558 ANCSAFLSSFPDGLQTLVGPRGTQLSGGQKQRIALARAFLLDPDLLILDEATSALDSRSE 617

Query: 603 GAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSEL 662
             +          G  TI SIAHR+STI+ S  VIVLG+ G V+E G F EL ++P+S+L
Sbjct: 618 EVVARALYSRSTRGKTTI-SIAHRVSTIQHSSRVIVLGRSGYVVETGTFDELISDPDSQL 676

Query: 663 CKLLTEKSSRSDGNDSLPPPPPNATQDKVV 692
             LL ++   S    +    P N +Q + V
Sbjct: 677 NLLLRKEEEPSSEETTDSHVPENTSQGQQV 706

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]
           {ON} similar to uniprot|P33310 Saccharomyces cerevisiae
           YLR188W MDL1 Half-type ATP-binding cassette (ABC)
           transporter of the inner mitochondrial membrane mediates
           export of peptides generated upon proteolysis of
           mitochondrial proteins plays a role in the regulation of
           cellular resistance to oxidative stress
          Length = 714

 Score =  516 bits (1328), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 276/638 (43%), Positives = 398/638 (62%), Gaps = 21/638 (3%)

Query: 46  RWNSQLSPSQEENRPKPVKQI--LEPIQKKESSYKDAVRLFSLAKRDWRLLCAAIALLTI 103
           RWNS  +            QI  L   +K  S ++D  RL  LA+ +   +  A+ L+ I
Sbjct: 57  RWNSSNAKQPNTTNTDKTGQIAELSSNEKNSSGFRDITRLLGLARPEVWYIMGALCLIVI 116

Query: 104 SCVIGMSIPKVIGLVLDVLRKGI-------EGKDLQNVNMDDLGPIAFGLTIYQXXXXXX 156
           S  + M +P VIG +LD+ +          E  D  + + D      +G T  Q      
Sbjct: 117 SSTVSMLLPSVIGKLLDLAKSSSPSENEKQESGDGDDKDKDKEEGTIYGFTPKQFCVIMG 176

Query: 157 XXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDA 216
                    N  RI++L++  ER+VARLR+  M   L QDS F D ++VGDLISRL SD+
Sbjct: 177 GIFVAGAFANCGRIIILKVTGERLVARLRTRTMKAALDQDSAFLDRNRVGDLISRLSSDS 236

Query: 217 YVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHT 276
            +V++S+TQ VSDG +A+I G VG GMM  IS +L+ V+    PPI   A ++GKKIR+ 
Sbjct: 237 SIVAKSLTQNVSDGTRAVIQGFVGFGMMTYISWQLTCVMGLMLPPIGAMAIIYGKKIRNL 296

Query: 277 SKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFF 336
           SK LQ + G LT+VAEEQL   KT+QS+V E++E+ RY   +R ++++G K A  +  FF
Sbjct: 297 SKQLQTSVGGLTKVAEEQLGATKTIQSYVGEKKEIRRYAKEVRQVFDIGLKEALTSGMFF 356

Query: 337 TSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGV 396
            ST  +G++S + +L+ G+ ++  G +T+GDL++FM+Y  YTG S+FGL+ FYSELM+G 
Sbjct: 357 GSTGFVGNISLLALLMSGASMIQSGLITVGDLSSFMMYAVYTGGSMFGLSNFYSELMKGA 416

Query: 397 GAASRLFDLTDHISSISPTKGQ-----KYIPGKGDIEFKNVSFSYPTRPENQIFKDINIK 451
           GAA+R+F+L D   +I+PT G+     + +P    I FK+VSF+YPTR   +IF  +N+ 
Sbjct: 417 GAAARVFELNDRKPAIAPTLGKGPTSIRNLP----ISFKDVSFTYPTRLNKKIFNHLNLT 472

Query: 452 VPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQE 511
           + PG ++CI GPSG GKSTIA LL+RYY+   G I +   D+   N +  RR IG+V QE
Sbjct: 473 IQPGEHICIAGPSGSGKSTIASLLVRYYDVDQGGISIGDTDLRTFNLRKYRRLIGVVHQE 532

Query: 512 PILMSGTIRDNITYGLAEPATKEEIRSVAK--QCFCHNFITKFPDGYDTMIGAQGALLSG 569
           P+L +GTI +NI Y +     ++E R  A   +  C  F++ FPDG +T++G +GA LSG
Sbjct: 533 PVLFNGTILENILYAVPPSVAQDERRVSAAIGKANCSKFLSNFPDGLETLVGPRGAQLSG 592

Query: 570 GQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLST 629
           GQ+QR+A+ARA +  P +LVLDEATSALD +SE  +  T  + ++ G +T +SIAHR+ST
Sbjct: 593 GQKQRVALARAFLLDPALLVLDEATSALDSQSEEIVARTLQERVRRG-LTTISIAHRIST 651

Query: 630 IKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLT 667
           I  S  V+VLG+DG V+E+G F+EL   PNSEL  LL+
Sbjct: 652 IAHSTRVVVLGRDGFVVESGPFQELIDRPNSELNYLLS 689

>KLTH0F02024g Chr6 (161423..163627) [2205 bp, 734 aa] {ON} similar
           to uniprot|P33310 Saccharomyces cerevisiae YLR188W MDL1
           Half-type ATP-binding cassette (ABC) transporter of the
           inner mitochondrial membrane mediates export of peptides
           generated upon proteolysis of mitochondrial proteins
           plays a role in the regulation of cellular resistance to
           oxidative stress
          Length = 734

 Score =  515 bits (1327), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 287/672 (42%), Positives = 416/672 (61%), Gaps = 39/672 (5%)

Query: 45  VRWNSQLSPSQEENRPKPVKQILEPIQKKESSYKDAVRLFSLAKRDWRLLCAAIALLTIS 104
           VRW       Q  N  KP    L   ++  SS+KD  RLF LA+ + + +  A+ L+ +S
Sbjct: 60  VRW-------QHSNASKP-STTLTSEEQNSSSWKDIKRLFQLARPESKSMFFALVLIILS 111

Query: 105 CVIGMSIPKVIGLVLDVLRKG------IEGK--------DLQNVNMDDLGPIAFGLTIYQ 150
             + M +P VIG ++DV ++        +GK        D       D   +  GLT+ Q
Sbjct: 112 SSVSMLVPGVIGKLMDVAKEDGTSSSEADGKRGDATDKTDGSTAADTDSEKLILGLTLPQ 171

Query: 151 XXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLIS 210
                          N  RIV+L++  E++VARLR+  +   L QD+ F D +KVGDLIS
Sbjct: 172 FYGGLFSLFVVGAAANMGRIVILKVTGEKLVARLRTRTLKAALQQDASFLDNNKVGDLIS 231

Query: 211 RLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFG 270
           RL SDA +VS+S+TQ +SDG ++LI G VG GMM  IS +L+ V++  APP+   A V+G
Sbjct: 232 RLSSDASIVSKSLTQNMSDGTRSLIQGFVGFGMMSYISWKLTCVMMLLAPPLAVMALVYG 291

Query: 271 KKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAF 330
           +KIR+ S+ LQ + G LT+ AEEQLS  +T+Q++  E++ +  Y   +R +Y VG K A 
Sbjct: 292 RKIRNLSRTLQASVGGLTKAAEEQLSATRTIQAYGGEKQAIRHYAKEVRQVYQVGLKEAL 351

Query: 331 INAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYS 390
            +  FF  T ++G+ + + +LL G+ ++  G++T+GDL++FM+Y  YTGSS+FG+++FYS
Sbjct: 352 TSGGFFGLTGLVGNSAVLALLLTGTSMISTGAMTVGDLSSFMIYAVYTGSSLFGMSSFYS 411

Query: 391 ELMQGVGAASRLFDLTDHISSISPTKGQKYIP-GKGDIEFKNVSFSYPTRPENQIFKDIN 449
           ELM+G GAA+R+F+L D   +I PTKG+  +   +  +EFK V F+YPTR ++ IF+D++
Sbjct: 412 ELMKGAGAAARVFELNDRKPAIHPTKGRDPVSLARKPVEFKKVHFAYPTRRQHVIFEDLS 471

Query: 450 IKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQ 509
           +++ PG +VCIVGPSG GKST+A LLLR+Y+   G IL+ GQ+I+  N +  RR +G+VQ
Sbjct: 472 LRIDPGEHVCIVGPSGGGKSTVASLLLRFYDVDAGAILIGGQNIADFNLRKYRRLVGIVQ 531

Query: 510 QEPILMSGTIRDNITYGLAEPATKEEIRSVAK---QCFCHNFITKFPDGYDTMIGAQGAL 566
           QEP+L +GTI +NI Y + +    EE   VA+   Q  C  F++ FPDG  TM+G +G  
Sbjct: 532 QEPMLFNGTILENILYTVPQRLLNEEDGRVARAIGQANCSAFLSSFPDGLQTMVGPRGTQ 591

Query: 567 LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHR 626
           LSGGQ+QRIA+ARA +  P++L+LDEATSALD  SE  I  T       G  TI SIAHR
Sbjct: 592 LSGGQKQRIALARAFLLDPDLLILDEATSALDSRSEEVIARTLHSRTTRGKTTI-SIAHR 650

Query: 627 LSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLL------------TEKSSRSD 674
           +STI+ S  VIVLG++G V+E G F EL +N +S+L KLL            T    R +
Sbjct: 651 VSTIQHSTRVIVLGRNGGVVETGTFDELASNTDSQLNKLLRKEEEPVQPGEITNAPHRPE 710

Query: 675 GNDSLPPPPPNA 686
           G+D  P  P + 
Sbjct: 711 GSDQRPEGPSDG 722

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
           YLR188W
          Length = 707

 Score =  494 bits (1273), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 264/615 (42%), Positives = 392/615 (63%), Gaps = 19/615 (3%)

Query: 73  KESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDLQ 132
           K  + +D   LF LAK +   + A++ L+ I+  + M +P VIG +LD+   GIE    +
Sbjct: 92  KGKTREDIYNLFKLAKPEKWYIIASMGLIFITSAVSMLVPSVIGKLLDI-STGIEFASNK 150

Query: 133 NVNMDD--------------LGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSE 178
           + N +                  + +G T                  N  RI++L++  E
Sbjct: 151 DENDESSKEDKNENENENENKQTLIYGYTPLVFFSGLGVIFVVGAIANTGRIIILKLTGE 210

Query: 179 RVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGG 238
           R+VARLR+  M   L QD +F D++KVGDLISRL SD+ +VS ++T+ VSDG +A+I G 
Sbjct: 211 RIVARLRTRTMKNILKQDGKFQDSNKVGDLISRLSSDSSIVSNAVTRNVSDGARAVIQGC 270

Query: 239 VGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGV 298
           VG+GMM  IS +LSGV+LF  PPI   A ++G+KIR+ SK LQE+ G LT+++EEQL+G 
Sbjct: 271 VGVGMMSFISLKLSGVMLFMVPPIGVLAMIYGRKIRNISKKLQESVGSLTKISEEQLNGT 330

Query: 299 KTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLV 358
           +T+QS+V E+ E+H+Y   +R +Y+VG   A  +  FF  T ++G+ + + +L  G  ++
Sbjct: 331 RTIQSYVGEKLEIHKYAKEVRKVYHVGLNEAVASGLFFGVTGLIGNGAMLSLLYVGCNMI 390

Query: 359 LQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQ 418
             G+L+IG L++FM+Y  YTGSS+FGL++FYSE+M+G GAASR+F++  ++  I+ TKG 
Sbjct: 391 SNGTLSIGGLSSFMMYAVYTGSSLFGLSSFYSEIMKGSGAASRIFEINKYVPDINATKGI 450

Query: 419 KYIPGKGD-IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLR 477
             I  +   IEF+++ F+YPTR  + IF+D+NIK+ PG +VCI+GPSG GKSTI+ LLLR
Sbjct: 451 DPISFQDKPIEFEHIKFAYPTRSGHMIFQDLNIKINPGEHVCIIGPSGSGKSTISSLLLR 510

Query: 478 YYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPAT--KEE 535
           YY+P  G I + G+DI + + +  R+ +G+V QEP+L +GTI +NI Y + E     KE 
Sbjct: 511 YYDPLAGTISIGGKDIKEYSLRKYRKLMGVVHQEPVLFNGTILENILYNVPEEIANDKER 570

Query: 536 IRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATS 595
           + +  +   C+ F+   P G +T +G +G  LSGGQ+QR+A+ARA + +P +LVLDEATS
Sbjct: 571 LSNAIESSNCNKFLNTLPLGLETPVGPRGTQLSGGQKQRVALARAFLLEPTLLVLDEATS 630

Query: 596 ALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELF 655
           ALD  SE  +  T  Q    G  T +SIAHR+STIK S  V+VL K G V+E G ++EL 
Sbjct: 631 ALDPRSESIVAQTLKQRCAKG-FTTISIAHRVSTIKHSSRVVVLDKVGHVVETGPYEELL 689

Query: 656 ANPNSELCKLLTEKS 670
              +S L KLL  ++
Sbjct: 690 GIKDSALNKLLLSQN 704

>CAGL0E00385g Chr5 (31960..33786) [1827 bp, 608 aa] {ON} similar to
           uniprot|P33310 Saccharomyces cerevisiae YLR188w MDL1 or
           uniprot|P33311 Saccharomyces cerevisiae YPL270w MDL2
          Length = 608

 Score =  482 bits (1241), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 268/603 (44%), Positives = 382/603 (63%), Gaps = 32/603 (5%)

Query: 72  KKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVIGLVLDVLRKGIEGKDL 131
           KK  ++    +L  LAK + + +  A+ L+ +S  + MS+P VIG ++D           
Sbjct: 26  KKTQTWTQVKQLLRLAKPERKYIAGAVGLIAVSSAVSMSLPSVIGTLID----------- 74

Query: 132 QNVNMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNK 191
            + +  D  PI +GLT  Q               N  RI++L+I  E++VARLR+  M  
Sbjct: 75  -HASTPD-API-YGLTRNQFLLALGSVFVVGAIANSGRIIILKITGEKLVARLRTKTMKS 131

Query: 192 TLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPEL 251
            L QD+ F D H+VGDLISRL SDA +VS+S+T  +SDG +A + G VGIGMM  IS +L
Sbjct: 132 MLSQDATFLDKHRVGDLISRLSSDASIVSKSVTSNLSDGCRATLQGVVGIGMMTYISLKL 191

Query: 252 SGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQREL 311
           + V+    PP+   A ++G KI+  S+ LQ+  GQL++ +EEQL+ +KTVQ++  E++EL
Sbjct: 192 TTVMTMMVPPLGILAMLYGGKIKKISRQLQDKVGQLSKTSEEQLNSLKTVQAYAGERKEL 251

Query: 312 HRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAF 371
            RY+  +R ++N+G K A  +A FF ST ++G+++ I +LL G+      S+T+G+L++F
Sbjct: 252 QRYSNEVRSVFNIGVKEAVASALFFGSTGLIGNIAMIGLLLVGTA---DSSITLGELSSF 308

Query: 372 MLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKG------QKYIPGKG 425
           M+Y  YTGSSVFGLT FYSELM+G GAA R+ +L +  + ISPTKG       K +P   
Sbjct: 309 MMYGVYTGSSVFGLTGFYSELMKGCGAAERVLELQNMKTKISPTKGISPPKTLKGLP--- 365

Query: 426 DIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQ 485
            I F NVSF+Y       +  ++N ++ PG +VC VG SG GKSTI+ LLLRYY   +G 
Sbjct: 366 -ITFNNVSFAYSN--GKSVLSEMNFQIHPGEHVCFVGGSGCGKSTISSLLLRYYRTGSGN 422

Query: 486 ILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFC 545
           I +   DIS  N +  RR +G+VQQEP+L +GTI DNITYGL + +   ++    K   C
Sbjct: 423 ISIGNYDISAFNLRKYRRMLGVVQQEPLLFNGTILDNITYGLHDKSL-TDLNMALKAANC 481

Query: 546 HNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAI 605
             FI +   G DT++G +GA LSGGQRQRIA+AR  ++ P+IL+LDEATSALD +SE  I
Sbjct: 482 DQFIKESHMGLDTLVGPRGAQLSGGQRQRIALARVFLQNPDILILDEATSALDTKSEDII 541

Query: 606 NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKL 665
           N    +  ++G MT +SIAHRLSTI+ S  VIV+ +DG V+E+G F +L +  +SEL KL
Sbjct: 542 NKELQRRQEAG-MTTISIAHRLSTIRHSSRVIVI-EDGRVVESGSFDQLRSTRDSELNKL 599

Query: 666 LTE 668
           L E
Sbjct: 600 LKE 602

>Kwal_26.9480 s26 complement(1236178..1238337) [2160 bp, 719 aa]
           {ON} YMR301C (ATM1) - mitochondrial ABC transporter
           protein [contig 73] FULL
          Length = 719

 Score =  223 bits (568), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 147/430 (34%), Positives = 226/430 (52%), Gaps = 16/430 (3%)

Query: 258 FAPPILWSASVFGKKIRHTS--KDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYN 315
           F+  +L+S   F      T   K   +A  +   VA + L   + V+ F  EQ   ++Y+
Sbjct: 290 FSTMLLYSIFTFKTTAWRTEFRKSANKADNKAASVAVDSLINFEAVKYFNNEQYLANKYH 349

Query: 316 GAIRGIYN----VGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAF 371
            ++    +    V +  AF+N    +   ++   +   ++  G   V+ G L++GDL   
Sbjct: 350 KSLAQYRDSQIKVAQSLAFLN----SGQNLIFTSALTAMMYMGCTGVMSGELSVGDLVLI 405

Query: 372 MLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGK--GDIEF 429
                     +  L + Y EL Q +     LF L  +  SI  +K    +P     +I F
Sbjct: 406 NQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLQRNKVSIQNSKKPLMLPPNVPSEIVF 465

Query: 430 KNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVD 489
           KNVSF Y   P+  I K+ +  +P GS   IVGPSG GKSTI  L+ R+Y+P  G+IL+D
Sbjct: 466 KNVSFGYD--PDRLILKNASFTIPTGSKTAIVGPSGSGKSTILKLVFRFYDPIEGRILLD 523

Query: 490 GQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFI 549
           G+D+ +++ ++LRR IG+V Q+  L + +I DN+ +G  + AT +EI     +      I
Sbjct: 524 GKDVRELDIESLRRSIGVVPQDTPLFNESIWDNVKFGRID-ATDQEIERAIDRAQLRALI 582

Query: 550 TKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTF 609
            + P G DT++G +G ++SGG++QR+AIAR L+K   I+  DEATSALD  +E A+  T 
Sbjct: 583 RQLPKGRDTIVGERGLMISGGEKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALLRTI 642

Query: 610 GQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEK 669
            +   +GS T V IAHRL TI  ++ +IVL + G V E GK  EL A P S   +L   +
Sbjct: 643 KENFTTGSKTSVYIAHRLRTIADADKIIVL-EHGRVKEEGKHAELLATPKSLYAELWNVQ 701

Query: 670 SSRSDGNDSL 679
            +  D N  L
Sbjct: 702 ENLDDLNKEL 711

>YMR301C Chr13 complement(867555..869627) [2073 bp, 690 aa] {ON}
           ATM1Mitochondrial inner membrane ATP-binding cassette
           (ABC) transporter, exports mitochondrially synthesized
           precursors of iron-sulfur (Fe/S) clusters to the cytosol
          Length = 690

 Score =  218 bits (556), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 143/400 (35%), Positives = 217/400 (54%), Gaps = 16/400 (4%)

Query: 275 HTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN----VGRKAAF 330
           H  +D  +A  +   VA + L   + V+ F  E+    +YNG++    +    V +  AF
Sbjct: 282 HFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLMNYRDSQIKVSQSLAF 341

Query: 331 INA-EFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFY 389
           +N+ +    TT L  M ++     G   V+ G+LT+GDL             +  L + Y
Sbjct: 342 LNSGQNLIFTTALTAMMYM-----GCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVY 396

Query: 390 SELMQGVGAASRLFDLTDHISSISPTKGQKYIPGK--GDIEFKNVSFSYPTRPENQIFKD 447
            +L Q +     LF L  +   I   +    +P     DI F+NV+F Y   P+ +I K+
Sbjct: 397 RDLKQSLIDMETLFKLRKNEVKIKNAERPLMLPENVPYDITFENVTFGY--HPDRKILKN 454

Query: 448 INIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGL 507
            +  +P G    IVG SG GKSTI  L+ R+Y+P +G+IL++G+DI + +   LR+ IG+
Sbjct: 455 ASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGV 514

Query: 508 VQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALL 567
           V Q+  L + TI +N+ +G  + AT EE+ +V ++      I K P G+DT++G +G ++
Sbjct: 515 VPQDTPLFNDTIWENVKFGRID-ATDEEVITVVEKAQLAPLIKKLPQGFDTIVGERGLMI 573

Query: 568 SGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRL 627
           SGG++QR+AIAR L+K   I+  DEATSALD  +E A+  T      SGS T V IAHRL
Sbjct: 574 SGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRDNFTSGSRTSVYIAHRL 633

Query: 628 STIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLT 667
            TI  ++ +IVL  +G V E GK  EL A P S   +L T
Sbjct: 634 RTIADADKIIVL-DNGRVREEGKHLELLAMPGSLYRELWT 672

>Smik_13.518 Chr13 complement(850174..852237) [2064 bp, 687 aa] {ON}
           YMR301C (REAL)
          Length = 687

 Score =  216 bits (551), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 142/397 (35%), Positives = 216/397 (54%), Gaps = 16/397 (4%)

Query: 278 KDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN----VGRKAAFINA 333
           +D  +A  +   VA + L   + V+ F  E+    +YN ++    +    V +  AF+N+
Sbjct: 285 RDANKADNKAASVALDSLINFEAVKYFNNEKYLSDKYNSSLISYRDSQIKVSQSLAFLNS 344

Query: 334 -EFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSEL 392
            +    TT L  M ++     G   V+ G+LT+GDL             +  L + Y +L
Sbjct: 345 GQNLIFTTALTAMMYM-----GCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRDL 399

Query: 393 MQGVGAASRLFDLTDHISSISPTKGQKYIPGK--GDIEFKNVSFSYPTRPENQIFKDINI 450
            Q +     LF L  +   I   +    +P     DI F+NV+F Y   P+ +I K+ + 
Sbjct: 400 KQSLIDMETLFKLRRNEVKIKNAERPLMLPEHVPYDITFENVTFGY--HPDRKILKNASF 457

Query: 451 KVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQ 510
            +P G    IVG SG GKSTI  L+ R+Y+P +G+IL++G+DI + +   LR+ IG+V Q
Sbjct: 458 TIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIREYDINALRKVIGVVPQ 517

Query: 511 EPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGG 570
           +  L + TI +N+ +G  + AT EE+ +V ++      I K P G+DT++G +G ++SGG
Sbjct: 518 DTPLFNDTIWENVKFGRID-ATDEEVMTVVEKAQLAPLIKKLPQGFDTIVGERGLMISGG 576

Query: 571 QRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTI 630
           ++QR+AIAR L+K   I+  DEATSALD  +E A+  T      SGS T V IAHRL TI
Sbjct: 577 EKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLRTIRSNFTSGSRTSVYIAHRLRTI 636

Query: 631 KRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLT 667
             ++ +IVL  +G V E GK  EL A PNS   +L T
Sbjct: 637 ADADKIIVL-DNGRVREEGKHLELLATPNSLYRELWT 672

>Suva_13.491 Chr13 complement(849300..851381) [2082 bp, 693 aa] {ON}
           YMR301C (REAL)
          Length = 693

 Score =  215 bits (547), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 138/396 (34%), Positives = 212/396 (53%), Gaps = 14/396 (3%)

Query: 278 KDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN----VGRKAAFINA 333
           +D   A  +   VA + L   + V+ F  E+    +YNG++    +    V +  AF+N 
Sbjct: 288 RDANRADNKAASVALDSLINFEAVKYFNNEKYLADKYNGSLINYRDSQIKVSQSLAFLN- 346

Query: 334 EFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELM 393
              +   ++   +   ++  G   V+ G LT+GDL             +  L + Y EL 
Sbjct: 347 ---SGQNLIFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELK 403

Query: 394 QGVGAASRLFDLTDHISSISPTKGQKYIPGK--GDIEFKNVSFSYPTRPENQIFKDINIK 451
           Q +     LF L  +   I   +    +P     DI F+NV+F Y   P+ +I K+ +  
Sbjct: 404 QSLIDMEALFKLRKNEIKIKNAERPLMLPEHVPYDITFQNVTFGY--HPDRKILKNASFT 461

Query: 452 VPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQE 511
           +P GS   IVG SG GKSTI  L+ R+Y+P +G+IL++G+DI + +   LR+ IG+V Q+
Sbjct: 462 IPAGSKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRKVIGVVPQD 521

Query: 512 PILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQ 571
             L + TI +N+ +G  + AT EE+ +V ++      I K P G++T++G +G ++SGG+
Sbjct: 522 TPLFNDTIWENVKFGRID-ATDEEVNTVVEKAQLAPLIKKLPQGFNTIVGERGLMISGGE 580

Query: 572 RQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIK 631
           +QR+AIAR L+K   I+  DEATSALD  +E A+  T      SGS T V IAHRL TI 
Sbjct: 581 KQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAHRLRTIA 640

Query: 632 RSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLT 667
            ++ +IV   +G V E GK  EL A P S   +L T
Sbjct: 641 DADKIIVF-DNGKVREEGKHLELLATPGSLYRELWT 675

>Skud_13.475 Chr13 complement(841033..843108) [2076 bp, 691 aa] {ON}
           YMR301C (REAL)
          Length = 691

 Score =  214 bits (546), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 142/402 (35%), Positives = 219/402 (54%), Gaps = 20/402 (4%)

Query: 275 HTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN----VGRKAAF 330
           H  +D   A  +   VA + L   + V+ F  E+    +YN ++    +    V +  AF
Sbjct: 283 HFRRDANRADNKAASVALDSLINFEAVKYFNNEKYLSSKYNSSLMNYRDSQIKVSQSLAF 342

Query: 331 INA-EFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFY 389
           +N+ +    TT L  M ++     G   V+ G LT+GDL             +  L + Y
Sbjct: 343 LNSGQNLIFTTALTAMMYM-----GCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVY 397

Query: 390 SELMQGVGAASRLFDLTDH---ISSIS-PTKGQKYIPGKGDIEFKNVSFSYPTRPENQIF 445
            +L Q +     LF L  +   I S+  P    +++P   +I F+NV+F Y   P+ +I 
Sbjct: 398 RDLKQSLIDMETLFKLRKNEVKIKSVERPLMLPEHVPY--EITFENVTFGY--HPDRKIL 453

Query: 446 KDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHI 505
           K+ +  +P G    IVG SG GKSTI  L+ R+Y+P +G+IL++G+DI + +   LRR I
Sbjct: 454 KNASFTIPAGWKTAIVGSSGSGKSTILKLVFRFYDPESGRILINGRDIKEYDIDALRRVI 513

Query: 506 GLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGA 565
           G+V Q+  L + TI +N+ +G  + AT EE+++  ++      I K P G++T++G +G 
Sbjct: 514 GVVPQDTPLFNDTIWENVKFGRID-ATDEEVKTAVQKAQLAPLIKKLPQGFETIVGERGL 572

Query: 566 LLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625
           ++SGG++QR+AIAR L+K   I+  DEATSALD  +E A+  T      SGS T V IAH
Sbjct: 573 MISGGEKQRLAIARVLLKNARIMFFDEATSALDTHTEQALLRTIRSNFPSGSRTSVYIAH 632

Query: 626 RLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLT 667
           RL TI  ++ +IVL  +G+V E GK  EL A P S   +L T
Sbjct: 633 RLRTIADADKIIVL-DNGTVKEDGKHIELLATPGSLYRELWT 673

>KLTH0B09482g Chr2 complement(777282..779366) [2085 bp, 694 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 694

 Score =  213 bits (541), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 148/433 (34%), Positives = 226/433 (52%), Gaps = 22/433 (5%)

Query: 258 FAPPILWSASVFGKKIRHTS--KDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYN 315
           F   +L+S   F      T   K   +A  +   VA + L   + V+ F  EQ   ++Y+
Sbjct: 262 FTTMLLYSIFTFKTTAWRTEFRKSANKADNKAATVAVDSLINFEAVKYFNNEQFLANKYH 321

Query: 316 GAIRGIYN----VGRKAAFINA-EFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTA 370
            ++    +    V +  AF+NA + F  T+ L  M ++     G   V+ G+L++GDL  
Sbjct: 322 NSLAQYRDSQIKVAQSLAFLNAGQNFIFTSALTAMMYM-----GCTGVISGTLSVGDLVL 376

Query: 371 FMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSIS----PTKGQKYIPGKGD 426
                      +  L + Y EL Q +     LF L  +   I     P       P K  
Sbjct: 377 INQLVFQLSVPLNFLGSVYRELKQSLIDMESLFQLQRNKVKIQNKEKPLMLSSQRPSK-- 434

Query: 427 IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI 486
           I F+NVSF Y   P+  I K+ +  +P G    IVGPSG GKSTI  L+ R+Y+P  G+I
Sbjct: 435 IVFENVSFGYD--PDRMILKNSSFTMPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRI 492

Query: 487 LVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCH 546
           LVDG+D+ +++ ++LRR IG+V Q+  L + +I +N+ +G    A+ EEIR   ++    
Sbjct: 493 LVDGKDVRELDIESLRRAIGVVPQDTPLFNDSIWENVRFGKIS-ASDEEIRLAVEKAQLE 551

Query: 547 NFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAIN 606
           + + + P G DT++G +G ++SGG++QR+AIAR L+K   I+  DEATSALD  +E A+ 
Sbjct: 552 SLVDQLPKGRDTIVGERGLMISGGEKQRLAIARVLLKDAPIMFFDEATSALDTHTEQALL 611

Query: 607 YTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLL 666
            T      +GS T V IAHRL TI  ++ +IV+ + G V E GK  EL A P S   +L 
Sbjct: 612 RTIKDNFPTGSKTSVYIAHRLRTIADADKIIVI-QQGQVKEEGKHAELLAKPGSLYAELW 670

Query: 667 TEKSSRSDGNDSL 679
             + +    N+ L
Sbjct: 671 NVQENLDVLNEEL 683

>SAKL0H00968g Chr8 (107767..109869) [2103 bp, 700 aa] {ON} highly
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of
           iron-sulfur (Fe/S) clusters to the cytosol member of the
           ATP-binding cassette (ABC) transporter family
          Length = 700

 Score =  212 bits (540), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 144/459 (31%), Positives = 236/459 (51%), Gaps = 23/459 (5%)

Query: 216 AYVVSRSMTQKVSDGFK-ALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIR 274
           +YV+S  +   +   F+ +++CG +      S +       + FA  +L+S   F     
Sbjct: 233 SYVLSAMVFHIIPIAFEISVVCGILTYQFGTSFAA------VTFATMLLYSIFTFKTTAW 286

Query: 275 HTS--KDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN----VGRKA 328
            T   +    A  +   VA + L   + V+ F  E+    +Y+ ++    N    V +  
Sbjct: 287 RTEFRRSANRADNKAASVALDSLINFEAVKYFNNERYLADKYHNSLTNYTNSQIKVAQSL 346

Query: 329 AFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTF 388
           AF+N    +   ++   +   ++  G   V+ G L++GDL             +  L + 
Sbjct: 347 AFLN----SGQNLIFTSALTAMMYMGCTGVMSGDLSVGDLVLINQLVFQLSVPLNFLGSV 402

Query: 389 YSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKG--DIEFKNVSFSYPTRPENQIFK 446
           Y EL Q +     LF L  +  +I  +K    +P     +I+F+NV+F Y   P+ +I +
Sbjct: 403 YRELKQSLIDMESLFKLQKNKVNIQNSKTPLMLPKDKPCEIKFENVTFGY--HPDRKILE 460

Query: 447 DINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIG 506
           + N  +P G    IVGPSG GKSTI  L+ R+Y+P  G+IL+DG+DI +++ K+LRR IG
Sbjct: 461 NANFTLPAGWKTAIVGPSGSGKSTILKLVFRFYDPQEGRILIDGKDIRELDLKSLRRAIG 520

Query: 507 LVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGAL 566
           +V Q+  L + TI +N+ +G    AT ++IR    +      I   P G +T++G +G +
Sbjct: 521 VVPQDTPLFNDTIWENVKFGKIT-ATDDDIRKAIDKAQLAPLIHSLPQGSETIVGERGLM 579

Query: 567 LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHR 626
           +SGG++QR+AIAR L+K   I+  DEATSALD  +E A+  T  +     S T + IAHR
Sbjct: 580 ISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQALLRTIKENFAGNSRTSIYIAHR 639

Query: 627 LSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKL 665
           L TI  ++ ++VL ++G V E GK  EL + P S   +L
Sbjct: 640 LRTIADADKIVVL-ENGRVKEEGKHAELLSKPTSLYSEL 677

>KLLA0A10131g Chr1 complement(889688..891850) [2163 bp, 720 aa] {ON}
           similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301C ATM1 Mitochondrial inner membrane transporter
           exports mitochondrially synthesized precursors of iron-
           sulfur (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 720

 Score =  211 bits (537), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 141/417 (33%), Positives = 223/417 (53%), Gaps = 18/417 (4%)

Query: 258 FAPPILWSASVFGKKIRHTS--KDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYN 315
           F   +L+S   F      T   +    A  +   VA + L   + V+ F  E+   ++Y+
Sbjct: 283 FVTMLLYSFFTFKTTAWRTEFRRSANRADNKAASVALDSLINFEAVKYFNNEEYLANKYH 342

Query: 316 GAIRGIYN----VGRKAAFINA-EFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTA 370
            ++    +    V +  AF+NA + F  T+ L  M ++     G+  V++G+LT+GDL  
Sbjct: 343 QSLSKYRDSQIKVAQSLAFLNAGQNFIFTSALTAMMYM-----GASGVMEGALTVGDLVL 397

Query: 371 FMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGK--GDIE 428
                      +  L + Y EL Q +     LF L  +   I  T+    +P     +I+
Sbjct: 398 INQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKLQKNPILIKNTERPLMLPEHLPCEIK 457

Query: 429 FKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILV 488
           F+NV+F Y  +P+  I K+    + PG    IVGPSG GKSTI  L+ R+Y+P  G+IL+
Sbjct: 458 FENVTFGY--QPDRNILKNATFTIAPGKKTAIVGPSGSGKSTILRLVFRFYDPQQGRILL 515

Query: 489 DGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNF 548
           DG+DI +++   LRR +G+V Q+  L + TI +N+ +G    AT  EI +  ++    + 
Sbjct: 516 DGKDIRELDLDELRRIVGVVPQDTPLFNDTIWENVKFGRIN-ATDNEIVTAIEKAQLSDL 574

Query: 549 ITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYT 608
           I K P G +T++G +G ++SGG++QR+AIAR L+K   I+  DEATSALD  +E ++  T
Sbjct: 575 IHKLPKGTETIVGERGLMISGGEKQRLAIARVLLKDTPIMFFDEATSALDTHTEQSLLKT 634

Query: 609 FGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKL 665
             +     + T V IAHRL TI  ++ +IVL ++G+V E G    L ANPNS   +L
Sbjct: 635 IKENFSDVAKTSVYIAHRLRTIADADKIIVL-ENGAVREEGTHNALLANPNSLYSEL 690

>KNAG0E01320 Chr5 (261901..263988) [2088 bp, 695 aa] {ON} Anc_5.20
           YMR301C
          Length = 695

 Score =  207 bits (528), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 130/378 (34%), Positives = 206/378 (54%), Gaps = 15/378 (3%)

Query: 290 VAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN----VGRKAAFINAEFFTSTTMLGDM 345
           +A + L   + V+ F  E     +YN A+    +    V +  AF+N    +   ++   
Sbjct: 287 IALDSLINFEAVKYFNNESYLASKYNNALMTYRDAQIKVSQSLAFLN----SGQNLIFTS 342

Query: 346 SFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDL 405
           +   ++  G   +L G+LT+GDL             +  L + Y EL Q +     LF L
Sbjct: 343 ALTAMMYMGCTGILGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKL 402

Query: 406 TDHISSISPTKGQKYIPGKG---DIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVG 462
             +   I   +  K +P  G   +I F+NV+F Y   P+  I K+ +  +  G  + IVG
Sbjct: 403 RRNEVVIKNVEQPKMLPADGKPFEIRFENVTFGY--EPDRTILKNASFVIAAGKKIAIVG 460

Query: 463 PSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDN 522
           PSG GKSTI  L+ R+Y+P  G+IL++G D+ +++  +LR+ IG+V Q+  L + TI +N
Sbjct: 461 PSGSGKSTILKLVFRFYDPQEGRILINGIDVKEIDLDSLRKVIGVVPQDTPLFNDTIWEN 520

Query: 523 ITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALI 582
           + +G  + AT EE+ +  ++      I+K   G DT++G +G ++SGG++QR+AIAR L+
Sbjct: 521 VRFGRID-ATDEEVWAAVEKAHLSPLISKLSRGTDTIVGERGLMISGGEKQRLAIARVLL 579

Query: 583 KKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKD 642
           K  +I+  DEATSALD  +E  +  T     K+GS T + IAHRL TI  ++ +IVL +D
Sbjct: 580 KNADIMFFDEATSALDTHTEQNLLKTIRANFKTGSKTSIYIAHRLRTIADADKIIVL-ED 638

Query: 643 GSVIEAGKFKELFANPNS 660
           GSV E G   EL A  +S
Sbjct: 639 GSVKEEGTHTELLARDHS 656

>KAFR0I02580 Chr9 complement(520294..522423) [2130 bp, 709 aa] {ON}
           Anc_5.20 YMR301C
          Length = 709

 Score =  206 bits (523), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 134/391 (34%), Positives = 210/391 (53%), Gaps = 17/391 (4%)

Query: 278 KDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN----VGRKAAFINA 333
           +D  +A  +   +A + L   + V+ F  E     +YN A+    N    + +  AF+N+
Sbjct: 302 RDANKADNKGASIALDSLINFEAVKYFNNENYLSSKYNSALIDYRNSQIKISKSLAFLNS 361

Query: 334 -EFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSEL 392
            +    TT L  M ++     G   V+ G+LT+GDL             +  L + Y EL
Sbjct: 362 GQNLIFTTALTGMMYL-----GCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYREL 416

Query: 393 MQGVGAASRLFDLTDHISSISPTKGQKYI---PGKGDIEFKNVSFSYPTRPENQIFKDIN 449
            Q +     LF L  +   I   +  K I    G  +I F+NV+F Y    + +I K+ +
Sbjct: 417 KQSLIDMESLFKLRKNEVKIHNIENPKIILKEDGPFEITFENVTFGY--HADRKILKNAS 474

Query: 450 IKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQ 509
             +P G    IVGPSG GKSTI  L+ R+Y+P  G+IL++G D+ ++   +LR+ IG+V 
Sbjct: 475 FTIPAGWKTAIVGPSGSGKSTILKLVFRFYDPEEGRILINGIDVREIELDSLRKLIGVVP 534

Query: 510 QEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSG 569
           Q+  L + +I +N+ +G  + A   EI  V ++    + I K P  Y+T++G +G ++SG
Sbjct: 535 QDTPLFNDSIWENVKFGRID-ALDSEIYEVIEKAQLDSLIRKLPQSYETIVGERGLMISG 593

Query: 570 GQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLST 629
           G++QR+AIAR L+K  +++  DEATSALD  +E A+  T     K+GS T + IAHRL T
Sbjct: 594 GEKQRLAIARVLLKDASVMFFDEATSALDTHTEQALLKTIRANFKTGSRTSIYIAHRLRT 653

Query: 630 IKRSENVIVLGKDGSVIEAGKFKELFANPNS 660
           I  ++ +IVL +DG+V E G   EL A   S
Sbjct: 654 IADADKIIVL-EDGTVREEGTHNELLAKSTS 683

>TPHA0L02270 Chr12 complement(473597..475732) [2136 bp, 711 aa] {ON}
           Anc_5.20 YMR301C
          Length = 711

 Score =  205 bits (522), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 135/410 (32%), Positives = 211/410 (51%), Gaps = 15/410 (3%)

Query: 281 QEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGI----YNVGRKAAFINAEFF 336
            +A  +   +A + L   + V+ F  EQ    +YN +++        V +  AF+N    
Sbjct: 305 NKADNKGASIALDSLINFEAVKYFNNEQYLASKYNTSLKSYTEAQVKVAQSLAFLN---- 360

Query: 337 TSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGV 396
           +   ++   +   ++  G   +L G+L++GDL             +  L + Y +L Q +
Sbjct: 361 SGQNLIFTSALTAMMYMGCTGILGGNLSVGDLVLINQLVFQLSVPLNFLGSVYRDLKQSL 420

Query: 397 GAASRLFDLTDHISSISPTKGQKYIP---GKGDIEFKNVSFSYPTRPENQIFKDINIKVP 453
                LF L  +   I   K    +    G  +IEFKNV+F Y   P  +I ++ +  +P
Sbjct: 421 IDMESLFKLRKNEVKILNNKNPAILSLKDGPFNIEFKNVTFGYD--PNRKILRNASFIIP 478

Query: 454 PGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPI 513
            G    +VGPSG GKSTI  L+ R+Y+P  G++LV+G D+   +  +LRR IG+V Q+  
Sbjct: 479 AGVKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLVNGIDVRDYDLDSLRRAIGVVPQDTP 538

Query: 514 LMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQ 573
           L + TI +N+ +G    AT E+I +  ++      I K P  Y+T++G +G ++SGG++Q
Sbjct: 539 LFNDTIWENVKFGDVT-ATDEQILNAVEKAQLGTLIEKLPKKYETIVGERGLMISGGEKQ 597

Query: 574 RIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRS 633
           R+AIAR L+K   I+  DEATSALD  +E  +  T       GS T V IAHRL T+  S
Sbjct: 598 RLAIARVLLKNAPIMFFDEATSALDTHTEQELLKTIKNNFDKGSRTSVYIAHRLRTVADS 657

Query: 634 ENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPP 683
           + +IVL K+GS+ E G    L + PNS    L   + +    NDSL   P
Sbjct: 658 DKIIVL-KEGSIFEEGTHLGLLSKPNSLYKDLWNIQENLDMINDSLKVKP 706

>TDEL0G00430 Chr7 (89431..91521) [2091 bp, 696 aa] {ON} Anc_5.20
           YMR301C
          Length = 696

 Score =  204 bits (518), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 130/391 (33%), Positives = 213/391 (54%), Gaps = 17/391 (4%)

Query: 278 KDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN----VGRKAAFINA 333
           +D  +A  +   VA + L   + V+ F  E     +Y+ ++    +    + +  AF+NA
Sbjct: 281 RDANKADNKAASVALDSLINFEAVKHFNNENYLAGKYHNSLMKYRDSQVKIAQSLAFLNA 340

Query: 334 -EFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSEL 392
            + F  T+ L  M ++     G   V+ G LT+GDL             +  L + Y EL
Sbjct: 341 GQNFIFTSALSAMMYM-----GCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYREL 395

Query: 393 MQGVGAASRLFDLTDHISSISPTKGQKYIP---GKGDIEFKNVSFSYPTRPENQIFKDIN 449
            Q +     LF+L ++   I        +P   G  +I+F+NV+F Y TR   +I ++ +
Sbjct: 396 KQSLIDMEALFNLRNNKIKIHNNDKPLMLPENAGPFEIKFENVTFGYDTR--RKILRNAS 453

Query: 450 IKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQ 509
             +P G    IVGPSG GKSTI  L+ R+Y+P +G++LV+G+D+ + +  + R+ IG+V 
Sbjct: 454 FTIPAGVKTAIVGPSGSGKSTILKLVFRFYDPESGRVLVNGKDVREYDLDSFRKVIGVVP 513

Query: 510 QEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSG 569
           Q+  L + TI +N+ +G  + AT +E+ +  ++      I K P G  T++G +G ++SG
Sbjct: 514 QDTPLFNDTIWENVKFGRID-ATDDEVTNAIEKAQLAPLIHKLPVGSATIVGERGLMISG 572

Query: 570 GQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLST 629
           G++QR+AIAR L+K   I+  DEATSALD  +E ++  T  +    GS T V +AHRL T
Sbjct: 573 GEKQRLAIARVLLKNSQIMFFDEATSALDTHTEQSLLKTIRENFDRGSRTSVYVAHRLRT 632

Query: 630 IKRSENVIVLGKDGSVIEAGKFKELFANPNS 660
           I  ++ ++VL ++G V E G   EL + PNS
Sbjct: 633 IADADKILVL-EEGCVREEGSHTELLSRPNS 662

>YKL209C Chr11 complement(42423..46295) [3873 bp, 1290 aa] {ON}
            STE6Plasma membrane ATP-binding cassette (ABC)
            transporter required for the export of a-factor,
            catalyzes ATP hydrolysis coupled to a-factor transport;
            contains 12 transmembrane domains and two ATP binding
            domains; expressed only in MATa cells
          Length = 1290

 Score =  205 bits (522), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 152/523 (29%), Positives = 264/523 (50%), Gaps = 26/523 (4%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFY--DTHKVGDLISRLGSDAYVVSRSM 223
            NFA+  +L   SE  V  LR+ VM K   ++ +++  + +K  ++ + + +D   +   +
Sbjct: 777  NFAKGFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISALVLNDLRDLRSLV 836

Query: 224  TQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEA 283
            ++ +S     +    +G+   +    +LS V +   P I+  ++++G  ++    D + +
Sbjct: 837  SEFLSAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSAIYGGILQKCETDYKTS 896

Query: 284  TGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLG 343
              QL     + ++ +KT++   AE      Y+     +  +  K A       + T M+ 
Sbjct: 897  VAQLENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQIASKRAIATGFGISMTNMIV 956

Query: 344  DMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLF 403
                 ++  YG  LV+    T  ++        +T  S   L +   ++ +G  AAS ++
Sbjct: 957  MCIQAIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAASWIY 1016

Query: 404  DLTDHISSISPTK----------GQKYIPGKGD---IEFKNVSFSYPTRPENQIFKDINI 450
             + D   +    +          G  Y  GK     +  +N++F+YP+ P   ++K++N 
Sbjct: 1017 RILDEKHNTLEVENNNARTVGIAGHTY-HGKEKKPIVSIQNLTFAYPSAPTAFVYKNMNF 1075

Query: 451  KVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQ 510
             +  G  + I+G SG GKST+ LLL + YN   G+I +DG D++  N  +LR+ I +V+Q
Sbjct: 1076 DMFCGQTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKEISVVEQ 1135

Query: 511  EPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGG 570
            +P+L +GTIRDN+TYGL +   + E+    K    H+F+   P G DT I     LLSGG
Sbjct: 1136 KPLLFNGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQGLDTRIDT--TLLSGG 1193

Query: 571  QRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG--SMTIVSIAHRLS 628
            Q QR+ IARAL++K  IL+LDE TSALD  S   IN    +++K G  ++  + I H   
Sbjct: 1194 QAQRLCIARALLRKSKILILDECTSALDSVSSSIIN----EIVKKGPPALLTMVITHS-E 1248

Query: 629  TIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
             + RS N I + KDG V+E G F  L+ N   EL ++++ +SS
Sbjct: 1249 QMMRSCNSIAVLKDGKVVERGNFDTLY-NNRGELFQIVSNQSS 1290

 Score =  191 bits (486), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 150/518 (28%), Positives = 247/518 (47%), Gaps = 23/518 (4%)

Query: 176 LSERVVARLRSGVMNKTLHQD-SEFYDTHK--VGDLISRLGSDAYVVSRSMTQKVSDGFK 232
           + ER   R+RS ++   L +   E+YD ++  +GD  +++      +  S  +  +  F+
Sbjct: 99  IGERQGFRIRSQILEAYLEEKPMEWYDNNEKLLGDF-TQINRCVEELRSSSAEASAITFQ 157

Query: 233 ALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAE 292
            L+     +G     S  L+ ++L  +P I + A VF + I   S+     T +  ++  
Sbjct: 158 NLVAICALLGTSFYYSWSLTLIILCSSPIITFFAVVFSRMIHVYSEKENSETSKAAQLLT 217

Query: 293 EQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLL 352
             ++  + V+ +  ++ E  ++   I        K+ F  A        L    F+    
Sbjct: 218 WSMNAAQLVRLYCTQRLERKKFKEIILNCNTFFIKSCFFVAANAGILRFLTLTMFVQGFW 277

Query: 353 YGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSI 412
           +GS ++ +G L I D+          GS++         L +G  A  ++  L    S  
Sbjct: 278 FGSAMIKKGKLNINDVITCFHSCIMLGSTLNNTLHQIVVLQKGGVAMEKIMTLLKDGSKR 337

Query: 413 SP---TKGQKYIP---GKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGR 466
           +P   T   ++ P      D+ F NVSFSYP+RP   + K++++    G    IVG SG 
Sbjct: 338 NPLNKTVAHQF-PLDYATSDLTFANVSFSYPSRPSEAVLKNVSLNFSAGQFTFIVGKSGS 396

Query: 467 GKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYG 526
           GKST++ LLLR+Y+  NG I ++G +I  ++ K L  +I +V+Q   L + T+R NI  G
Sbjct: 397 GKSTLSNLLLRFYDGYNGSISINGHNIQTIDQKLLIENITVVEQRCTLFNDTLRKNILLG 456

Query: 527 L------AEPATKEE---IRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAI 577
                  A+ +T E    I+   +      FI   PDG +T+IG  G  LSGGQ+QR+AI
Sbjct: 457 STDSVRNADCSTNENRHLIKDACQMALLDRFILDLPDGLETLIGTGGVTLSGGQQQRVAI 516

Query: 578 ARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVI 637
           ARA I+   IL LDEA SALD+     +        K G  TI+ + H LS I+ S++ +
Sbjct: 517 ARAFIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRK-GKTTII-LTHELSQIE-SDDYL 573

Query: 638 VLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDG 675
            L K+G V+E+G   EL A+P +        ++  SD 
Sbjct: 574 YLMKEGEVVESGTQSELLADPTTTFSTWYHLQNDYSDA 611

>AGL335W Chr7 (82640..84715) [2076 bp, 691 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR301C (ATM1)
          Length = 691

 Score =  201 bits (511), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 141/454 (31%), Positives = 230/454 (50%), Gaps = 23/454 (5%)

Query: 216 AYVVSRSMTQKVSDGFK-ALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIR 274
           +YV+S  +   +   F+ +++CG +      S +       + F+  +L+S   F     
Sbjct: 225 SYVLSAMVFHIIPITFEISMVCGILTYQFGASFAA------ITFSTMLLYSIFTFRTTAW 278

Query: 275 HTS--KDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN----VGRKA 328
            T   +D  +A  +   VA + L   + V+ F  E+    +Y+ ++    +    V +  
Sbjct: 279 RTRFRRDANKADNKAASVALDSLINFEAVKYFNNEKYLADKYHTSLMKYRDSQIKVSQSL 338

Query: 329 AFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTF 388
           AF+N    T   ++   +   ++      V+QGSLT+GDL             +  L + 
Sbjct: 339 AFLN----TGQNLIFTTALTAMMYMACNGVMQGSLTVGDLVLINQLVFQLSVPLNFLGSV 394

Query: 389 YSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKG--DIEFKNVSFSYPTRPENQIFK 446
           Y +L Q +     LF L  +  +I  +   + +P     DI F+NV+F Y   PE +I  
Sbjct: 395 YRDLKQSLIDMESLFKLQKNQVTIKNSPNAQNLPIHKPLDIRFENVTFGYD--PERRILN 452

Query: 447 DINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIG 506
           +++  +P G    IVGPSG GKSTI  L+ R+Y P  G+ILV G DI  ++  +LR+ IG
Sbjct: 453 NVSFTIPAGMKTAIVGPSGSGKSTILKLVFRFYEPEQGRILVGGTDIRDLDLLSLRKAIG 512

Query: 507 LVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGAL 566
           +V Q+  L + TI +N+ +G    +  E +R++ K       +   P G  T++G +G +
Sbjct: 513 VVPQDTPLFNDTIWENVKFGNISSSDDEILRAIEKAQLT-KLLQNLPKGASTVVGERGLM 571

Query: 567 LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHR 626
           +SGG++QR+AIAR L+K   ++  DEATSALD  +E A+ +T  Q   S S T V +AHR
Sbjct: 572 ISGGEKQRLAIARVLLKDAPLMFFDEATSALDTHTEQALLHTIQQNFSSNSKTSVYVAHR 631

Query: 627 LSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS 660
           L TI  ++ +IVL + GSV E G    L A+  S
Sbjct: 632 LRTIADADKIIVL-EQGSVREEGTHSSLLASQGS 664

>Ecym_5649 Chr5 complement(1310682..1312772) [2091 bp, 696 aa] {ON}
           similar to Ashbya gossypii AGL335W
          Length = 696

 Score =  201 bits (510), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 130/400 (32%), Positives = 210/400 (52%), Gaps = 14/400 (3%)

Query: 278 KDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN----VGRKAAFINA 333
           +D   A  +   VA + L   + V+ F  E+   ++Y+ ++    +    V +  AF+N+
Sbjct: 293 RDANSADNKAASVALDSLINFEAVKYFNNEEYLANKYHKSLLTYRDSQIKVQQSLAFLNS 352

Query: 334 EFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELM 393
                  ++   +   V+      V++GSLT+GDL             +  L + Y EL 
Sbjct: 353 ----GQNLIFTSALTAVMYMACSGVMEGSLTVGDLVLINQLIFQLSLPLNFLGSVYRELK 408

Query: 394 QGVGAASRLFDLTDHISSISPTKGQKYIPGK--GDIEFKNVSFSYPTRPENQIFKDINIK 451
           Q +     LF L  +  +I      + +P K   DI F+NV+F Y   PE +I K+    
Sbjct: 409 QSLIDMESLFRLQKNKITIKNVLNPQMLPEKLPSDIRFENVTFGYD--PERKILKNATFT 466

Query: 452 VPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQE 511
           +P G    IVGPSG GKSTI  L+ R+Y P  G+IL+DG+DI +V+  +LR+ IG+V Q+
Sbjct: 467 IPAGKKTAIVGPSGSGKSTILRLVFRFYEPEQGRILIDGKDIREVDLDSLRKSIGVVPQD 526

Query: 512 PILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQ 571
             L + TI +N+ +G  + A+ ++I +  ++      I   P G +T++G +G ++SGG+
Sbjct: 527 TPLFNDTIWENVKFGRID-ASDKDITNAIERAQLTKLIQNLPKGINTIVGERGLMISGGE 585

Query: 572 RQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIK 631
           +QR+AI+R L+K   ++  DEATSALD  +E ++  T  +  +  S T V IAHRL TI 
Sbjct: 586 KQRLAISRVLLKDCPLMFFDEATSALDTHTEQSLLKTINENFEGQSKTSVYIAHRLRTIA 645

Query: 632 RSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
            ++ +IVL  +  V E G  K L   P S   +L   + S
Sbjct: 646 DADKIIVLN-NSRVHEEGDHKTLLKTPGSLYSELWNIQES 684

>NCAS0D02430 Chr4 (462683..464791) [2109 bp, 702 aa] {ON} Anc_5.20
          Length = 702

 Score =  200 bits (508), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 138/426 (32%), Positives = 221/426 (51%), Gaps = 25/426 (5%)

Query: 278 KDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN----VGRKAAFINA 333
           +D  +A  +   VA + L   + V+ F  E+    +Y+ ++    +    V +  A++N+
Sbjct: 284 RDANKADNKGASVALDSLINFEAVKYFNNEKYLADKYHTSLIKYRDSQIKVSQSLAYLNS 343

Query: 334 EFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELM 393
                  ++   +   ++  G   V+ G LT+GDL             +  L + Y EL 
Sbjct: 344 ----GQNLIFTSALTAMMYMGCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYRELK 399

Query: 394 QGVGAASRLFDLTDHISSISPTKGQKYI-----PGKGDIEFKNVSFSYPTRPENQIFKDI 448
           Q +     LF L  +   I    G   I      G  +I F+NV+F Y ++   +I  + 
Sbjct: 400 QSLIDMESLFQLRKN--EIKIENGTNPIVLKASDGPFEITFENVTFGYDSK--RKILNNA 455

Query: 449 NIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLV 508
           +  +P G    +VGPSG GKSTI  L+ R+Y+P  G+IL++G D+ + +  +LRR +G+V
Sbjct: 456 SFTIPGGLKTAVVGPSGSGKSTILKLVFRFYDPEQGRILINGVDVKEYDVDSLRRVMGVV 515

Query: 509 QQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLS 568
            Q+  L + TI +N+ +G  + AT EE+ +V ++      I K P GY+T++G +G ++S
Sbjct: 516 PQDTPLFNDTIWENVKFGRID-ATDEEVHTVIEKAQLAPLIKKLPQGYETIVGERGMMIS 574

Query: 569 GGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLS 628
           GG++QR+AIAR L+K   I+  DEATSALD  +E A+  T     +SGS T V IAHRL 
Sbjct: 575 GGEKQRLAIARVLLKNAKIMFFDEATSALDTHTEQALLTTIRANFESGSRTSVYIAHRLR 634

Query: 629 TIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPPPNATQ 688
           TI  ++ +IVL +DG+V E G    L A P S    L   + +     D L       TQ
Sbjct: 635 TIADADKIIVL-EDGAVKEEGTHSGLLATPGSLYANLWNIQENLDVIEDEL------KTQ 687

Query: 689 DKVVEQ 694
           ++V+ Q
Sbjct: 688 EEVLLQ 693

>CAGL0M13739g Chr13 complement(1347781..1349964) [2184 bp, 727 aa]
           {ON} similar to uniprot|P40416 Saccharomyces cerevisiae
           YMR301c ATM1
          Length = 727

 Score =  199 bits (507), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 134/391 (34%), Positives = 210/391 (53%), Gaps = 17/391 (4%)

Query: 278 KDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN----VGRKAAFINA 333
           K+  +A  +   VA + L   + V+ F  E    ++Y+ ++    +    V +  AF+N+
Sbjct: 313 KEANKADNKGASVALDSLINFEAVKYFNNESYLANKYHNSLIKYRDSQVKVAQSLAFLNS 372

Query: 334 -EFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSEL 392
            +    TT L  M ++     G   V+ G LT+GDL             +  L + Y EL
Sbjct: 373 GQSLIFTTALTGMMYM-----GCTGVIGGDLTVGDLVLINQLVFQLSVPLNFLGSVYREL 427

Query: 393 MQGVGAASRLFDLTDH---ISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDIN 449
            Q +     LF L  +   I + S  K      G  +I+F+NV+F Y    + +I K+ +
Sbjct: 428 KQSLIDMESLFKLRKNQVKIQNCSQPKSISKSDGPFEIKFENVTFGYD--GQRKILKNAS 485

Query: 450 IKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQ 509
             +P G    I GPSG GKST+  L+ R+Y+P  G++LV+G D+ + +   LR+ IG+V 
Sbjct: 486 FTIPAGMKTAIAGPSGSGKSTVLKLVFRFYDPEEGRVLVNGVDVREYDIDQLRKAIGVVP 545

Query: 510 QEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSG 569
           Q+  L + TI +N+ +G  E A+ EEI  V  +    + I K P G  T++G +G ++SG
Sbjct: 546 QDTPLFNDTIWENVKFGRIE-ASDEEITRVIDKAQLSDLIAKLPQGSSTIVGERGLMISG 604

Query: 570 GQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLST 629
           G++QR+AIAR L+K  +I+  DEATSALD  +E ++  T  +   SG  T V IAHRL T
Sbjct: 605 GEKQRLAIARVLLKDADIMFFDEATSALDTHTEQSLLRTIRRNFNSGEKTSVYIAHRLRT 664

Query: 630 IKRSENVIVLGKDGSVIEAGKFKELFANPNS 660
           I  ++ +IVL ++G+V E G  +EL A  NS
Sbjct: 665 IADADKIIVL-EEGTVREEGTHQELLARENS 694

>NDAI0D01540 Chr4 (369687..373568) [3882 bp, 1293 aa] {ON} Anc_1.527
           YKL209C
          Length = 1293

 Score =  202 bits (514), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 150/510 (29%), Positives = 251/510 (49%), Gaps = 30/510 (5%)

Query: 176 LSERVVARLRSGVMNKTLHQDSEFYDTHK--VGDLISRLGSDAYVVSRSMTQKVSDGFKA 233
           L ER    +R  ++N+ L +  E+YD H   +GD  +++      +  S  +  +  F+ 
Sbjct: 100 LGERQGFAIRKRLLNEYLVKPMEWYDCHDKLLGDF-TQVNRCVEELRSSSAEASAITFQN 158

Query: 234 LICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEE 293
            +     IG     S  L+ ++L  AP I+  A +F   I   ++     TG+  ++   
Sbjct: 159 FVAMLALIGTSFYYSWSLTLIILCSAPLIILFAILFSHMIHKYTELENSETGKAAQLLNW 218

Query: 294 QLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTS--TTMLGDMS---FI 348
            ++  + V+ +  +  E+H +   +    ++     FI + F+ S  T++L  +S   F+
Sbjct: 219 SMNSAQLVKLYCTQAYEIHSFKELVGQCNDL-----FIKSCFYVSANTSILRFLSLSMFV 273

Query: 349 VVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDH 408
               +G+ +V +G L+I D+          GS++         L +G  A  ++ D    
Sbjct: 274 QGFWFGAIMVKKGKLSIKDVITCFHSCLMLGSTLNNTLQQIVVLQKGDVALKKILDFIS- 332

Query: 409 ISSISPTKGQKYIPG----KGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPS 464
            S  SP+    Y P      G+I F+N+SF+YPTRP   + KD++I   PG +  I+G S
Sbjct: 333 FSQRSPSLEPPYEPSVPISNGEISFQNISFAYPTRPHQTVLKDVSITFQPGRSTFIIGKS 392

Query: 465 GRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNIT 524
           G GKST+A LLL++YN   G I +   ++ K+N   L  +I +V+Q   L + T+R+N+ 
Sbjct: 393 GSGKSTLANLLLKFYNDYQGSIKIGNTNVKKINKNWLFENITVVEQRCTLFNDTLRNNLL 452

Query: 525 YGLAEPATKEE---------IRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRI 575
            G++    K E         ++   +       I + PDG DT+IGA G  LSGGQ+QR+
Sbjct: 453 LGISNSNQKVEQDDIEISQRLKDACRIAMLEELIRELPDGLDTIIGAGGVSLSGGQQQRV 512

Query: 576 AIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSEN 635
           AIARA IK  ++L+LDEA SALD+     I        +SG  TI+ + H LS +   + 
Sbjct: 513 AIARAYIKDSSVLILDEAVSALDIIHRELIMKAIKN-WRSGKTTII-LTHDLSQLDYDDF 570

Query: 636 VIVLGKDGSVIEAGKFKELFANPNSELCKL 665
           + V  +DG V E+G  + L  +  +   KL
Sbjct: 571 LYVF-EDGEVKESGYQQALLQDEKTIFSKL 599

 Score =  181 bits (458), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 151/520 (29%), Positives = 251/520 (48%), Gaps = 27/520 (5%)

Query: 166  NFARIVMLRILSERVVARLR----SGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSR 221
            NF +  +L   SE  +  LR    + +MNK L   S+  + +K  +L + L +D   +  
Sbjct: 782  NFLKSYILGYCSELWIMDLRNEAMAAIMNKRLDWFSK--EENKSSELSALLLNDLRDLRS 839

Query: 222  SMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQ 281
             +++ +S     ++   VG+   +    +LS V +   P I+  + ++G  ++      +
Sbjct: 840  LVSEFLSAMTTFIVVSLVGLIWALVSGWKLSLVCISMFPLIILVSGIYGSTLQRYETMYK 899

Query: 282  EATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTM 341
             A  +L     E ++ +KT++   A +  +  Y      +  +  K +       + T  
Sbjct: 900  TAVAELENHEYEIMTKIKTIRYLQASKYFIKNYKVLENNLKKIAHKRSIATGFGISITNT 959

Query: 342  LGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASR 401
            +      ++  YG  LV +G  +   +        +T  S   L +   ++ +G  AAS 
Sbjct: 960  IAVCIQSILYYYGLRLVFKGEYSSKKMFETFTLLLFTIISCTSLVSQIPDISRGQRAASW 1019

Query: 402  LFDLTDHI--SSISPTKGQK----YIPGKGD----IEFKNVSFSYPTRPENQIFKDINIK 451
            L+ + D    +  S   G +     I G  +    I  KN+ FSYP+    +I+K+I + 
Sbjct: 1020 LYRILDESDDNKESVDSGSRSADIIISGNTNSVPLISIKNLRFSYPSAQTVEIYKNITLH 1079

Query: 452  VPPGS-NVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQ 510
            V      + IVG SG GKST+  LL + Y      I +DG D+++ +   LR+ I +V+Q
Sbjct: 1080 VTSSQKTIGIVGESGSGKSTLMYLLTKLYKTPANSIYIDGTDVNEWDTLKLRKQISVVEQ 1139

Query: 511  EPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGG 570
             P L  GT+RDN+ YG     ++ EI  V K    + FI   P G D+ I  +  L+SGG
Sbjct: 1140 NPTLFEGTVRDNLVYGTLNDISEIEIYDVLKYLGIYEFIENLPMGLDSRIDTK--LVSGG 1197

Query: 571  QRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVS--IAHRLS 628
            Q QR+ IARAL++KP IL+LDE TSALD  S   IN     L+K+G  T+++  I H   
Sbjct: 1198 QAQRLCIARALLRKPTILILDECTSALDAASAHLIN----NLVKNGLPTVLTIVITHSKQ 1253

Query: 629  TIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTE 668
             ++   ++ V+ KDG + E G F EL  N NSEL +++ E
Sbjct: 1254 MMEACNSLAVI-KDGRLAEQGNFAELMKN-NSELRRIINE 1291

>Kpol_513.23 s513 complement(65118..67244) [2127 bp, 708 aa] {ON}
           complement(65118..67244) [2127 nt, 709 aa]
          Length = 708

 Score =  197 bits (502), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 129/383 (33%), Positives = 203/383 (53%), Gaps = 15/383 (3%)

Query: 290 VAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN----VGRKAAFINAEFFTSTTMLGDM 345
           +A + L   + V+ F  EQ   ++Y  ++    N    V +  AF+N    +   ++   
Sbjct: 310 IALDSLINFEAVKYFNNEQYLANKYYSSLVDYRNSQVKVAQSLAFLN----SGQNLIFTS 365

Query: 346 SFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDL 405
           +   ++  G   V+ G+LT+GDL             +  L + Y EL Q +     LF L
Sbjct: 366 ALTAIMYLGCTGVIGGNLTVGDLVLINQLVFQLSVPLNFLGSVYRELKQSLIDMESLFKL 425

Query: 406 TDHISSISPTKGQKYIPGK---GDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVG 462
             +   I        +P +    +I+F+NV+F Y    E +I K+ +  +P G    +VG
Sbjct: 426 RKNEIKIQNVHRPLMLPNELTPFEIKFENVTFGYD--KERKILKNASFTIPAGWKTAVVG 483

Query: 463 PSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDN 522
           PSG GKSTI  L+ R+Y+P  G+IL++G DI +++  +LR+ IG+V Q+  L + TI +N
Sbjct: 484 PSGSGKSTILKLVFRFYDPEEGRILLNGTDIKEIDLASLRKVIGVVPQDTPLFNDTIWEN 543

Query: 523 ITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALI 582
           + +G  E AT  EI    ++      I K P G +T++G +G ++SGG++QR+AIAR L+
Sbjct: 544 VKFGRIE-ATDNEILQAIEKAQLAPLIKKLPKGRETIVGERGLMISGGEKQRLAIARVLL 602

Query: 583 KKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKD 642
           K   I+  DEATSALD  +E ++  T  +     S T V IAHRL TI  ++ +IVL KD
Sbjct: 603 KNSGIMFFDEATSALDTHTEQSLLRTIKENFDGSSRTSVYIAHRLRTIADADKIIVL-KD 661

Query: 643 GSVIEAGKFKELFANPNSELCKL 665
           G V E G  ++L A   S   +L
Sbjct: 662 GQVEEEGTHRQLIAKKESLYSEL 684

>ZYRO0D07106g Chr4 (616125..618254) [2130 bp, 709 aa] {ON} similar
           to uniprot|P40416 Saccharomyces cerevisiae YMR301C ATM1
           Mitochondrial inner membrane transporter exports
           mitochondrially synthesized precursors of iron- sulfur
           (Fe/S) clusters to the cytosol member of the ATP-
           binding cassette (ABC) transporter family
          Length = 709

 Score =  197 bits (502), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 142/455 (31%), Positives = 231/455 (50%), Gaps = 24/455 (5%)

Query: 216 AYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRH 275
           +YV+S  +   +   F+  +  G+   +        +G+   F   +L+S   F      
Sbjct: 221 SYVLSAMVFHIIPITFEISVVCGI---LTYQFGASFAGIT--FTTMLLYSIFTFRTTAWR 275

Query: 276 TS--KDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYN----VGRKAA 329
           T   ++  +A  +   VA + L   + V++F  E+    +Y  ++    +    V +  A
Sbjct: 276 TKFRREANKADNKAASVALDSLINFEAVKNFNNEKYLAEKYETSLLKYRDSQVRVAQSLA 335

Query: 330 FINA-EFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTF 388
           F+N+ +    TT L  M ++     G   ++ GSLT+GDL             +  L + 
Sbjct: 336 FLNSGQNLIFTTALTAMMYM-----GCTGIIGGSLTVGDLVLINQLVFQLSVPLNFLGSV 390

Query: 389 YSELMQGVGAASRLFDLTDHISSISPTKGQKYIP---GKGDIEFKNVSFSYPTRPENQIF 445
           Y EL Q +     LF+L ++   I      K +P   G  DI F+NV+F Y   P  +I 
Sbjct: 391 YRELKQSLIDMESLFNLRNNPILIDNPSKPKMLPANAGPFDIVFENVTFGYD--PRRKIL 448

Query: 446 KDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHI 505
           ++ +  +P G    +VGPSG GKST+  L+ R+Y+P  G+ILV+G DI + +  +LRR I
Sbjct: 449 QNASFVIPAGWKTAVVGPSGSGKSTLLKLVFRFYDPQEGRILVNGIDIREYDLDSLRRAI 508

Query: 506 GLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGA 565
           G+V Q+  L + TI +N+ +G  +   +E  RS+ K       + + P G +T++G +G 
Sbjct: 509 GVVPQDTPLFNDTIWENVKFGRIDADDQEVTRSIEKAHLAP-LVYRLPGGLNTIVGERGL 567

Query: 566 LLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625
           ++SGG++QR+AIAR L+K  +I+  DEATSALD  +E A+  T       GS T V IAH
Sbjct: 568 MISGGEKQRLAIARVLLKNSSIMFFDEATSALDTHTEQALLRTIRANFDRGSKTSVYIAH 627

Query: 626 RLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS 660
           RL TI  ++ +IVL ++G   E G   EL    +S
Sbjct: 628 RLRTIADADKIIVL-EEGRPREEGTHHELLQKEDS 661

>NDAI0I02440 Chr9 complement(556154..558346) [2193 bp, 730 aa] {ON}
           Anc_5.20 YMR301C
          Length = 730

 Score =  195 bits (495), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 143/461 (31%), Positives = 234/461 (50%), Gaps = 33/461 (7%)

Query: 216 AYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRH 275
           +YV+S  +   +  GF+  +  G+   +        +G+   F   +L+S  +F   IR 
Sbjct: 257 SYVLSAMLFHIIPIGFEISVVCGI---LTYQFGASFAGIT--FTTMLLYS--IF--TIRT 307

Query: 276 TS------KDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAI----RGIYNVG 325
           T+      +D  +A  +   VA + L   + V+ F  E    ++Y+ ++         V 
Sbjct: 308 TAWRTQFRRDANKADNKGASVALDSLINFEAVKYFNNETYLSNKYHDSLLQYRDSTIKVA 367

Query: 326 RKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGL 385
           +  AF+N+       ++   +  +++  G   V++G+LT+GDL             +  L
Sbjct: 368 QSLAFLNS----GQNLIFTSALTMMMYLGCTGVIEGNLTVGDLVLINQLVFQLSVPLNFL 423

Query: 386 TTFYSELMQGVGAASRLFDLTDHISSISPTKG------QKYIPGKGDIEFKNVSFSYPTR 439
            + Y EL Q +     LF L  +   I   K        K   G  +I+F+NV+F Y T 
Sbjct: 424 GSVYRELKQSLIDMESLFQLRKNPIKIQNAKTGPAPIMLKSSDGPFEIKFENVTFGYDT- 482

Query: 440 PENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCK 499
              +I K+ +  +P G    +VGPSG GKSTI  L+ R+Y+P  G++L++G ++ + +  
Sbjct: 483 -NRKILKNASFIIPAGLKTAVVGPSGSGKSTILKLVFRFYDPEEGRVLINGINVQRYDID 541

Query: 500 TLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTM 559
           +LRR +G+V Q+  L + TI +N+ +G    A  EEI+ V ++      I K P    T+
Sbjct: 542 SLRRVMGVVPQDTPLFNDTIWENVKFGRIN-ANDEEIKQVIEKAQLAPLIEKLPQREKTI 600

Query: 560 IGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMT 619
           +G +G ++SGG++QR+AIAR L+K  NI+  DEATSALD  +E A+  T      SG+ T
Sbjct: 601 VGERGLMISGGEKQRLAIARVLLKDANIMFFDEATSALDTHTEQALLNTIRANFPSGTRT 660

Query: 620 IVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS 660
            + IAHRL TI  ++ +IVL +DG V E G   EL A   S
Sbjct: 661 SIYIAHRLRTIADADKIIVL-EDGKVKEEGSHNELLATKGS 700

>TBLA0C07000 Chr3 complement(1688965..1691142) [2178 bp, 725 aa]
           {ON} Anc_5.20 YMR301C
          Length = 725

 Score =  195 bits (495), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 134/413 (32%), Positives = 213/413 (51%), Gaps = 18/413 (4%)

Query: 258 FAPPILWSASVFGKKIRHTS--KDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYN 315
           F   +L+S   F      T   +   +A  +   +A + L   + V+ F  E+    +Y+
Sbjct: 283 FTTMLLYSIFTFKTTAWRTKFRRQANKADNKGASIALDSLINFEAVKYFNNEEYLAQKYH 342

Query: 316 GAIRGIYN----VGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAF 371
             +    +    V +  AF+N+       ++   +  V++  G   ++ G+LT+GDL   
Sbjct: 343 KTLSQYRDSQIKVAQSLAFLNS----GQNLIFTSALTVMMYMGCTGIIGGNLTVGDLVLI 398

Query: 372 MLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGD----I 427
                     +  L + Y EL Q +     LF L  +   I   +    +  KG     I
Sbjct: 399 NQLVFQLSVPLNFLGSVYRELKQSLIDMEYLFQLKKNPIIIKNVEKPLMLAEKGHMPMTI 458

Query: 428 EFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQIL 487
            F+NV+F Y    + +I K+ + ++  G    IVGPSG GKSTI  LL R+Y+P  G+IL
Sbjct: 459 RFENVTFGYD--KQRKILKNASFQIESGQKTAIVGPSGSGKSTILKLLFRFYDPEEGRIL 516

Query: 488 VDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHN 547
           V+G D  + +  +LR+ IG+V Q+  L + TI +N+ +G    A+ +EI  V  +     
Sbjct: 517 VNGVDAREYDIDSLRKVIGVVPQDTPLFNDTIWENVRFGRI-GASDDEITQVINKAQLGP 575

Query: 548 FITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINY 607
            + K P G +T++G +G ++SGG++QR+AIAR L+K  +I+  DEATSALD  +E A+  
Sbjct: 576 LLVKLPQGRETIVGERGLMISGGEKQRLAIARVLLKDADIMFFDEATSALDTHTEQALLK 635

Query: 608 TFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS 660
           T  +  K GS T V IAHRL TI  ++ +IVL ++G+V E GK  EL A   S
Sbjct: 636 TINENFKKGSRTSVYIAHRLRTIADADKIIVL-QEGTVREEGKHSELLARSGS 687

>Suva_11.11 Chr11 complement(26032..29904) [3873 bp, 1290 aa] {ON}
            YKL209C (REAL)
          Length = 1290

 Score =  197 bits (502), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 150/527 (28%), Positives = 259/527 (49%), Gaps = 36/527 (6%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFY--DTHKVGDLISRLGSDAYVVSRSM 223
            NFA+  +L   SE  +  LR+ +M+K   ++  ++  +++K  ++ + + +D   +   +
Sbjct: 778  NFAKGFLLGYCSEYWIMDLRNKIMDKLTRKNINWFSGESNKASEITALVLNDLRDLRSLV 837

Query: 224  TQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEA 283
            ++ +S     +    +G+   +    +LS V +   P I+  ++++G  ++    D + +
Sbjct: 838  SEFLSAMTSFVTVSTIGLVWALVSGWKLSLVCISMFPLIVIFSAIYGGILQKYETDYKTS 897

Query: 284  TGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLG 343
              QL     + ++ +KT++   AE      Y+   + +  +  K A       + T M+ 
Sbjct: 898  VAQLENCLYQIMTSIKTIKCLQAEFHFQLSYHDLKKKMEQIAYKRAIATGFGISVTNMIA 957

Query: 344  DMSFIVVLLYGSYLVLQGSLT---IGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAAS 400
                 ++  YG  LVL    T   + +    +L+T  + +S+ G      ++ +G  AAS
Sbjct: 958  MCIQAILYYYGLKLVLVHEYTSKKMFETFTLLLFTIMSCTSLVGQI---PDISRGQRAAS 1014

Query: 401  RLFDLTDHIS---------------SISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIF 445
             ++ + D                  S +   G + IP    I  +N+SF+YP+ P   IF
Sbjct: 1015 WIYRILDEEEDTLEIENNDARALDISGAEYYGDRNIP---IISIRNLSFAYPSAPNVPIF 1071

Query: 446  KDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHI 505
            K +++ +     + IVG SG GKST+ALLL R YN     I++DG D++  N  +LR+ I
Sbjct: 1072 KHMDLDMFCEQTIGIVGESGSGKSTLALLLTRLYNCEANSIIIDGTDVNDWNLTSLRKQI 1131

Query: 506  GLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGA 565
             +V+Q+P    G+IRDN+TYG      + EI  V K    ++F+   P G DT +     
Sbjct: 1132 SVVEQKPSFFDGSIRDNLTYGCLGEMLEVEIYDVLKYVGIYDFVASLPQGLDTRVDTN-- 1189

Query: 566  LLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG--SMTIVSI 623
            LLSGGQ QR+ IARAL++K  IL+LDE TSALD  S   IN     +++ G   +  + I
Sbjct: 1190 LLSGGQAQRLCIARALLRKSKILILDECTSALDSVSSRIIN----DIVRKGPPGLLTLVI 1245

Query: 624  AHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKS 670
             H    + R  N I + K G V+E G F  L+ N   EL +++  KS
Sbjct: 1246 THS-EQMMRCCNSIAVLKHGKVVEEGNFDNLY-NKEGELFRIVCNKS 1290

 Score =  157 bits (398), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 128/455 (28%), Positives = 217/455 (47%), Gaps = 19/455 (4%)

Query: 235 ICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQ 294
           IC  +G     S S  L+ ++L  +P I   A +F + I   ++     T    ++    
Sbjct: 163 ICALIGTSFYYSWS--LTLIILCSSPVITIFAVIFSRLIHTYTQKENTETSNAAQLFTWS 220

Query: 295 LSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYG 354
           ++  + V+ +  +  E  ++   I        K+    A        L    F+    +G
Sbjct: 221 MNAAQLVRLYCTQPLERQKFQEIILSCNTFFIKSCLYVAANAGILRFLTLTMFVQGFWFG 280

Query: 355 SYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISP 414
           S ++ +G L I D+          GS++         L +G  A  ++  L +  S  + 
Sbjct: 281 STMIRKGKLNINDVITCFHSCIMLGSTLNSTLHQIVVLQKGEVALQKIMALLESGSKQNA 340

Query: 415 TKGQKYIP-----GKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKS 469
           +  ++++         D+ F+NVSF+YP+RP   + +++N+K P G    IVG SG GKS
Sbjct: 341 SNTREHLQPPLNFATSDLVFENVSFAYPSRPSETVLQNVNLKFPSGQFTFIVGKSGSGKS 400

Query: 470 TIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNI------ 523
           TI+ LLL +Y+  +G IL++G++   +  K L  +I +V+Q   L + T++ NI      
Sbjct: 401 TISNLLLNFYDNYDGSILINGRNTQSIQQKLLVSNITVVEQRCTLFNDTLKKNILLGSTG 460

Query: 524 TYGLAEPAT---KEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARA 580
           + G A+  T      I+   +       I   PDG +T+IG+ G  LSGGQ+QR+AIARA
Sbjct: 461 SIGNADTNTIGNNNLIKDACRMALLDRLILDLPDGLETLIGSGGVSLSGGQQQRVAIARA 520

Query: 581 LIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLG 640
            I+   IL LDEA SALD+     +        K G  TI+ + H LS I+  +++ V+ 
Sbjct: 521 FIRDTPILFLDEAVSALDIVHRNLLMKAIRHWRK-GKTTII-LTHELSQIESDDHLYVM- 577

Query: 641 KDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDG 675
           ++G V+E+G   EL A+  +   K    ++  SD 
Sbjct: 578 QEGRVVESGIQSELLADSATTFSKWYYLQNDFSDA 612

>Kpol_1018.185 s1018 (464370..468200) [3831 bp, 1276 aa] {ON}
            (464370..468200) [3831 nt, 1277 aa]
          Length = 1276

 Score =  196 bits (499), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 150/522 (28%), Positives = 259/522 (49%), Gaps = 35/522 (6%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFY--DTHKVGDLISRLGSDAYVVSRSM 223
            NF +  +L   SE  +  LR+  M +   +  E++  + +K  ++ + L +D   +   +
Sbjct: 765  NFLKTFILGYCSEYWIMDLRNRAMEEIAQKKLEWFSREENKSPEIAALLMNDLRDLRSLV 824

Query: 224  TQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEA 283
            +Q +S     L    VG+   ++   +LS V +   P I+  + ++G  +++     +  
Sbjct: 825  SQFLSVISTFLTVSLVGLIWAIATGWKLSLVCISMFPLIVIFSIIYGTVLKNYETTYKTK 884

Query: 284  TGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLG 343
               L  +  E ++GVKT++    +      Y+     +  + RK A +       TT + 
Sbjct: 885  VANLENLEYEIITGVKTIKCLQLQNHFKKCYHKLKDEMGQIARKRAIVTGLGIAITTAIA 944

Query: 344  DMSFIVVLLYGSYLVLQGSL---TIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAAS 400
                 ++  YG  LV+ G     T+      +L+T  T +S   L +   ++ +G  AAS
Sbjct: 945  TTIQSILYYYGLKLVMDGEYSTRTMFQTFTLLLFTVMTCNS---LISQIPDISRGQRAAS 1001

Query: 401  RLFDLTDHISSISPTKGQKYIPGKGD--------------IEFKNVSFSYPTRPENQIFK 446
             ++ +   I     TK Q    G+ D              +   N+ F+YPT  +  I+ 
Sbjct: 1002 WIYRI---IEESEDTKEQTITDGRFDEIHCGEKVDKTQPLVSIHNLEFAYPTALDVNIYD 1058

Query: 447  DINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIG 506
            ++++ +  G  V IVG SG GKST+  LL + Y   +  I +DG D+++ + +TLRR I 
Sbjct: 1059 NLSLDLNVGQTVAIVGESGSGKSTLVYLLTKLYQVADNCIDIDGTDVNEWDNETLRRQIS 1118

Query: 507  LVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGAL 566
            +V+Q+P+L  GT+R+N+ YGL     + +I  + K    ++FI   P+G +T +    +L
Sbjct: 1119 VVEQKPVLFPGTVRENLIYGLYFSPLEIDIIDILKYVGVYDFIESLPEGLETSVDT--SL 1176

Query: 567  LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG--SMTIVSIA 624
            +SGGQ QR+ IARAL++KP IL+LDE TSALD  S   IN     ++  G  S+  +SI 
Sbjct: 1177 ISGGQAQRLCIARALLRKPKILILDECTSALDANSSKIIN----DIVAKGPPSLLTISIT 1232

Query: 625  HRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLL 666
            H    + RS N + + KDG + E G F +LF  P +EL K++
Sbjct: 1233 HN-EQMMRSCNTVAVLKDGKICETGPFNKLF-KPGNELYKVV 1272

 Score =  167 bits (423), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 154/634 (24%), Positives = 291/634 (45%), Gaps = 56/634 (8%)

Query: 71  QKKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVI-GLVLDVLRKGIEG- 128
           +KK S +K+ + ++   KRDW LL A + L TI+  +  ++  ++ G V D+L+   +  
Sbjct: 3   KKKVSVWKENIYMYVQFKRDW-LLIATMVLTTIANGLVPAVTSILTGKVFDLLKDFADPN 61

Query: 129 --KD--------LQNVNMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSE 178
             KD        L+++++  L   AF L                    +  I       E
Sbjct: 62  IPKDHNLYHQLVLRSMSLMALAACAFPLI-------------------WTSISTWMSFGE 102

Query: 179 RVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGG 238
                +R  ++N  L +  E+YD  +       L  D   ++R + +  +   +A     
Sbjct: 103 GQGFTVRYRMLNSYLDKSMEWYDKKE------NLSGDFTQLNRCVEELRASSAEASAITL 156

Query: 239 VGIGMMVSI-------SPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVA 291
             I  M+S+       S  L+ ++L   P ++  A +F + I+  +      +G    + 
Sbjct: 157 QNISSMLSLIGVSFYYSWSLTLIILCGTPLLIILAFIFSRSIQKYAALENTESGLAADLL 216

Query: 292 EEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVL 351
              ++  + ++    + +E+  +        +   K +   A   ++   L    F+   
Sbjct: 217 AWSMNSAQMIKLSCTQLKEIESFEELTLKCNDYFIKLSLYVAANISTLRFLSLAMFVQGF 276

Query: 352 LYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFD-LTDHIS 410
            +G+  + +G+L I D+          GS++     +   L +G  A  ++   L D+  
Sbjct: 277 WFGNTEIRKGNLNISDVITCFSSCLMLGSTLNTTLGYLIFLQKGQVALRKIQSFLNDNKV 336

Query: 411 SISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKST 470
            I  +  ++    K DI F++VSFSYP+RP + +  DI+I    G    IVG SG GKST
Sbjct: 337 EIDESALKQIDISKADISFRHVSFSYPSRPADDVLNDISIDFLSGKTTFIVGRSGSGKST 396

Query: 471 IALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAE- 529
           ++ LLL+ Y+  +G I +    I +++ + L ++I +V+Q   L + T+ +NI  G  + 
Sbjct: 397 LSNLLLKLYDEYDGYISIGSTHIREIDQQVLIKNITVVEQRCTLFNDTLVNNILLGSQDE 456

Query: 530 ----PATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKP 585
               P  +++++   K     + I    +G DT++G  G  LSGGQ+QR+A+ARA ++  
Sbjct: 457 DKSSPVVQKKLKEAIKMACLESVIDSLSNGLDTILGTGGISLSGGQQQRVALARAYMRDT 516

Query: 586 NILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSV 645
            +L+LDEA SALD+     +     +  + G  TI+ + H LS I   + + V+ ++G +
Sbjct: 517 EVLILDEAVSALDIVHREQLMSNITK-WRQGRTTII-LTHELSQISIQDYLYVV-EEGRI 573

Query: 646 IEAGKFKELFANPNSELCKL--LTEKSSRSDGND 677
           IE+G   +L  +P+S  C++  L     + + ND
Sbjct: 574 IESGFQGQLMYDPDSAFCRMNILQNVHDKYENND 607

>NCAS0G03510 Chr7 (652949..656815) [3867 bp, 1288 aa] {ON} Anc_1.527
          Length = 1288

 Score =  196 bits (498), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 148/520 (28%), Positives = 258/520 (49%), Gaps = 30/520 (5%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFY--DTHKVGDLISRLGSDAYVVSRSM 223
            NF +  +L   SE  +  LR+  M   L++D  ++  DT+K  +L + L +D   +   +
Sbjct: 775  NFLKAYILGYCSENWIMDLRNEAMESILNKDLFWFSKDTNKSSELSALLLNDLRDLRSLV 834

Query: 224  TQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEA 283
            ++ +S     ++   +G+   +    +LS V L   P I+  ++V+G  ++      + +
Sbjct: 835  SEFLSAMTTFMVVSLIGLIWALVSGWKLSLVCLSMFPLIIAFSAVYGTMLQKYETTYKTS 894

Query: 284  TGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLG 343
               L     E ++G+KT++S  AE   +  Y+G    +  +  K +       + T M+ 
Sbjct: 895  VAALENQEYEIMTGIKTIRSLQAESHFIKNYSGLEHNMRAIAHKRSIATGFGISVTNMIT 954

Query: 344  DMSFIVVLLYGSYLVLQGSLT---IGDLTAFMLYTEYTGSSVFG-----------LTTFY 389
                 ++  YG  LV +G  +   + +    +L+T  T +S+              T  Y
Sbjct: 955  ICIQSILYYYGIKLVFEGEYSSKKMFETFTLLLFTIMTCTSLVNQIPDISRGQRSATFLY 1014

Query: 390  SELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDIN 449
              L +G+ +    F+       ++P +  K  P    I+ +N++F+YP+     +++D+N
Sbjct: 1015 RILDEGLASDESEFETHRKAEIVAPKQESKSNPL---IKIQNLTFAYPSETNVNVYEDLN 1071

Query: 450  IKVPPGS-NVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLV 508
            +++      + +VG SG GKST+  LL + Y      I +DG D++      LR  I +V
Sbjct: 1072 LEMHASEKTIGLVGESGSGKSTLMYLLTKLYQVAPHSIYLDGTDVNDWGLMNLRTQISVV 1131

Query: 509  QQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLS 568
            +Q+P L  GT+R+N++YG++      E+  + K    + F+   P G DT I  +  LLS
Sbjct: 1132 EQKPTLFDGTVRENLSYGISTDILDMELFDMLKYVGIYEFVESLPFGLDTRIDTK--LLS 1189

Query: 569  GGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG--SMTIVSIAHR 626
            GGQ QRI IARAL++KP IL+LDE TSALD  S   I      ++K+G  ++  + I H 
Sbjct: 1190 GGQAQRICIARALLRKPKILILDECTSALDALSANII----IDIVKNGPPALLTIVITHS 1245

Query: 627  LSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLL 666
               + R+ N I + K+G +IE G FKEL  N N EL K++
Sbjct: 1246 -EKMMRACNTIAVLKNGKIIEKGGFKEL-VNGNGELKKII 1283

 Score =  150 bits (378), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 146/574 (25%), Positives = 266/574 (46%), Gaps = 42/574 (7%)

Query: 176 LSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDG----- 230
           L ER    +R  ++ + L +   +YD++        L  D   ++R + +  S       
Sbjct: 102 LGERQGFAVREKILQEYLTKPITWYDSN------DNLSGDFTQINRCVEELRSSSAEASA 155

Query: 231 --FKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLT 288
             F+ L+     IG     S  L+ ++L  AP I+  A  F   I   ++     TG+  
Sbjct: 156 IIFQNLVSILALIGTSFYYSWSLTLIILCTAPIIIAFAVFFSHMIHKYTELENTETGKAA 215

Query: 289 RVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTS--TTMLGDMS 346
           ++A   +  ++ V+ +  + RE+  +        ++     FI    + S  T +L  +S
Sbjct: 216 QLANWAMDSIQLVKLYCTQFREVRNFRELTSNCNDL-----FIKCCLYVSANTALLRFLS 270

Query: 347 ---FIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLF 403
              FI    +G+ +V +G L I ++          GS++         L +G  A  ++ 
Sbjct: 271 LSMFIQGFWFGATMVRKGKLQISNVVTCFQSCLMLGSTLSNTLQVIVILQKGDVALKKIL 330

Query: 404 DL----TDHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVC 459
                  DH  +  P    +       I F N++FSYP+RP + + K++++   P     
Sbjct: 331 GFLSTSVDH-GADEPIYEPETPAELCTIAFNNITFSYPSRPSHPVLKNVSLCFEPTKFTF 389

Query: 460 IVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTI 519
           I+G SG GKST++ LLL++Y+  NG I V G D+ ++N   L  ++ +V+Q   L + T+
Sbjct: 390 IIGKSGSGKSTLSNLLLKFYDDYNGTITVKGNDVKEINRNWLLNNVTVVEQRCTLFNDTL 449

Query: 520 RDNITYGLAE------PATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQ 573
           R+NI  G+++       + +++++           +   P G +T+IG+ G  LSGGQ+Q
Sbjct: 450 RNNILLGVSKDQLEDHESIEQKLKDACSISMLDRLVCDLPHGLNTIIGSGGISLSGGQQQ 509

Query: 574 RIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRS 633
           R+AIARA ++   IL+LDEA SALD+     +     Q  +SG  TI+ + H LS I+  
Sbjct: 510 RVAIARAFMRNKPILILDEAVSALDIIHRELLMKNIRQ-WRSGKTTIL-LTHELSQIEPD 567

Query: 634 ENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPPPNATQDKVVE 693
           +   V+ ++G V E G  K+L     S    +L   + +++  DS       A +  + E
Sbjct: 568 DYTYVI-QEGEVKENGYQKDLKQKKTSVFNHML---NLQTNNRDSYAISDRTALETPIKE 623

Query: 694 Q--IAEKILERFPEAGQSPDATVKEIFKDVSSEG 725
               A+  ++   E+  S +A +  ++++ S  G
Sbjct: 624 NNIFADTTIDSDSESPISKEADLSYMYEEASYRG 657

>TDEL0F00340 Chr6 complement(53876..57649) [3774 bp, 1257 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1257

 Score =  193 bits (490), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 147/503 (29%), Positives = 248/503 (49%), Gaps = 22/503 (4%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFY--DTHKVGDLISRLGSDAYVVSRSM 223
            NF +  +    SE  + +LR+ VM +   ++ +++  + HK  ++ + L +D   +    
Sbjct: 750  NFLQYFLFGYCSEYWILQLRNQVMQRISFEELDWFQRERHKASEVSALLLNDLRDLRALA 809

Query: 224  TQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEA 283
            +  +       +   VGI   + I  +LS V +   P I+  ++V+G  ++      + A
Sbjct: 810  SDFLIAVSSFAVVSSVGIIWALIIGWKLSLVCISMFPLIVIFSAVYGMALQRQETQYKSA 869

Query: 284  TGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLG 343
               L  +  E  +G+KT++    E   L +Y      +  +  + A            L 
Sbjct: 870  VVDLENLLYEVATGIKTIRRLQLETNFLRQYKRLESHMRVIASRRAITTGLGVAVIEALA 929

Query: 344  DMSFIVVLLYGSY-LVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL 402
             MS   +L Y +  LV+ G  T   +   +    +T  +   L +   ++ +G  AA+R+
Sbjct: 930  -MSIQAILFYYALKLVIDGQYTTKKMFETLTLLLFTIMTCNILISQVPDISRGQRAANRI 988

Query: 403  FDLTDH-ISSISPTKGQKYIPG------KGDIEFKNVSFSYPTRPENQIFKDINIKVPPG 455
              + D  +    P + +K             I  +NV+F+YP+ P   IF  + +++P G
Sbjct: 989  LQMLDEKLEREKPHQEKKQTTSGSVSESSAVISLQNVTFAYPSAPSIHIFDSLYLELPIG 1048

Query: 456  SNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILM 515
                +VG SG GKST+  LL + Y PT+G +LV+ +D+++ N + LRR + +V+Q P + 
Sbjct: 1049 RTFALVGQSGSGKSTLVTLLTQLYRPTSGTVLVENKDVNEWNIRDLRRQMSVVEQTPTIF 1108

Query: 516  SGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRI 575
            SGT+R+N+ YGL     + E+  V +    H+FI+K P G DT I     LLSGGQ QR+
Sbjct: 1109 SGTVRENLLYGLHHDPLEVEMYDVLRYVGIHDFISKLPLGLDTTIDID--LLSGGQLQRL 1166

Query: 576  AIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGS---MTIVSIAHRLSTIKR 632
             IARA++K+P IL+LDE TSALD  S   IN     +++ G    +TI SI H +  +K 
Sbjct: 1167 CIARAILKRPKILILDECTSALDPFSSHVIN----NIVRRGCPAPLTI-SITHNVDMMKA 1221

Query: 633  SENVIVLGKDGSVIEAGKFKELF 655
             + +I L K+G V   G F  L 
Sbjct: 1222 CDEIIFL-KNGRVAGTGSFDALL 1243

 Score =  154 bits (389), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 145/509 (28%), Positives = 251/509 (49%), Gaps = 21/509 (4%)

Query: 167 FARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVV--SRSMT 224
           +A I    +L ER    +R  ++ K L    E+YD  K  D+          V  +R+  
Sbjct: 76  WASISAWMLLGERCGFGIRRRLLYKYLENPFEWYD--KTEDICGNFTQQNRCVEEARASC 133

Query: 225 QKVSDGF-KALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEA 283
            + S    ++L+     IG     S  L+ V L  AP I+     F +K++  +    E 
Sbjct: 134 AEASAVITRSLVTIIALIGTSFYASWSLTLVTLCSAPLIIMCGWFFSRKVQRYADLENEQ 193

Query: 284 TGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLG 343
           T + +++ +  ++  + ++    E RE+  +   ++   N   K    ++    +   L 
Sbjct: 194 TSKASQLLDWSMTAAQFIRLSGTELREIKSFKNCVQNCTNNFVKMCQYSSINLATLKFLS 253

Query: 344 DMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQG---VGAAS 400
              F+    +GS ++ +G + IGD+          GS++ G       + +G   V   S
Sbjct: 254 LAMFVQAFWFGSTMIRKGKMNIGDVITCFHSCILLGSTISGTLQQLVIIQKGSVAVNIVS 313

Query: 401 RLFDLTDHISSISPTKGQKYIPG---KGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSN 457
           +   L D  ++ +  +  + +P    KGDI F+NV FSYP+RP++ + + I++    G  
Sbjct: 314 KF--LADDKTATTDIRRWQDVPFPELKGDIRFQNVEFSYPSRPDHNVLRSISLNFRAGKT 371

Query: 458 VCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSG 517
             ++G SG GKS+++ LLL++Y    G I VDG++I  ++   L ++I +V+Q   + +G
Sbjct: 372 TFLLGKSGSGKSSLSNLLLKFYENYTGVISVDGRNIKHIDQSQLIKNITVVEQRCNVFNG 431

Query: 518 TIRDNITYGLAEPATKEEI----RSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQ 573
           T+++NI  G+ + A +EEI    + V +     NFI    DG +T+IG+ G  LSGGQ+Q
Sbjct: 432 TLKENIIIGI-DGADEEEILTKLKLVCRISLLENFIHDLSDGLNTLIGSGGISLSGGQQQ 490

Query: 574 RIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRS 633
           ++AIARAL+K P IL+LDE+ SALDV   G I        K  +  I++  H L+ I  S
Sbjct: 491 KVAIARALMKDPQILILDESLSALDVLQRGLILRAIRTHRKEKTTIILT--HELNQIG-S 547

Query: 634 ENVIVLGKDGSVIEAGKFKELFANPNSEL 662
            +   L + G  IE G  + L  +P++  
Sbjct: 548 NDFCYLIESGQCIEHGLEETLVNDPSTRF 576

>KAFR0E00230 Chr5 complement(47473..51285) [3813 bp, 1270 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1270

 Score =  190 bits (482), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 155/515 (30%), Positives = 252/515 (48%), Gaps = 26/515 (5%)

Query: 167  FARIVMLRILSERVVARLRSGVMNKTLHQDSEFY--DTHKVGDLISRLGSDAYVVSRSMT 224
            F +   L  +SE  +  LR+  M    +++ E++  D +K  +L + + +D   +   ++
Sbjct: 763  FLKSFSLGFVSENWIMDLRNKAMESITNKELEWFYKDENKSSELAALVLNDLRDLRSLIS 822

Query: 225  QKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEAT 284
            + +S     ++    G+   ++   +LS V +   P I+  ++++G  ++      +   
Sbjct: 823  EFISAMSTFIVVSLAGLIWALTTGWKLSLVCIAMFPLIILFSAIYGSILQRYETTYKTTV 882

Query: 285  GQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGD 344
              L     E + G+KT++    EQ  + RY+     + ++GRK A         TT L  
Sbjct: 883  ADLENCVYEIMLGIKTIRCLQLEQHFIQRYSVLEARMKHIGRKRAIATGFGIAITTALVM 942

Query: 345  MSFIVVLLYGSYLVLQGSLTIGDLT---AFMLYTEYTGSSVFGLTTFYSELMQGVGAASR 401
                ++  YG  LV  G  T   +      +L+T  T +S   L     ++ +G  AASR
Sbjct: 943  CIEAILFYYGLKLVFIGEYTTMKMFKTFTLLLFTIMTCTS---LINQIPDVTRGQRAASR 999

Query: 402  LF---DLTDHISSISPTKGQ-KYIPG----KGDIEFKNVSFSYPTRPENQIFKDINIKVP 453
            +F   D +D     S   G+ + IP     K  I   N+ F YP+   + +F  +N+++ 
Sbjct: 1000 IFRILDESDRFLEDSDEHGRTRGIPKNNSIKSIITINNLQFHYPSAESSNVFNRLNLQIA 1059

Query: 454  PGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPI 513
                V +V  SG GKST+  LL R Y      I +DG DI++    +LR  I +V+Q+P 
Sbjct: 1060 DNQTVAVVAESGSGKSTLLYLLTRLYKVDFNSIFIDGTDINEWQLTSLRNLIAIVEQKPT 1119

Query: 514  LMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQ 573
            L  G+IR N+ YG        +I  V KQ    +F+T  P+G DT +    +LLSGGQ Q
Sbjct: 1120 LFEGSIRKNLIYGNKLEIMDMDIYDVLKQVGIFDFVTSLPNGIDTNVDT--SLLSGGQAQ 1177

Query: 574  RIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG--SMTIVSIAHRLSTIK 631
            RI IARAL++K  IL+LDE TSALD ES   I      L+KSG   +  ++I H    ++
Sbjct: 1178 RICIARALLRKSKILILDECTSALDAESAFVIQ----NLVKSGLPGVLTIAITHSEPMMR 1233

Query: 632  RSENVIVLGKDGSVIEAGKFKELFANPNSELCKLL 666
               NVIVL +DG   + G F EL+  P +EL +++
Sbjct: 1234 ACGNVIVL-QDGETAQQGTFDELY-KPGNELHRIV 1266

 Score =  150 bits (379), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 136/522 (26%), Positives = 254/522 (48%), Gaps = 52/522 (9%)

Query: 183 RLRSGVMNKTLHQDSEFYDTHK--VGDLIS--------RLGSDAYVVSRSMTQKVSDGFK 232
           R+R  ++   L +  E++D +   +GD +         R GS     + ++T +      
Sbjct: 103 RIRRTILLSYLKKPMEWFDENDQLLGDFVQMHRCVEEVRSGSAE---ASAITFQNFVAII 159

Query: 233 ALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAE 292
           AL+C           S  L+ ++L  +P ++  A+ F + I + +K   + TG   +   
Sbjct: 160 ALVCTSF------YYSWSLTLIILCSSPLLIVLAAFFSRMIENFTKLENDETGIAAQSLT 213

Query: 293 EQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTS--TTMLGDMS---F 347
             ++  + V+ +  +  E+ ++   +     +     FINA F+ S  T++L  +S   F
Sbjct: 214 WSMNAAQLVKLYCTQDFEIKKFKEIV-----IRCNDYFINAWFYVSANTSILRFLSLAMF 268

Query: 348 IVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAA-SRLFDLT 406
           +    +GS ++ +  +++  +          GS +   T     L+Q      +R+ D  
Sbjct: 269 VQGFWFGSTMIKKNKMSVDQVITCFSSCLMLGS-ILNTTLPQIVLLQKAHVGLNRVQDFL 327

Query: 407 DHISSISPTKGQKYIPGKGD----IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVG 462
           +  S ++  + ++      +    I F  +SF YP+RP++ + K+I++   P     IVG
Sbjct: 328 EDKSEMATDRDRQTSINLDNVPISISFDAISFCYPSRPDDMVLKNISMNFDPNKTTFIVG 387

Query: 463 PSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDN 522
            SG GKST++ LLL++YN  NG I V+G ++  ++   + +++ LV+Q+  L + T+R+N
Sbjct: 388 KSGSGKSTMSNLLLKFYNGYNGCIKVNGVNVQSIDRHWITKNVTLVEQKCTLFNDTLRNN 447

Query: 523 ITYGLAEPATKEEIRS-VAKQC---FCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIA 578
           +  GL+  +  E++ S + + C      N I K P G DT +G+ G  LSGGQ+QR+A+A
Sbjct: 448 LLIGLSHISAAEDVDSRLQEACRFALLDNVIEKLPSGLDTKVGSGGVSLSGGQQQRVALA 507

Query: 579 RALIKKPNILVLDEATSALDVESEGAINYTFGQLMK-----SGSMTIVSIAHRLSTIKRS 633
           RA ++   +++LDEA SALD  +         QLM+     + S T + + H L+ I  S
Sbjct: 508 RAYLRDTPVVILDEAISALDARNR-------RQLMENIRIWTRSKTAIILTHELNQILPS 560

Query: 634 ENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDG 675
           +  + L ++G + E G   EL  N  S  CK    ++S  + 
Sbjct: 561 D-FLYLMENGQIKEEGYQNELIENVESTFCKFFHLQNSNRES 601

>TBLA0B10070 Chr2 (2422767..2426657) [3891 bp, 1296 aa] {ON} Anc_1.527
            YKL209C
          Length = 1296

 Score =  189 bits (481), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 139/513 (27%), Positives = 251/513 (48%), Gaps = 16/513 (3%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFY--DTHKVGDLISRLGSDAYVVSRSM 223
            NF +  +L I SE  +  LR   M + L +  +++  + ++  ++ + + +D   +   +
Sbjct: 786  NFFKGFLLGICSEYWIMDLRDKFMKEILRKKIQWFSDEKYQTAEMSALILNDLRDLRSLV 845

Query: 224  TQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEA 283
            ++ +S     ++    G+   +    +L+ V +   P I+  ++++G  ++ +  D + +
Sbjct: 846  SEFMSAMATFIVVSLFGLIWALVTGWKLALVCIAMFPLIIIFSAIYGAVLQKSETDYKSS 905

Query: 284  TGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLG 343
               L  +  + +S +KT++S   E    H Y  A   + NV  K +       + T  + 
Sbjct: 906  VANLENIEFDIVSNIKTIKSLQLEGHFYHNYKVAETKLKNVATKRSIYTGLGISITNTIT 965

Query: 344  DMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLF 403
                 ++  YG  L++ G  T+  +        +T  +   L     ++ +G  AAS ++
Sbjct: 966  MCIQAILYYYGFKLIMDGEYTVKQMFTTFTLLLFTVMTCNSLVNQIPDMSRGQRAASWVY 1025

Query: 404  DLTDHISSISPTKGQKYIPGKGD--------IEFKNVSFSYPTRPENQIFKDINIKVPPG 455
             +               I    +        ++ KN++F+Y + P  ++   + +K+ PG
Sbjct: 1026 SILQQSDDTKEVNDPNSIIVDNNTISNDFPILDIKNLTFAYESTPSIKVLDGLTLKLFPG 1085

Query: 456  SNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILM 515
              + I G SG GK+T+  LL+++Y+    QI  +G+DI     ++LR  I +V+Q+P ++
Sbjct: 1086 DKLAIAGESGCGKTTLLSLLVKFYDVDPNQIYFNGKDILNYEFESLRDAIVIVEQKPSVL 1145

Query: 516  SGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRI 575
            SG+IRDN+        +  E+  V K     +FI   P G DT+I     LLSGGQ QRI
Sbjct: 1146 SGSIRDNLLGNNKRLISDYELYDVLKLTGIFDFIETLPSGIDTIIDT--TLLSGGQAQRI 1203

Query: 576  AIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSEN 635
             IARAL++KP IL+LDE TSALD  S   IN    + +    +TI+SI H  S +   +N
Sbjct: 1204 CIARALLRKPKILILDECTSALDAMSADIINNLVSKEL--NGVTIISITHSESMMTSCQN 1261

Query: 636  VIVLGKDGSVIEAGKFKELFANPNSELCKLLTE 668
            V VL K+G ++E G +  L A  +S L KLL++
Sbjct: 1262 VAVL-KNGKIVEVGTYDSL-ATSSSHLGKLLSK 1292

 Score =  187 bits (474), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 143/518 (27%), Positives = 246/518 (47%), Gaps = 25/518 (4%)

Query: 176 LSERVVARLRSGVMNKTLHQDSEFYDTHKV--GDLISRLGSDAYVVSRSMTQKVSDGFKA 233
           + ER   ++R+ ++N  L Q   +YD ++   GD  ++L      +  S  +  +  F+ 
Sbjct: 106 IGERQGIKVRTKILNNYLTQSMTWYDLNEQLQGDF-TQLHRCVEELRSSSAEASAVTFQN 164

Query: 234 LICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEE 293
            I     I      S  L+ ++L   P I   +  F   I+  +      T    ++  E
Sbjct: 165 CIAIIALIATSFYYSWSLTLIILCSTPIICIFSICFSIMIQKFANLENNETTVSAQIFTE 224

Query: 294 QLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTS--TTMLGDMS---FI 348
            +  ++ ++    + ++L ++  +I           FI    + S  T++L  ++   F+
Sbjct: 225 TIQNIQLIKLNNLQLKKLMKFQTSISKC-----NKFFIQMCLYVSLNTSILRTLTLLMFV 279

Query: 349 VVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDH 408
               +GS ++ +G L I ++          GS +         L +G  A  ++ D  D 
Sbjct: 280 QGFWFGSTMIRKGHLKIDEVITCFSSCLLLGSIISNTLHQIVVLQKGEVALQKIVDFLDE 339

Query: 409 ISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGK 468
                            +I F+N+SF+YP+RP   I   IN+     +   IVG SG GK
Sbjct: 340 ADDPLEINSAPITLINSNISFQNISFAYPSRPNENILNQINLYFQNSATTFIVGKSGSGK 399

Query: 469 STIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLA 528
           ST++ LLL++Y    G IL+D  +I  +N K L  +I +V+Q+  L + TIR+NI +G++
Sbjct: 400 STLSNLLLKFYETYKGDILIDNINIKNLNQKNLLDNIMIVEQKCTLFNDTIRNNILFGVS 459

Query: 529 E---------PATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIAR 579
                     P   E +++        +F+   P+G DT+IG  G  LSGGQ+QR+A+AR
Sbjct: 460 NFTNQYASNRPNLNERLKNACTFALLDHFLIDLPNGIDTVIGTGGITLSGGQQQRVALAR 519

Query: 580 ALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVL 639
           A ++ P IL+LDEA SALDV     +     +L +S   TI+ + H L+ I   + + V+
Sbjct: 520 AYMRDPPILILDEAVSALDVNIRELLMKAI-KLWRSNKTTII-LTHDLTQIDNDDFLYVI 577

Query: 640 GKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGND 677
            K G +IE GK KEL  +PN+E  KL+  +++ +   D
Sbjct: 578 -KHGRIIEHGKRKELITDPNTEFHKLVAIQNNNNLNED 614

>AFR432W Chr6 (1213211..1217065) [3855 bp, 1284 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YKL209C (STE6)
          Length = 1284

 Score =  189 bits (480), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 138/509 (27%), Positives = 244/509 (47%), Gaps = 13/509 (2%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQ 225
            NF ++ +L  +SE+ V +LR  +M   L +D  +   +K  ++ +   +D   +    + 
Sbjct: 778  NFLQLFLLGFVSEQCVRQLRGNMMQLVLKRDLHWISQNKSSEITALTMNDLRDLRNVTSI 837

Query: 226  KVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATG 285
             +S      +   VG+   + I  +L+ V L   P  +   +++G  ++ +    + A  
Sbjct: 838  LLSSLTSLCVLASVGLIWAIVIGWKLTLVCLSLLPLFIGVITLYGMFVQKSEVQYKTAVS 897

Query: 286  QLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDM 345
            QL  +  E + GVKT++    E     RY    + +    R+ + +       T+ L  +
Sbjct: 898  QLENLLSEIVKGVKTIKCLQLEPYFQGRYATMEKYLKKQMRRRSILYGSGLAITSCLVIL 957

Query: 346  SFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDL 405
               ++  YG  LV+ G      L        +T  S  GL +      +G  A + +F +
Sbjct: 958  LQTILYYYGIRLVVTGEYDSKQLFQTFTLILFTTMSSVGLLSALPSSSRGQRAGTFVFGM 1017

Query: 406  T-------DHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNV 458
                    D+ S++       +   +  +  + ++F+YP   + QI+K+ N+++  G+ V
Sbjct: 1018 LEEPLPEPDNYSAVLRKAPTNHFSREPLVVLRALNFAYPAAKDVQIYKNFNLRINQGTKV 1077

Query: 459  CIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGT 518
             IVG SG GKST+  L+   Y      + +DG DI       LR+ I +V+Q+P   +GT
Sbjct: 1078 AIVGESGSGKSTLFYLICGLYPVKPASLFIDGTDICNWEMSALRKIIAVVEQKPRFFNGT 1137

Query: 519  IRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIA 578
            IR+N+ YGL    T  EI  V  +    NF+   P+G +T +     L+SGGQ QR++I 
Sbjct: 1138 IRENLVYGLEGTITDNEIYEVLAEVRIINFVRSLPEGLETRVDTN--LVSGGQLQRLSIV 1195

Query: 579  RALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIV 638
            RAL+++P +L+LDE TSALD  +  AI       +    +T++ I H    +K  + ++V
Sbjct: 1196 RALLRRPTLLILDECTSALDAANANAIANVVRNSLH--DITVIVITHSKQMMKMCDRIVV 1253

Query: 639  LGKDGSVIEAGKFKELFANPNSELCKLLT 667
            L K+G+V E G F +LF     EL +++T
Sbjct: 1254 L-KNGAVAEDGSFDDLF-RARGELHRMVT 1280

 Score =  132 bits (331), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 152/635 (23%), Positives = 280/635 (44%), Gaps = 63/635 (9%)

Query: 72  KKESSYKDAVRLFSLAKRDWRLLCAAIALLTISCVIGMSIPKVI----GLVLDVLRKGIE 127
           +K +  KD +  +    +D+ LL   I ++T++ + G ++P V+    G V DV+++  +
Sbjct: 2   RKRAQIKDGIYSYVYISKDYGLL---ITMITMTIIWG-TVPAVVAVLTGRVFDVMQQLAQ 57

Query: 128 GKDLQNVNMDDLGPIAFGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSG 187
            K   N   +      F   +                  +  I    +L ER   R+R  
Sbjct: 58  MK--YNTQAE------FLHVLLVRSLELGSVGLVQIPVQWIAITSWMLLGERQSLRIRRE 109

Query: 188 VMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDG--------FKALICGGV 239
           ++   L +  ++YD  K+ D+     +  Y ++    ++            F++ +   +
Sbjct: 110 LLRSYLAKPMQWYD--KIDDI-----NGMYTITNRCVEEARASCAEASGVLFQSAVTALI 162

Query: 240 GIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVK 299
                   S +L+ V L  AP +     VF K ++  +    E T   +      L+   
Sbjct: 163 LAVTAFKFSAKLTVVTLAGAPLLALLTVVFSKFVQKYAALENEQTSSASSTLSWALNSAT 222

Query: 300 TVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTT-----MLGDMSFIVVLLYG 354
            V+ F  +  EL ++N A+    N+ +K  F+     +S        L  M F+    YG
Sbjct: 223 MVKLFGTQDLELRKFNKAV----NLSKKY-FVRTLICSSINQAAMRFLSLMMFVQAFWYG 277

Query: 355 SYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISP 414
           S L+ +  +    +      +    SS+  + +    L +G  A  ++ +  +      P
Sbjct: 278 SILIQRDEVETAAVITVFSASVLLSSSINAMLSKVVLLQKGKVACRQIAEAVNVEPEGRP 337

Query: 415 TK-GQKYIPGK--------GDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSG 465
            +    Y  G          +I F  VSF+YP RP+ +    +++   P     IVG SG
Sbjct: 338 NQYAFPYEVGHIIALEDQPSEIVFDQVSFNYPARPDTKALDGVSLTFRPNQITFIVGKSG 397

Query: 466 RGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITY 525
            GKST+  LLL++Y+   G I V+  ++  ++   L ++I LV+Q   L +GT+ +NIT 
Sbjct: 398 SGKSTLGNLLLKFYSDYEGIITVNSTNLRGIDRSWLLQNITLVEQSCTLFNGTLFENITL 457

Query: 526 GLAEPATKE--EIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIK 583
             A+P  K    ++   +       +   P+G  T +G+ G  +SGGQ+QR+A+ARA+++
Sbjct: 458 S-AKPVNKTAGAVKRACQMALLEKLVFDLPEGLHTKVGSGGISMSGGQQQRVALARAILR 516

Query: 584 KPNILVLDEATSALDVESEGAINYTFGQLMKS--GSMTIVSIAHRLSTIKRSENVIVLGK 641
              +L+LDEA SALD+     +     ++++S     T + + H LS +   ++ + + +
Sbjct: 517 DAPVLILDEAISALDIIHRDLLM----EVIRSWRADKTTIILTHELSHV-LDDDYLYMME 571

Query: 642 DGSVIEAGKFKELFANPNSE---LCKLLTEKSSRS 673
            G VIE G   EL +NPNS    L +L   K+ R+
Sbjct: 572 HGQVIEQGYKSELLSNPNSRFRALNRLQNSKNERA 606

>KNAG0G00190 Chr7 complement(20457..24284) [3828 bp, 1275 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1275

 Score =  189 bits (480), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 142/518 (27%), Positives = 259/518 (50%), Gaps = 31/518 (5%)

Query: 167  FARIVMLRILSERVVARLRSGVMNKTLHQDSEFYD--THKVGDLISRLGSDAYVVSRSMT 224
            F++  ++   SE  +  LR  VM    +   E++    +K  ++ +   +D   +   +T
Sbjct: 768  FSKTFIMGYCSEYWIMDLRKKVMRTITYNKFEWFQLAENKPSEVSALALNDLRDLRTLVT 827

Query: 225  QKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEAT 284
            + ++     L+    G+   +    +LS V +   P I+  + V+G  ++    D + A 
Sbjct: 828  EFLATASTFLVVSTCGLIWALVAGWKLSLVSISMFPLIIVFSGVYGAALQKCETDYKSAV 887

Query: 285  GQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGD 344
             QL     E +  +KT++    +    +RY+   + + ++GR+ + I       T  L  
Sbjct: 888  AQLENCLYEVVVSMKTIRCLQLQTHFQNRYDRRKQRMLSLGRRRSVITGCGIAITHTLTL 947

Query: 345  MSFIVVLLYGSYLVLQGSLT---IGDLTAFMLYTEYTGSSVFG----------LTTFYSE 391
                ++  YG  LV+ G  T   + ++   +L+T  T +++              T+   
Sbjct: 948  CIQAILYYYGIKLVIDGKYTSKKMFEVFTLILFTIMTCTNLINQIPEVTRGQRAATYIYR 1007

Query: 392  LMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIK 451
            +++   A     D+ +    IS T  +  +     +  K+++F+YP  P   +++ +N+ 
Sbjct: 1008 ILKEAAATREHQDMHNRTLPISNTSEKDTM-----VLVKDLTFAYPATPSKHVYEHLNLN 1062

Query: 452  VPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQE 511
            +   ++V +VG SG GKSTI  LL + Y+     I VDG D+S+ +  +LR  I +V+Q 
Sbjct: 1063 LKSDTSVALVGESGSGKSTIISLLTKLYDVPEKHIYVDGTDLSEWDTNSLRNQISVVEQS 1122

Query: 512  PILMSGTIRDNITYGLAEPATKE-EIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGG 570
              L++GTIR+N+TYGL E  T E ++  + K    ++F+++ P+G DT++     LLSGG
Sbjct: 1123 ANLLNGTIRENLTYGLPEEDTTEVDLIGILKLVSIYDFVSRLPNGIDTIVDRD--LLSGG 1180

Query: 571  QRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG--SMTIVSIAHRLS 628
            Q QR+ IARAL+K   IL+LDE TSALD  S   I      +++ G  +  I++I H   
Sbjct: 1181 QAQRLCIARALVKPHRILILDECTSALDALSTNII----IDIVRKGIPNTLIIAITHDEH 1236

Query: 629  TIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLL 666
             ++  E+V++L K+G+++E G F EL    +SE  K L
Sbjct: 1237 MMRSCESVLLL-KNGAIVEQGSFVELM-QQDSEFKKCL 1272

 Score =  159 bits (403), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 125/459 (27%), Positives = 222/459 (48%), Gaps = 54/459 (11%)

Query: 254 VLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGV----KTVQSFVAEQR 309
           +++  + PI+ + +++  K+ +   DL+    + T  A E L+        V+ + A+  
Sbjct: 167 LIILCSTPIITAIAIYFAKLTNKYTDLE---NKETSYAAELLTWSMRFNDMVKFYTAQNE 223

Query: 310 ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLT 369
           E+ +++ ++    ++  KA   +A   +    L    F+    +G+ ++ +  L I D+ 
Sbjct: 224 EISKFDTSVTRCNSLFIKACLYSALNSSIIRFLTLCMFVQGFWFGATMIRRNKLDINDV- 282

Query: 370 AFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLT----DHISS-----ISPTKGQKY 420
                          +T F+S LM G   +  +  +T     H+++         +G+  
Sbjct: 283 ---------------ITCFHSCLMLGATVSEAMSQVTVIQKGHVANKKLEGFLELEGKTI 327

Query: 421 I------PGKGD---IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTI 471
           +      P KG+   I F N+SF YP R  N   +++++++  G    I+G SG GKST+
Sbjct: 328 MQAALKCPPKGNSLSITFNNISFKYPCRTSNSAVENVSLRLESGKMTFIIGKSGSGKSTL 387

Query: 472 ALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYG---LA 528
           A LLLR+Y   +G I VD   I  +N + L  +I +V+Q   L + T+R+NI  G    +
Sbjct: 388 AKLLLRFYEEYSGSITVDNISICDLNQEWLLSNITVVEQNCTLFNDTLRNNILLGSENQS 447

Query: 529 EPATKEEI----RSVAKQC---FCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARAL 581
           EPA  E I    R + K C     +  +    DG DT+IG+ G  LSGGQRQR+A+ARA 
Sbjct: 448 EPARMESIEERERKLRKACNFALLNEMLADLTDGLDTVIGSGGVELSGGQRQRVALARAF 507

Query: 582 IKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGK 641
           ++   I++ DE+ SALDV     +     +  + G  TIV + H LS I  ++ + ++ +
Sbjct: 508 LRNTPIMIFDESVSALDVAHRKLLMKAI-RSWRQGKTTIV-LTHELSQINPTDFIYIM-E 564

Query: 642 DGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLP 680
            G V E G  ++L  +  S   +    ++     ++SLP
Sbjct: 565 HGRVCEYGYQEDLLKSETSYFSRFYQHQAPEGAVHESLP 603

>TPHA0O00160 Chr15 complement(16002..19763) [3762 bp, 1253 aa] {ON}
            Anc_1.527 YKL209C
          Length = 1253

 Score =  187 bits (475), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 134/504 (26%), Positives = 248/504 (49%), Gaps = 19/504 (3%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFY--DTHKVGDLISRLGSDAYVVSRSM 223
            NF +I +L   SE  +  LR+ +M     +  E+Y   ++K  ++ +   +D   +   +
Sbjct: 739  NFIKIFILGYCSEYWIMDLRNELMQCVSQKRFEWYGRSSNKSSEISALALNDLRDLRTLV 798

Query: 224  TQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEA 283
            T+ +S     +    +G+   ++   +LS V +   P I+  + ++G  +++     + A
Sbjct: 799  TEFLSTMSTFVTVSMMGLIWAIATGWKLSLVCISMFPLIIIFSMIYGTVLQNYETSYKSA 858

Query: 284  TGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLG 343
               L  +  E ++ +KT++        L  Y+   + +  + +K   +     +  T + 
Sbjct: 859  VADLENLQYEMITSIKTIKCLRLNDHFLGLYSELEKKMKRIAKKRTIVTGLGLSMLTTIT 918

Query: 344  DMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLF 403
                 ++  YG  LVL G  T   +        +T ++   L +   ++ +G  AAS + 
Sbjct: 919  TCIQSILYYYGLKLVLTGEYTSKTMFQTFTLVLFTVTTCNSLVSQIPDVSRGQRAASWVL 978

Query: 404  DLTDHISSISPTKGQ----KYIPGKGD----IEFKNVSFSYPTRPENQIFKDINIKVPPG 455
             + D         G+    + I  + D    IE +N++F YP  P   +++D+N+K+  G
Sbjct: 979  RIIDENEYTKEVNGEDCRVETIEHENDSDPLIEIENLNFHYPNTPGVNVYQDLNLKINSG 1038

Query: 456  SNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILM 515
              + +VG SG GKST+  LL + Y+  + +IL++G DI+  +   LR  I +V+Q+P L 
Sbjct: 1039 ETIGLVGQSGSGKSTLMYLLTKLYDVQDNRILINGTDINDWSYDILRAEICVVEQKPNLF 1098

Query: 516  SGTIRDNITYGLAE--PATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQ 573
             GTIR+NITYG++E  P ++ E++ + +    H F+   P   DT++     LLSGGQ Q
Sbjct: 1099 HGTIRENITYGVSEKNPVSETEVQELLQLVDMHEFVEALPKALDTVVDI--GLLSGGQAQ 1156

Query: 574  RIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQL---MKSGSMTIVSIAHRLSTI 630
            R+ I R L++KP +L+LDE TS+LD ++   +      L   +    +TIV I H    +
Sbjct: 1157 RLCIVRTLLRKPKVLILDECTSSLDAQTTQIVIALIKDLNTKLGWDILTIV-ITHNRQMM 1215

Query: 631  KRSENVIVLGKDGSVIEAGKFKEL 654
            +    ++VL   G V+E G+F +L
Sbjct: 1216 QCCSRLVVLDV-GRVVEDGQFDDL 1238

 Score =  166 bits (420), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 151/587 (25%), Positives = 270/587 (45%), Gaps = 78/587 (13%)

Query: 176 LSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI 235
           L ER   R+RS ++ + L +  E+YD      L   L  D   ++R M +  S   +A  
Sbjct: 93  LGERQGFRVRSKLLEEYLEKPMEWYD------LKENLAGDFTQLNRCMEELRSGSAEASA 146

Query: 236 -----CGGVGIGMMVSI--SPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLT 288
                C  +   + VS   S +L+ ++L  +P I+  A+ F + I+  +    + T    
Sbjct: 147 VTYQNCVAIIALICVSFYYSWQLTLIILCTSPFIIVCAACFSRFIQKYASFENKETAAAA 206

Query: 289 RVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFI 348
            +    +   +TV+    + +E+ ++   +    +      FI    FT+   +G + F+
Sbjct: 207 DLLMWTMDSSQTVKLSCTQSKEIKKFETLVSKCNDY-----FIRTSLFTAAN-IGILRFL 260

Query: 349 VV------LLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL 402
            +        +GS ++ +G L I D+                +T FYS LM G    S L
Sbjct: 261 TLSMFVQGFWFGSTMIRKGKLNISDV----------------ITCFYSCLMLG----SIL 300

Query: 403 FDLTDHI-----SSISPTKGQKYI------PGKG-----------DIEFKNVSFSYPTRP 440
                H+       ++  K QK+I      P K            DI   N++F+YP+RP
Sbjct: 301 NTTLHHVIFIQKGQVALAKIQKFINESPELPSKTLTSSGLVYSHVDISIDNLTFAYPSRP 360

Query: 441 ENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKT 500
              + K++++K+       IVG SG GKSTI  L++++Y    G I+V  +DI  V    
Sbjct: 361 TENVLKNVSLKIKSARTTFIVGKSGSGKSTITNLIMKFYEDYKGNIIVGDKDIRSVPIDE 420

Query: 501 LRRHIGLVQQEPILMSGTIRDNITYG---LAEPATKEEIRSVAKQCFCHNFITKFPDGYD 557
           L ++I LV+Q   L + T+++NI  G    ++      + S+       + I+  PDG +
Sbjct: 421 LLQNITLVEQRCTLFNDTLKNNILLGSKYTSQTINDGLLSSICSLACLDSVISSLPDGIE 480

Query: 558 TMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGS 617
           T +G  G  LSGGQ+QR+A+ARA ++  +IL+LDEA SALD+     +     ++ ++ +
Sbjct: 481 TRLGTDGITLSGGQQQRVALARAFLRDTDILILDEAVSALDIMQREILMRNISKVRQNKT 540

Query: 618 MTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGND 677
             I++  H L+ I  ++  I L ++  + E G FK+   N  + L   +      +   D
Sbjct: 541 TIILT--HDLNQINDND-YIYLFENNEIKENG-FKKTLMNDENTLFYNMYNLQRNAAITD 596

Query: 678 SLPPPPPNATQDKVVEQIAEKILERFPEAGQSPDATVKEIFKDVSSE 724
           S    P    +D+V E+  + ++   P +G++ D  V + + + SS+
Sbjct: 597 SRASSPTIYDKDEVYEKKDDFVIS--PISGETFD--VMKYYSEESSD 639

>Skud_11.11 Chr11 complement(25896..29783) [3888 bp, 1295 aa] {ON}
            YKL209C (REAL)
          Length = 1295

 Score =  186 bits (473), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 143/518 (27%), Positives = 249/518 (48%), Gaps = 24/518 (4%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFY--DTHKVGDLISRLGSDAYVVSRSM 223
            NFA+  +L   SE  +  LR+ +M K   ++  ++  + +K  ++ + + +D   +   +
Sbjct: 778  NFAKGFLLGYCSEYWIMDLRNEIMEKVTRKNINWFSGENNKAAEISALVMNDLRDLRSLV 837

Query: 224  TQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEA 283
            ++ +S     +    +G+   +    +LS V +   P I+  + ++G  ++    D + +
Sbjct: 838  SEFLSAMTSFITVSTIGLVWALISGWKLSLVCISMFPLIIIFSVIYGSSLQTYETDYKSS 897

Query: 284  TGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLG 343
              QL     + ++ +KT++   AE      Y+     +  +  K A       + T M+ 
Sbjct: 898  VAQLENCLYQIVTSIKTIKCLQAEFHFQLTYHDMKTKMEGIASKRAIATGFGVSMTNMIA 957

Query: 344  DMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLF 403
                 ++  YG  LV+    T   + A      +T  S   L     ++ +G  AAS ++
Sbjct: 958  MCIQAILYYYGLKLVMVHEYTSKKMFATFTLLLFTIMSCTTLVGQIPDISRGQRAASWIY 1017

Query: 404  ----------DLTDHISSISPTKGQKYI--PGKGDIEFKNVSFSYPTRPENQIFKDINIK 451
                      ++ D+   +    G  Y     K  +  +N++F+YP+ P   I+K +++ 
Sbjct: 1018 RILDEAECTLEIEDNNGRVLGISGGTYYGNSNKPIVSIQNLTFAYPSAPNISIYKRMDLN 1077

Query: 452  VPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQE 511
            +  G  V IVG SG GKST+ LLL   Y    G I +DG D++  N  +LRR I +V+Q+
Sbjct: 1078 MFCGQTVGIVGESGSGKSTLVLLLTGLYACKVGCIEIDGTDVNDWNLTSLRREISVVEQK 1137

Query: 512  PILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQ 571
            P L  G+IRDN+TYG        E+    K    ++F+   P   DT I     LLSGGQ
Sbjct: 1138 PSLFDGSIRDNLTYGCLGQMPDFELYDALKYVGIYDFVASLPQSLDTRIDTN--LLSGGQ 1195

Query: 572  RQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG--SMTIVSIAHRLST 629
             QR+ IARAL++K  IL+LDE TSALD  S   IN     ++K G  ++  + I H    
Sbjct: 1196 AQRLCIARALLRKSKILILDECTSALDSVSSRIIN----DIVKKGPPALLTMVITHNEEM 1251

Query: 630  IKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLT 667
            ++   +V+V  KDG ++E G F  L+ N + EL ++++
Sbjct: 1252 MRCCSSVVVF-KDGKIVEEGSFDTLY-NDHKELFRIIS 1287

 Score =  175 bits (444), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 146/512 (28%), Positives = 246/512 (48%), Gaps = 33/512 (6%)

Query: 176 LSERVVARLRSGVMNKTLHQDS-EFYDTHK--VGDLISRLGSDAYVVSRSMTQKVSDGFK 232
           + ER   R+RS ++   L +   E+YD ++  +GD  +++      +  S  +  +  F+
Sbjct: 100 IGERQGFRIRSMLLEAYLKKKPIEWYDANETLLGDF-TQINRCVEELRSSSAEASAITFQ 158

Query: 233 AL--ICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRV 290
            L  IC  +G     S S  L+ ++L  +P I   A  F + I   +K     TG+  ++
Sbjct: 159 NLVAICALIGTSFFYSWS--LTLIILCSSPIIALFAVAFCRMIHIYTKKENTETGKAAQL 216

Query: 291 AEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVV 350
               ++  + V+ +  +  E  ++   +        K+ F  A        L    F+  
Sbjct: 217 LTWSMNAAQLVRLYCTQPLERKKFEEIVSNCNTFFIKSCFYLAANAGVLRFLTLTMFVQG 276

Query: 351 LLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHIS 410
             +GS ++ +G L I D+          G+++         L +G  A  ++  L ++  
Sbjct: 277 FWFGSTMIRKGRLNINDVITCFHSCIMLGTTLNNTLHQIVVLQKGEVALEKIMTLLEN-- 334

Query: 411 SISPTKG-----QKYIP----GKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIV 461
              P +      + Y P      GD+ F+NVSF+YP+RP   I ++  IK P G    IV
Sbjct: 335 --GPKRNTSNTIELYQPLIDYATGDLVFENVSFAYPSRPTETILQNAGIKFPGGQFTFIV 392

Query: 462 GPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRD 521
           G SG GKSTI+ LLL++Y+  +G I ++G++I  +  K+L  +I +V+Q   L + T+++
Sbjct: 393 GKSGSGKSTISNLLLKFYDGYDGSISINGRNIQTIPQKSLIENITVVEQRCTLFNNTLKN 452

Query: 522 NITYGL------AEPATKEE---IRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQR 572
           NI  G       A+  T +    I+   +       I   PDG +T+IG+ G  LSGGQ+
Sbjct: 453 NILLGSTGSIRNADSNTIDNNNLIKEACRMALLDRLILDLPDGLETIIGSGGITLSGGQQ 512

Query: 573 QRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKR 632
           QR+AIARA I+   IL LDEA SALD+     +        K G  TI+ + H+LS I+ 
Sbjct: 513 QRVAIARAFIRDTPILFLDEAISALDIVHRNLLMKAIRHWRK-GKTTII-LTHQLSQIE- 569

Query: 633 SENVIVLGKDGSVIEAGKFKELFANPNSELCK 664
           +++ + L +DG VIE+G   EL  +  +   K
Sbjct: 570 ADDYLYLMQDGKVIESGIQSELLVDSTTTFSK 601

>SAKL0A10208g Chr1 (894334..898266) [3933 bp, 1310 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1310

 Score =  184 bits (468), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 141/501 (28%), Positives = 241/501 (48%), Gaps = 21/501 (4%)

Query: 167  FARIVMLRILSERVVARLRSGVMNKTLHQDSEFY--DTHKVGDLISRLGSDAYVVSRSMT 224
            F +   L   SE  +  LR   + K   QD  ++  D +K  ++ + + +D   +   ++
Sbjct: 808  FLKNFFLGYCSEYWIRDLRMLAIRKITAQDLHWFSLDMNKSSEISALVLNDLRDLRSLVS 867

Query: 225  QKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEAT 284
            + +S     +I   VGI        +LS V +   P  +  +  +G  ++    D +   
Sbjct: 868  EFLSSISTLIIVSSVGIVWAFISGWKLSLVCISLFPIFILFSCFYGGLLQRYETDYKTKV 927

Query: 285  GQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGD 344
             +L     E   G+ T++    E + L +Y    + +    +K A        ++  L  
Sbjct: 928  AELENQLHEIFRGITTIRYLKLEYQFLEKYYNLEKKMRRASKKRAITIGFGVAASNTLTL 987

Query: 345  MSFIVVLLYGSYLVLQGSLT---IGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASR 401
                ++  YG  LV  GS +   + +    +L+T  T  S+ G      ++ +G  AA+ 
Sbjct: 988  AVQAILFYYGIKLVTTGSYSTEKMFETFTLLLFTVMTCVSLIGQI---PDISRGQRAATY 1044

Query: 402  LFDLTDHISSISPTKGQKYIPGKGD----IEFKNVSFSYPTRPENQIFKDINIKVPPGSN 457
            +F + D+ S  +  + +K    K      I  KN+SFSYP+ P   I+K + + V  G  
Sbjct: 1045 IFRIIDNQSPAAKDEKKKIASYKFTHDPLISVKNLSFSYPSAPSTAIYKGLKLDVFSGET 1104

Query: 458  VCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSG 517
            + +VG SG GKST+ LL+   Y   NG I +DG DI++ +   LR  I +V+Q+P    G
Sbjct: 1105 IAVVGESGSGKSTLTLLISALYEVPNGSIEIDGIDINRWDTNKLRTIISVVEQKPQFFDG 1164

Query: 518  TIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAI 577
            T+ +N+ YG++   T+ +++         +F+   P+G DT I    +L+SGGQ QR++I
Sbjct: 1165 TVGENLLYGISGRVTQIQVKEALCLAGVQDFVFSLPEGLDTRIDT--SLISGGQAQRLSI 1222

Query: 578  ARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG--SMTIVSIAHRLSTIKRSEN 635
            ARA+++KP IL LDE TSALD  +  AI      L+K     +T + I H    ++  E 
Sbjct: 1223 ARAMLRKPKILFLDECTSALDTSNTHAI----ANLIKKHFCGITTIVITHNEQMMRACER 1278

Query: 636  VIVLGKDGSVIEAGKFKELFA 656
            + VL ++G V E G F +L+A
Sbjct: 1279 IAVL-QNGKVAEDGSFDDLYA 1298

 Score =  157 bits (397), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 139/533 (26%), Positives = 237/533 (44%), Gaps = 26/533 (4%)

Query: 176 LSERVVARLRSGVMNKTLHQDSEFYD-THKVGDLISRLGSDAYVVSRSMTQKVSDGFKAL 234
           L E+   R+R  ++N  L +   +YD + +     ++L      +  S  +  +  F+ +
Sbjct: 104 LGEKQGLRVRRKLLNTYLDKPLTWYDKSEQASGEFTQLNRCVEELRSSCAESSAITFQNV 163

Query: 235 ICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQ 294
           +            S  L+ V++   P I+  + +  K I   ++     + +  ++    
Sbjct: 164 VTVFALTITSFYYSWSLTLVIMAGVPIIIVFSVILSKLIERFTRLENMESSRAAQMVSWS 223

Query: 295 LSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYG 354
               + ++ F  +Q E+ ++  +++       + +  ++  +          FI    +G
Sbjct: 224 FDAAEMIRLFCTQQFEIEKFELSVKKCTKYFIRISLFSSASYAMLRFFTLCMFIQGFWFG 283

Query: 355 SYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLF-------DLTD 407
           + ++ QG LT GD+          G+++         + +G  A  ++        D  D
Sbjct: 284 NKMIRQGVLTTGDVITCFSSCLLLGNTLNNTLQQVITMQKGKVALGKILMFTSEENDFPD 343

Query: 408 HISSI-------SPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCI 460
           H + I       +     K+  G G+I FKNVSFSYPTRP   + K++++  P      I
Sbjct: 344 HRNEIISDAFILNHINANKFRCG-GEISFKNVSFSYPTRPNYHVLKNVSLNFPKNKTTFI 402

Query: 461 VGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIR 520
           VG SG GKSTI  LLL+ Y    G I VDG DI  +    L  +I LV+Q   L + TI+
Sbjct: 403 VGKSGSGKSTIGKLLLKSYGGYTGAIEVDGIDIQHIKTSWLAENITLVEQSCTLFNDTIK 462

Query: 521 DNITYGLAEPATKEE-IRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIAR 579
           +NI  G    A  +  +R   +       I   P+G DT++G+ G  LSGGQ+QR+A+AR
Sbjct: 463 NNILLGCKGKAYGDSLVREACQMALLDRLIFDLPNGLDTVLGSGGVSLSGGQKQRVALAR 522

Query: 580 ALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVL 639
           A ++   IL+LDEA S +D+     +     +  K   MT V + H L+ I   E+ +  
Sbjct: 523 ARVRDSPILILDEAISGMDIIHRDLLVEAIKKWRK--GMTTVIVTHELTQIS-DEDYLYF 579

Query: 640 GKDGSVIEAGKFKELFANPNSELCKLL------TEKSSRSDGNDSLPPPPPNA 686
            ++G + E+G    L  N NS   +L       T  S RS    +L   P NA
Sbjct: 580 MEEGQIRESGFKCNLEKNENSHFNRLWRLQKAKTGFSRRSVSTSNLEKFPENA 632

>Smik_11.14 Chr11 complement(26603..30553) [3951 bp, 1316 aa] {ON}
            YKL209C (REAL)
          Length = 1316

 Score =  179 bits (455), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 150/524 (28%), Positives = 258/524 (49%), Gaps = 28/524 (5%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFY--DTHKVGDLISRLGSDAYVVSRSM 223
            NFA+  +L   SE  +  LR+ VM K   +   ++  + +K  ++ + + +D   +   +
Sbjct: 803  NFAKGFLLGYCSEYWIMDLRNEVMEKLTKKSMNWFSGEDNKASEVSALVLNDLRDLRSLV 862

Query: 224  TQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEA 283
            ++ +S     +    +G+   ++   +LS V +   P I+  ++++G  ++    D + +
Sbjct: 863  SEFLSAITSFITVSFIGLVWALASGWKLSLVCISMFPLIIIFSAIYGSILQKHETDYKTS 922

Query: 284  TGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLG 343
              QL     + ++ +KT++   AE      Y+     +  +  K A       + T M+ 
Sbjct: 923  VVQLENCLYQIVTNIKTIKYLQAEFHFQLSYHKLKTKMEQIASKRAIATGFGISMTNMIA 982

Query: 344  DMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLF 403
                 ++  YG  LV+    T   +        +T  S   L +   ++ +G  AAS ++
Sbjct: 983  MCIQAILYYYGLKLVMVHEYTSKKMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAASWIY 1042

Query: 404  DLTDH--------------ISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDIN 449
             + D               I  I  T  +K       I+  N++F+YP+ P   I+K++N
Sbjct: 1043 RILDEKQVTLEIEDNNARSIGIIGETYHEKQTTPMLSIQ--NLTFAYPSAPSVLIYKNMN 1100

Query: 450  IKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQ 509
            + +  G  + IVG SG GKST+ LLL R Y+   G I +DG D++  N   LRR I +V+
Sbjct: 1101 LNMFCGQTIGIVGGSGSGKSTLVLLLTRLYDCEVGSIKLDGTDVNDWNLTVLRREISVVE 1160

Query: 510  QEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSG 569
            Q+P+L +GTIRDN+TYG      + EI    K    ++F+   P G  T I     LLSG
Sbjct: 1161 QKPLLFNGTIRDNLTYGCLGEILEIEIYDALKYVGIYDFVASLPLGLGTRIDTN--LLSG 1218

Query: 570  GQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG--SMTIVSIAHRL 627
            GQ QR+ IARAL++KP IL+LDE TSALD  S   I     +++K G  ++  + I H  
Sbjct: 1219 GQAQRLCIARALVRKPKILILDECTSALDSMSSHVIK----EIVKKGPPALLTLVITHDE 1274

Query: 628  STIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
              ++  +++ V  KDG VIE G F  L+ N   E+ ++++EK++
Sbjct: 1275 QMMRCCDSIAVF-KDGKVIEEGSFDTLYNNC-GEMFRIVSEKNA 1316

 Score =  178 bits (452), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 148/535 (27%), Positives = 244/535 (45%), Gaps = 30/535 (5%)

Query: 173 LRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFK 232
           LRI S+ + A L    M      D+   D  ++   +  L S +   S    Q +     
Sbjct: 131 LRIRSQLLEAYLEKKPMKWYDVNDTLLGDFTQINRCVEELRSSSAEASAITFQNL----- 185

Query: 233 ALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAE 292
             IC  +G     S S  L+ ++L  +P I + A  F + +   S+   E T +  ++  
Sbjct: 186 VAICALLGTSFYYSWS--LTLIILCSSPIITFFAVAFSRMVHMYSQKENEETSKAAQLFA 243

Query: 293 EQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLL 352
             ++  + V+ +  +  E  ++   I        K+    A        L    F+    
Sbjct: 244 WSMNAAQLVRLYCTQPLERKKFQRIILSCNTFFIKSCLFVAANAGILRFLTLTMFVQGFW 303

Query: 353 YGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSI 412
           +GS ++ QG L I D+          GS++         L +G  A  ++ +L ++    
Sbjct: 304 FGSTMIKQGKLNINDVITCFHSCILLGSTLNNTLHQIVVLQKGEVALQKIMNLLENGPKC 363

Query: 413 SP---TKGQKYIP---GKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGR 466
           +P    +  +Y P      D+ F NVSFSYP+RP   + ++ ++K P G    IVG SG 
Sbjct: 364 NPPNEIELHQY-PLDYANSDLVFDNVSFSYPSRPSEIVLENASLKFPAGQFTFIVGKSGS 422

Query: 467 GKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYG 526
           GKST++ LLL++Y+  +G I ++G++I  +  K L ++I +V+Q   L + T+R NI  G
Sbjct: 423 GKSTLSSLLLKFYDGYDGSISINGRNIQAIPQKLLIKNITVVEQRCTLFNDTLRKNILLG 482

Query: 527 LAEPATKEE---------IRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAI 577
             E A   +         I+   +       I   PDG +T+IG+ G  LSGGQ+QR+A+
Sbjct: 483 STELAKNADYSTNKNTNLIKDACRMALLDRLILDLPDGLETLIGSGGVTLSGGQQQRVAM 542

Query: 578 ARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVI 637
           ARA I+   IL LDEA SALD+     +        K G  TI+ + H L  ++ S++ +
Sbjct: 543 ARAFIRDTPILFLDEAVSALDIIHRNLLMKAIRHWRK-GKTTII-LTHELGQVE-SDDHL 599

Query: 638 VLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDG----NDSLPPPPPNATQ 688
            L ++G VIE+G   EL A+  S   K    +   SD     N  +     N+T+
Sbjct: 600 YLMQEGKVIESGTQSELLADSTSTFSKWYCLQKDYSDTKTIVNSEIDEKSLNSTE 654

>ZYRO0G02244g Chr7 (169369..173190) [3822 bp, 1273 aa] {ON} similar to
            uniprot|P12866 Saccharomyces cerevisiae YKL209C STE6
            ATP-binding cassette (ABC) transporter required for the
            export of a-factor catalyzes ATP hydrolysis coupled to
            a-factor transport contains 12 transmembrane domains and
            two ATP binding domains expressed only in MATa cells
          Length = 1273

 Score =  176 bits (447), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 140/503 (27%), Positives = 248/503 (49%), Gaps = 21/503 (4%)

Query: 177  SERVVARLRSGVMNKTLHQDSEFY--DTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKAL 234
            SE  +  LR   M K  +   E+   D +K  +L + L +D   +  S +  +S     +
Sbjct: 776  SEIYIRTLRDDAMRKITYNRIEWLTQDNNKPSELSALLMNDLRDLRTSTSNFISFVSSFV 835

Query: 235  ICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQ 294
            I   VG+   +    +LS V +   P ++  + ++G  ++    + +    +L  V  E 
Sbjct: 836  IVSSVGLIWAIVTGWKLSLVCISMFPLLVIFSMIYGILLKKYETEYKNTIAKLENVQYEV 895

Query: 295  LSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYG 354
            ++G+KT++    E     ++N   +    +G++ A +   F  + +    MS   +L Y 
Sbjct: 896  VTGMKTIRCLQIEDHFKAKFNVLKQTAKLMGQRRAIVTG-FGVAVSNGLTMSIQGILYYY 954

Query: 355  SY-LVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHI--SS 411
            +  LV+ G  T   +        +T  +   L     ++ +G  AAS+++ + + I  S 
Sbjct: 955  AIKLVIHGEYTTKKMFETFTLLLFTIMTCNNLVNQIPDIRRGQRAASKIYRILEGIDESE 1014

Query: 412  ISPTKGQKYIPGKGD-----IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGR 466
               T+G + +P   +     I F ++SF+YPT P  +I K +++++  G  + IVG SG 
Sbjct: 1015 CFETEGHRIVPIVENPTGPIIRFNDLSFAYPTAPTVKILKHLSMEIYSGDRIAIVGESGC 1074

Query: 467  GKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYG 526
            GKST+  ++ R Y   +  + VD  D++      LR  I +V+Q+P L  GTIR+N+ YG
Sbjct: 1075 GKSTLVNIITRLYECPSNSLFVDNTDVNDWALPKLREQIAVVEQKPTLFKGTIRENLVYG 1134

Query: 527  LAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPN 586
                    ++ ++ K    ++F    P+G +T I +   LLSGGQ QR+ IARAL+++P 
Sbjct: 1135 SPLGTADVDVFNMLKYVGIYDFFATLPEGLETKIDS--GLLSGGQNQRLCIARALLQRPK 1192

Query: 587  ILVLDEATSALDVESEGAINYTFGQLMKSG--SMTIVSIAHRLSTIKRSENVIVLGKDGS 644
            IL+LDE TSALD  S   IN    ++++ G  +M  +SI H    ++    V VL + G 
Sbjct: 1193 ILILDECTSALDTMSSHIIN----EIIREGPPTMLTISITHDEQMVRACNKVAVLDQ-GH 1247

Query: 645  VIEAGKFKELFANPNSELCKLLT 667
            ++E G  ++L      +L KL+T
Sbjct: 1248 IVEMGNREDLL-RQKGQLWKLVT 1269

 Score =  167 bits (424), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 137/494 (27%), Positives = 234/494 (47%), Gaps = 16/494 (3%)

Query: 175 ILSERVVARLRSGVMNKTLHQDSEFYDTHKV--GDLISRLGSDAYVVSRSMTQKVSDGFK 232
           +L ER   R+R+ +++  L +  ++YD +    GDL ++       +  S  +  +  +K
Sbjct: 88  LLGERQNFRVRTQLIDSYLQKPMKWYDDNDTLTGDL-TQTNRCVEELRSSSAEASALTWK 146

Query: 233 ALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAE 292
            L+            S  L+ V +  AP I+  A  F + I   S+     T   +++  
Sbjct: 147 NLVTILALTVTSFYYSWSLTLVTMCGAPVIVLCAIFFSRLIHIYSEKENSHTAISSQLLS 206

Query: 293 EQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLL 352
             +   + V+    +  E+  +  A++       K     +        L    F+    
Sbjct: 207 WSMEAAQLVRLSCMQLVEVQNFQLAVKKCSKNFMKMCLYASANTAILKFLTLTIFVQAFW 266

Query: 353 YGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQ----GVGAASRLFDLTDH 408
           +GS ++ +  L I D+          G+++ G T     ++Q    GV   +      ++
Sbjct: 267 FGSTMIRKHKLRIEDVITCFQSCVLLGATING-TLHQIVILQKGKVGVINVNEFLKKDEY 325

Query: 409 ISSISPTKGQKYIPG--KGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGR 466
           +        + Y+ G     IE +NV F+YP+RP     K++++ +P G    +VG SG 
Sbjct: 326 LKEDFKNNRRFYLDGGISEKIELRNVQFNYPSRPTVPALKNVSLTLPVGKITYVVGKSGS 385

Query: 467 GKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYG 526
           GKS++  LLL+ Y+  NG I +DG DI  ++ K++ ++I LV+Q   L + T+R+NI +G
Sbjct: 386 GKSSLGNLLLKLYDDYNGSISIDGIDIKGIDQKSILKNITLVEQRCTLFNDTLRNNILFG 445

Query: 527 LAEP---ATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIK 583
             E       E +++  +     NFI   P+G DT+IG  G   SGGQ+QRIAIARA ++
Sbjct: 446 SKETDELVRDESLKAACRISLLDNFIYDLPEGLDTLIGTGGITPSGGQQQRIAIARAYMR 505

Query: 584 KPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDG 643
              ILVLDEA SALD+   G +        +S   TI+ + H LS I   +++I L +DG
Sbjct: 506 DTPILVLDEAVSALDIIHRGLLMNAIRN-WRSEKTTII-LTHDLSEIG-PDDMIYLLEDG 562

Query: 644 SVIEAGKFKELFAN 657
            V+E G+ + L  N
Sbjct: 563 EVVEQGQQRNLLLN 576

>CAGL0K00363g Chr11 complement(38281..41964) [3684 bp, 1227 aa] {ON}
            similar to uniprot|P12866 Saccharomyces cerevisiae
            YKL209c STE6
          Length = 1227

 Score =  176 bits (445), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 133/445 (29%), Positives = 216/445 (48%), Gaps = 23/445 (5%)

Query: 234  LICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEE 293
            ++   +G+   ++I  +LS V +   P ++    ++G  +  T    + +   L  +  E
Sbjct: 792  ILVTSIGLVWAIAIGWKLSLVCIAIIPLVVVLTGLYGTILIKTENRYKTSVANLESIVYE 851

Query: 294  QLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLY 353
             + G+KT+QS   +Q    ++N  I+ +   G   A         T ML  +   ++  Y
Sbjct: 852  AIIGMKTIQSLCLQQYITKKFNCKIKLLEKNGTYRAVATGLGIALTNMLVLLFQSILFYY 911

Query: 354  GSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHI---- 409
            G  LVL G  T   L   +    +T  +V  L T   ++ +G     R     D I    
Sbjct: 912  GFKLVLTGEYTHSKLFETIALLLFTIVTVASLVTQLPDITRG----QRSISWIDQILKGD 967

Query: 410  --------SSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIV 461
                    S++S TKG  + P +  IE  N+SF+Y      +   +IN+++       IV
Sbjct: 968  NQQTIEPPSNLSTTKG-IWNPNQPVIEVSNLSFTYAQVHNKKTLTNINMQLYSNQIYGIV 1026

Query: 462  GPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRD 521
            G SG GKST+  L+   Y+ + G I +   DI+K + K L + + L+QQ P+L   TIR+
Sbjct: 1027 GKSGSGKSTLINLICGLYSLSEGSINICSCDINKWSTKELHKTVALLQQNPVLQFDTIRN 1086

Query: 522  NITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARAL 581
            N+ YGL E    E + +V +     +FI    +G D+ +    +LLSGGQ QR+ +AR +
Sbjct: 1087 NLLYGLTETVGDEHLLNVLEYVGLKSFIISLNNGLDSKL--DDSLLSGGQSQRLCMAREM 1144

Query: 582  IKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGK 641
            ++ P +L+LDE TSALDV S   IN   G   +S +   + ++H+  TIK  + +  L  
Sbjct: 1145 LRNPKVLILDECTSALDVTSAKKINDIIGS--RSLAPVTIIVSHQKETIKLCDKIFFL-V 1201

Query: 642  DGSVIEAGKFKELFANPNSELCKLL 666
            DG+V   G ++EL  N N E  KLL
Sbjct: 1202 DGTVAMMGTYEELMEN-NWEFRKLL 1225

 Score =  158 bits (399), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 121/406 (29%), Positives = 193/406 (47%), Gaps = 17/406 (4%)

Query: 241 IGMMVSISPELSGVLLFFAPPILWSASVFGKKI-RHTSKDLQEATGQLTRVAEEQLSGVK 299
           IG     S  L+ ++    P I+  A +F K I ++T K+  E+     R+A   L  ++
Sbjct: 165 IGTAFYFSWSLTLIIFCSTPFIIICAVIFSKYIHKYTEKENTESECAAERLAW-MLKNIE 223

Query: 300 TVQSFVAEQRELHRYNGAIRGIYNVGRKAA-FINAEFFTSTTMLGDMSFIVVLLYGSYLV 358
            V+    +  E+  Y   I        KA+ FI+A       +   M F+    +GS ++
Sbjct: 224 FVRLHNGDDFEISMYTHYIAQANEYYIKASLFISANISILRLLSLLM-FVQGFWFGSSMI 282

Query: 359 LQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDH-----ISSIS 413
            QG L I  +          GS +         L +G  A  RL  + D      ++ I 
Sbjct: 283 KQGKLNIDSVITSFHCCLMLGSIINSALGQAVVLQKGDVAMKRLLKMIDRTPRESLAFID 342

Query: 414 PTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIAL 473
              G   +P    I F NVSF YP R  +++F  +N  + P     ++GPSG GKST+  
Sbjct: 343 AISGIDLLP----IVFNNVSFCYPERKTDKVFDKMNFIIKPNKMTYVIGPSGSGKSTLFD 398

Query: 474 LLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNI--TYGLAEPA 531
           L+L +Y+  +G I++   DI  +N   +  +I LV Q P L + TIR+NI          
Sbjct: 399 LILLHYDNYHGSIMLGDLDIRSINRNIILENITLVSQTPTLFNDTIRNNILACSNWTNLP 458

Query: 532 TKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLD 591
           +K E+  + K     N I + PDG DT IG+ G  LSGGQ Q++A+ARA  +  +IL+LD
Sbjct: 459 SKLEMECICKFALLENLIAELPDGLDTRIGSGGIKLSGGQAQKVALARAFARNTSILLLD 518

Query: 592 EATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVI 637
           E  SA+D+     +     +  ++G  T++ I H L  I+ ++N++
Sbjct: 519 EPLSAVDMRQRIVLMENIKR-WRNGKTTVI-ITHDLEFIRNTDNIL 562

>Ecym_3612 Chr3 (1167419..1171366) [3948 bp, 1315 aa] {ON} similar to
            Ashbya gossypii AFR432W
          Length = 1315

 Score =  176 bits (446), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 136/498 (27%), Positives = 241/498 (48%), Gaps = 16/498 (3%)

Query: 167  FARIVMLRILSERVVARLRSGVMNKTLHQDSEFY--DTHKVGDLISRLGSDAYVVSRSMT 224
            F +  +L + SE  +  LR   M++  +QD  ++  D +K  ++ + + +D   +   ++
Sbjct: 808  FLKKFILSVCSELWIMSLRIKAMDRISNQDVHWFSLDINKPSEISALILNDLRDLRYLVS 867

Query: 225  QKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEAT 284
              +S     +    +G+        +LS V +   P  +    ++G  ++    D + A 
Sbjct: 868  GFLSAVTTLIFVSAIGLAWAFVSGWKLSLVCISTIPLFIGVTGIYGGVLQKYETDYKTAV 927

Query: 285  GQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGD 344
             +L     E + G+KTV+    E    ++Y     G+ +  R+ A +       +  L  
Sbjct: 928  AELENNMFEFVKGIKTVRCLQLESHFSNKYTMLEEGMKHQSRRRAVVTGFGVALSNALVI 987

Query: 345  MSFIVVLLYGSYLVLQGSLTIGDLT---AFMLYTEYTGSSVFGLTTFYSELMQGVGAASR 401
                ++  YG  LV+ G  T  +L      +++T  T S++      +S   +      R
Sbjct: 988  GVQAILYYYGIKLVVDGEYTPDNLLQTFTLLVFTIMTCSALMYEVPSFSRGRRAATYVFR 1047

Query: 402  LFDLTDHISSISPTKGQKYI--PGKGD--IEFKNVSFSYPTRPENQIFKDINIKVPPGSN 457
            + +      SI      + I  P   +  I  ++++F+YP+  + +++K +++ +  G N
Sbjct: 1048 ILNTRSDFLSIDDDFRTEPIEKPSHMNPLIRIQDLTFAYPSALDVEVYKKLSLTINFGEN 1107

Query: 458  VCIVGPSGRGKSTIALLLLRYYNPTNGQ-ILVDGQDISKVNCKTLRRHIGLVQQEPILMS 516
            + IVG SG GKST+ L+L   Y P NG  + +D  DI K N  +LR+HI +V+Q+     
Sbjct: 1108 LAIVGESGSGKSTMGLILCGLY-PVNGNTVFIDDTDICKWNLSSLRKHISMVEQKAKFFD 1166

Query: 517  GTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIA 576
            G+IRDN+ YGL    T  +I  V       +F+ + P G +T I     L+SGGQ QRI+
Sbjct: 1167 GSIRDNLIYGLDRIVTDSQIFEVLSLVGIADFVKELPQGLNTRIDTN--LISGGQAQRIS 1224

Query: 577  IARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENV 636
            I RAL+++P +L+LDE TS+LD ++  AI    G  +    +T + I H    +K S N 
Sbjct: 1225 IGRALLRQPKLLILDECTSSLDAKNAQAIASLVGSSLY--GITTIVITHNTQMMK-SCNR 1281

Query: 637  IVLGKDGSVIEAGKFKEL 654
            I+  K+G + E G F+EL
Sbjct: 1282 ILFFKNGRISEEGTFQEL 1299

 Score =  130 bits (328), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 131/543 (24%), Positives = 240/543 (44%), Gaps = 39/543 (7%)

Query: 167 FARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHK--VGDLISRLGSDAYVVSRSMT 224
           +A +    +L ER   R+R  ++   L +   +YDT++   GD  +++      +  S  
Sbjct: 93  WATLSSWMLLGERQGFRVRRRLLGAYLSKTMAWYDTNENLEGDF-TQIHRGVEELRSSAA 151

Query: 225 QKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEAT 284
           +  +  F   +     +   +  S  L+ V+L   P I+  A +F K +   ++     T
Sbjct: 152 ESSAVTFLNAVTVVTLLTTSLYFSWSLTLVILASTPLIIALAIIFSKLVEKYTELENTET 211

Query: 285 GQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRG----IYNVGRKAAFINAEFFTSTT 340
                +    +   + ++ F  EQ EL +++ +++       N+ + AA   A    S  
Sbjct: 212 SHAASILTWSMEAPQLIRLFGTEQVELQKFSISVKKCSKFFINLSKYAAANQA----SLR 267

Query: 341 MLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAAS 400
            L  + F+    +G+ ++ +G L  G +          G+++         + +G  A  
Sbjct: 268 GLSLIMFVQGFWFGNTMIKRGKLNSGQVITCFSACILLGTTLNNTLQHIVIMQKGKVALQ 327

Query: 401 RLFDLTDHISSI-------------SPTKGQKYIP-GKGDIEFKNVSFSYPTRPENQIFK 446
           ++  + +  S               SP  G    P     I F+NVSFSYP+RP      
Sbjct: 328 KILSMVESESDALRGRRGETFEIFPSPISGMFVSPVFPKQITFENVSFSYPSRPNEYALD 387

Query: 447 DINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIG 506
           ++++   P     IVG SG GKST++ LLL+ Y+   G I V   DI       L  +I 
Sbjct: 388 NVSLTFYPEKITFIVGKSGSGKSTLSNLLLKLYSDYEGTIKVGTLDIRATKDSWLLENIT 447

Query: 507 LVQQEPILMSGTIRDNITYGLAEPATKE-EIRSVAKQCFCHNFITKFPDGYDTMIGAQGA 565
           LV+Q   L + ++ +N+     +    E  I+   +       +   PDG  T+IG+ G 
Sbjct: 448 LVEQSCTLFNDSLLNNLLLTAKDDNKNEASIKRACQMALLEKLLFDLPDGLSTVIGSNGI 507

Query: 566 LLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625
            LSGGQ+QR+A+ARA+++   +L+LDE+ SALD+     +        ++G  TI+ + H
Sbjct: 508 SLSGGQQQRVALARAILRDTPVLILDESISALDIIHRDLLMEVIRN-WRAGKTTII-LTH 565

Query: 626 RLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPPPN 685
            LS I   ++ + L +DG V E G  ++L +  +    +L          ++++ P  P+
Sbjct: 566 ELSHI-LDDDYLYLMEDGKVGEHGYKRDLLSYTSGRFTEL----------HNAVIPSDPS 614

Query: 686 ATQ 688
           A +
Sbjct: 615 AIE 617

>KLLA0B14256g Chr2 (1248654..1252469) [3816 bp, 1271 aa] {ON}
           similar to uniprot|P12866 Saccharomyces cerevisiae
           YKL209C STE6 ATP-binding cassette (ABC) transporter
           required for the export of a-factor catalyzes ATP
           hydrolysis coupled to a-factor transport contains 12
           transmembrane domains and two ATP binding domains
           expressed only in MATa cells
          Length = 1271

 Score =  175 bits (443), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 147/535 (27%), Positives = 262/535 (48%), Gaps = 27/535 (5%)

Query: 176 LSERVVARLRSGVMNKTLHQDSEFYDTHK--VGDLISRLGSDAYVVSRSMTQKVSDGFKA 233
           L ER   R+R+ ++     +D ++YD+++   GD I ++      V  S  +  +  F+ 
Sbjct: 91  LGERQGFRIRNSLIMFYFEKDLKWYDSNENLEGDFI-QINRCIEEVRASSAEASAIFFQN 149

Query: 234 LICGGVGIGMMVSISPELSGVLLFFAPPILWSASVF-GKKIRHTSKDLQEATGQLTRVAE 292
           +I     I   +  S  L+ ++L  + P+L + +VF   K+   SK     + + + V  
Sbjct: 150 VISIIALIATSMYYSWSLTLIILC-SLPLLATLAVFLSMKVEKFSKLENLESSKASSVLA 208

Query: 293 EQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLL 352
             L   + ++ F     E  ++   +        K+   +A   +S   L    F+    
Sbjct: 209 WSLDAFQMIRLFNTSYWEQKKFETLVSKCNKHFVKSCLYSALNASSLRFLTLCMFVQGFW 268

Query: 353 YGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL--FDLTDHIS 410
           +G+  + +G +  GD+          GSS+         + +G  A  R+  F + +  S
Sbjct: 269 FGNTQIKRGKMKAGDVITCFSSCLLLGSSLSSTLQQIVTIQKGKAAIQRINQFLVPNSKS 328

Query: 411 SISPTK------------GQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNV 458
           ++   +            G   I   GDIEF++VSF+YPTRP++ + K+++IK+  G+  
Sbjct: 329 AVGEWEKRSSLISTSSSIGLAPIFCDGDIEFRDVSFAYPTRPDDYVLKNVSIKIKSGATC 388

Query: 459 CIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGT 518
            IVG SG GKST+A LLL+ Y    G+I     +I  ++   L  +I LV+Q   L +GT
Sbjct: 389 FIVGKSGSGKSTLASLLLKMYGEYTGEIKFGEYEIDSLDDSWLVENITLVEQRCTLFNGT 448

Query: 519 IRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIA 578
           ++DN+T  + + A+  E++   +    +  +   P+G DT++G  G  LSGGQ+QR+A+A
Sbjct: 449 LKDNLTI-VNKYASCTEVKQACQFALLNTVLLNLPNGIDTLLGRHGVTLSGGQQQRVALA 507

Query: 579 RALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIV 638
           RA ++   +L+LDE+ SALD+ S   I        K G  TI+ + H  + IK  E V +
Sbjct: 508 RAYLRNTPVLILDESLSALDIMSRELIVEAIRHWRK-GKTTII-LTHEYTQIKDDEYVYL 565

Query: 639 LGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSD----GNDSLPPPPPNATQD 689
           +  +G+V+E+G   +L  NP+S   +L + + +R +     +  LP  P +AT +
Sbjct: 566 MS-EGTVVESGFKYDLLENPDSYFAQLNSLQETRYEVPVSPDVELPYSPDSATYN 619

 Score =  168 bits (426), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 132/499 (26%), Positives = 244/499 (48%), Gaps = 15/499 (3%)

Query: 167  FARIVMLRILSERVVARLRSGVMNKTLHQDSEFYD--THKVGDLISRLGSDAYVVSRSMT 224
            F +  +L   SE  + RLR   M K   +  +++   T+   +L S + +D   +    +
Sbjct: 763  FLKDFILGYCSEVWIERLRVDAMAKISSKSLDWFKLPTNNSSELNSLMMNDLRDLRGLAS 822

Query: 225  QKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEAT 284
            + +S     +    +G+   +    +LS V +   P  +  + ++G  ++      +   
Sbjct: 823  EFLSAITTLVFVASIGLIWALVSGWKLSLVCISLFPAFILFSGIYGSLLQVYETAYKTEI 882

Query: 285  GQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGD 344
             +L     E +  +KT++    +Q     +   +  +  V +K +         T  L  
Sbjct: 883  AELETRVHELVISMKTIKLLQLQQHFEGSFKTQLAKVRIVCKKRSVAVGFGIAVTNALAM 942

Query: 345  MSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFD 404
            +   ++  +G  LV+QG  ++  +        ++  +   L     E+ +G  AA+ +F 
Sbjct: 943  VVQAILFFFGIKLVIQGEYSVAQMFETFTLLLFSIMTCVSLINQVPEISRGQRAATYIFK 1002

Query: 405  LTDHISSIS-----PTKGQKYIPGKGD---IEFKNVSFSYPTRPENQIFKDINIKVPPGS 456
            + +   S+      P++ Q +    G+   I+  N+SF++ + P N+IF  ++ ++    
Sbjct: 1003 VLEDSGSVDTSKPDPSQNQSFFSTAGNRETIKISNLSFAFSSAPMNKIFNSLSCEICLNE 1062

Query: 457  NVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMS 516
             V IVG SG GKST++LLL R Y   +G++ + G DI+K +   LRR I +V+Q+P    
Sbjct: 1063 TVGIVGESGSGKSTLSLLLTRLYPVPSGKVYIGGIDINKWDEYALRRTISIVEQKPKFFD 1122

Query: 517  GTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIA 576
            GT+R+N+ YGL    +  E+RSV K     +F+   P+  +T +     L+SGGQ QR++
Sbjct: 1123 GTVRENLVYGLKRNVSNSELRSVLKSVDLLSFVQTLPNDLNTRV--HDGLMSGGQAQRLS 1180

Query: 577  IARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENV 636
            IAR L+++P I++LDE TSALD  +  AI      ++K  ++T++ I H    ++  + V
Sbjct: 1181 IARTLLRQPKIIILDECTSALDAANSFAIAELIRTVLK--NVTVIVITHSEQLMQICDRV 1238

Query: 637  IVLGKDGSVIEAGKFKELF 655
            +VL K G V E G + ELF
Sbjct: 1239 LVL-KKGKVKEEGSYAELF 1256

>KLTH0B01100g Chr2 complement(94260..98156) [3897 bp, 1298 aa] {ON}
           similar to uniprot|P12866 Saccharomyces cerevisiae
           YKL209C STE6 ATP-binding cassette (ABC) transporter
           required for the export of a-factor catalyzes ATP
           hydrolysis coupled to a-factor transport contains 12
           transmembrane domains and two ATP binding domains
           expressed only in MATa cells
          Length = 1298

 Score =  173 bits (439), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 148/551 (26%), Positives = 250/551 (45%), Gaps = 30/551 (5%)

Query: 176 LSERVVARLRSGVMNKTLHQDSEFYDTHK--VGDLISRLGSDAYVVSRSMTQKVSDGFKA 233
           L ER   RLR  ++   L +   +YD ++   GD  ++L      +  S  +  +  F+ 
Sbjct: 99  LGERQAFRLRRKMLQSYLDKSMAWYDANEQISGDF-TQLNRCVEELRSSSAESSAIVFQN 157

Query: 234 LICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEE 293
           ++     +G  +  S  L+ +++  +P ++  A  F +K+   +K     T         
Sbjct: 158 VVTVAALLGSALYYSWSLTLIIMANSPLVIGFAVFFSRKVEKYAKRENSETSSAADAMAW 217

Query: 294 QLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLY 353
            L   K V+    + REL R+   ++       K +  ++  ++    L    F+    Y
Sbjct: 218 SLDAAKMVRLLGTQDRELARFEACVQKCRQHFNKMSLFSSLNYSVLRFLTLCMFVQGFWY 277

Query: 354 GSYLVLQGSLTIGDL-TAFMLYTEYTGSSVFGLTTFYSELMQGV---GAASRLFDLTDHI 409
           G+  +  G L  GD+ T F        S V   +T  S L Q +     A  L  +   +
Sbjct: 278 GNSRINIGKLKPGDVVTCF-------SSCVLLASTLNSTLHQIIILQKGAVGLQKIMAFV 330

Query: 410 SSISPTKGQK-----------YIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNV 458
           +S   ++ QK               +  I F+NV F+YPTRP++ + K +++  P G   
Sbjct: 331 NSRDASESQKNKVEISFRRLPLCWERASITFQNVHFAYPTRPDDFVLKGVSLDFPSGETT 390

Query: 459 CIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGT 518
            ++G SG GKSTI  LLL +Y   +G I V+GQD+ ++N   L R+I LV+Q   L + T
Sbjct: 391 FVIGKSGSGKSTIGNLLLGFYGIGSGTINVNGQDVKEINQSELARNIMLVEQTTSLFTET 450

Query: 519 IRDNITYGLAEPATKE-EIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAI 577
           + +N+T G A     E  ++   +     N I     G +T IG  G  LSGG++QR+A+
Sbjct: 451 LANNVTIGEAGVDDDEIRLKQACQMAMLGNIIRDLAKGLETTIGCSGLDLSGGEQQRVAL 510

Query: 578 ARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVI 637
           ARA  +   IL+LDEA SA D   +  +     +  ++   TI+ + H LS I  ++ V 
Sbjct: 511 ARAYFRNAPILILDEALSAQDRIHKSLLMEAIRK-WRADKTTII-LTHELSDILDTDYVY 568

Query: 638 VLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSD-GNDSLPPPPPNATQDKVVEQIA 696
           V+  DG + E G    L +NP SE   L   ++   D G+ +      +   D+ +E + 
Sbjct: 569 VM-SDGQIREHGYKSGLLSNPKSEFSNLHRFQACDDDFGDVATLGDGTSQIVDQKLEGVR 627

Query: 697 EKILERFPEAG 707
             + E + E G
Sbjct: 628 TDVEELYSELG 638

 Score =  165 bits (418), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 121/429 (28%), Positives = 207/429 (48%), Gaps = 15/429 (3%)

Query: 250  ELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQR 309
            +LS V +   P  +     +G  ++    + + A   +       +  +KT++    E+R
Sbjct: 876  KLSLVCISLIPAFILFTGAYGGLLQKCEANYKSAVASMEDQLYSAVRRIKTIRCLQVEER 935

Query: 310  ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLT 369
             +  Y          GRK A         +  L  ++  ++L YG  LV+ G  +   + 
Sbjct: 936  VIKEYEVLEGKAKLAGRKRALGTGFGVALSNALTLITQSILLYYGMKLVITGEYSSERMF 995

Query: 370  AFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPT--KGQKYIPGKGD- 426
              +    +T  +   L     E+ +G  AA+ LF + D  +  +    +G+  +  +G  
Sbjct: 996  QTLTLLLFTIMTCMSLIAQIPEISRGQRAATYLFRILDSETQFADANLEGESALTSRGCS 1055

Query: 427  ----IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPT 482
                I  K++ FSY       +++ +N+ V  G  V +VG SG GKST+  L+ R Y   
Sbjct: 1056 NEALIFIKDLRFSYSFLNNPMVYRGLNLSVKAGETVALVGLSGSGKSTLWHLITRLYRVP 1115

Query: 483  NGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQ 542
            +G I  DG D+++     LR+ I +V+Q P L  G+I DN+TYGL+    + EIR + + 
Sbjct: 1116 SGSIWFDGLDVNEWEEWALRKRIAVVEQRPSLFRGSIFDNLTYGLSTSVDEREIRELLEL 1175

Query: 543  CFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESE 602
                +F+   P G  + I     +LSGGQ QR+AI RAL++KP +LVLDE TSALD +  
Sbjct: 1176 VGMMDFVNSNPLGLQSFIDTD--VLSGGQLQRLAIVRALLRKPQLLVLDECTSALDAQH- 1232

Query: 603  GAINYTFGQLMKSGSMTIVSIAHRLS-TIKRSENVIVLGKDGSVIEAGKFKELFANPNSE 661
                +   + ++ GS +  ++    S  + R+ N I+   +G++IE G F+ L++    E
Sbjct: 1233 ---GFIMSEFVRQGSQSTTTLVLTHSEQMMRACNRILTFANGNIIEDGSFERLYSQKG-E 1288

Query: 662  LCKLLTEKS 670
            L K+L+  S
Sbjct: 1289 LFKILSSCS 1297

>TPHA0C00960 Chr3 (204061..208632) [4572 bp, 1523 aa] {ON} Anc_8.303
            YDR135C
          Length = 1523

 Score =  170 bits (431), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 148/516 (28%), Positives = 243/516 (47%), Gaps = 47/516 (9%)

Query: 183  RLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIG 242
            +L S + +        F++T  +G +++R  +D Y +   + +  S  F+  I     I 
Sbjct: 1018 QLHSSMTSSIFRAPMSFFETTPIGRILNRFSNDVYKIDEILGRSFSQFFQNTIRVSFTIV 1077

Query: 243  MMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQ----LTRVAEEQLSGV 298
            ++ S + +     +F   P+ +    + +    TS++L+         L    +E L GV
Sbjct: 1078 VICSTTWQF----IFLIIPMAFLYIYYQQYFLRTSRELRRLDSTTRSPLYAHFQETLCGV 1133

Query: 299  KTVQSFVAEQRELH----RYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVL 351
             T++ F  + R +H    R +  +   Y   N  R  AF   EF  S  +LG  +  +  
Sbjct: 1134 STIRGFAQQDRFIHINQSRVDSNMMAYYPSINSNRWLAF-RLEFLGSLIILGAATLSIFR 1192

Query: 352  LYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISS 411
            L        GSLT G +   M Y      S+  +     ++   + +  R+ + + H+ S
Sbjct: 1193 LKN------GSLTAGMIGLSMSYALQVTQSLNWIVRMTVDVESNIVSVERIEEYS-HLPS 1245

Query: 412  ISP-----TKGQKYIPGKGDIEFKNVSFSYPTRPE-NQIFKDINIKVPPGSNVCIVGPSG 465
             +P      +  +  P KG IEFKN S  Y  RPE + + K+IN+K+ P   V IVG +G
Sbjct: 1246 EAPLIIENNRPSEEWPSKGAIEFKNYSTRY--RPELDLVLKNINLKILPKEKVGIVGRTG 1303

Query: 466  RGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNI-- 523
             GKS++ L L R    ++G I +DG +I+++    LR  + ++ Q+  +  G+IR+NI  
Sbjct: 1304 AGKSSLTLALFRIIEASSGSIEIDGVNINELGLYDLRHKLSIIPQDSQVFEGSIRENIDP 1363

Query: 524  --TYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDT---------MIGAQGALLSGGQR 572
               +   E     E+  +       N I+   +  DT          I   G+ LS GQR
Sbjct: 1364 TQQFSEQEIWNALEMAHLKPHILKMNEISPESENSDTNQSSNPLDAKITEGGSNLSVGQR 1423

Query: 573  QRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKR 632
            Q I +ARAL+   N+L+LDEAT+A+DVE++  I +T     K    TI++IAHR++TI  
Sbjct: 1424 QLICLARALLVPSNVLILDEATAAVDVETDELIQHTIRTAFK--DRTILTIAHRINTIMD 1481

Query: 633  SENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTE 668
            S+ +IVL  +G V E  K + L  N NS    L  E
Sbjct: 1482 SDKIIVL-DNGEVAEFDKPEILLTNKNSLFYSLCYE 1516

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 98/415 (23%), Positives = 189/415 (45%), Gaps = 38/415 (9%)

Query: 278 KDLQEATGQLTRVAEEQLSGVKTVQSFV-----AEQRELHRYNGAIRGIYNVGRKAAFIN 332
           KD  +   + T +  E L+ +K+++ +       E+ E  R    ++ +  +G   A I 
Sbjct: 462 KDQMKYKDERTGLVNEILNNIKSLKLYAWEKPFQEKLEFVRNEKELKNLKKIGVFNAMIA 521

Query: 333 AEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSEL 392
            +F     ++   +F  + ++     L   L    LT F L        +  +    S  
Sbjct: 522 FQFNIVPFLVSCCTF-AIFVWVEDKPLTTDLVFPALTLFNL----LNFPLVAVPITISAF 576

Query: 393 MQGVGAASRLFD-LTDHISSISPTKGQKYIPGKGDIEFK---NVSFSYPTRPENQI-FKD 447
           ++   + SRL+  LT+        +   ++   G+   K   N +F +  +PE ++  K+
Sbjct: 577 IEASVSISRLYSYLTNEELQKDAIQRLPFVKQNGETTVKIGDNATFLWKRKPEYKVALKN 636

Query: 448 INIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVN-CKTLRRHIG 506
           IN +   G   CIVG  G GKS     +L               D+ +V    ++  ++ 
Sbjct: 637 INFEARKGELACIVGKVGSGKSAFIQSIL--------------GDLFRVKGFASIHGNVA 682

Query: 507 LVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGAL 566
            V Q   +M+GT++DNI +G       E      K C     ++  PDG  T++G +G  
Sbjct: 683 YVSQLAWIMNGTVKDNIIFG--HRYDPEFYEKTIKACALTIDLSILPDGDQTLVGEKGIS 740

Query: 567 LSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQ--LMKSGSMTIVSI 623
           LSGGQ+ R+++ARA+  + +I +LD+  +A+D   S+  I    G   L+KS +  + + 
Sbjct: 741 LSGGQKARLSLARAVYARADIYLLDDPLAAVDEHVSKHLIQNVLGAKGLLKSKTRILTT- 799

Query: 624 AHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDS 678
            +++  +  ++++ +L ++G + E G + ++ A   S L KL+TE   + D ++S
Sbjct: 800 -NKIPVLSIADSITLL-ENGEITEQGTYFDVMATEGSSLSKLITEYGKKKDSSES 852

>Ecym_4265 Chr4 (560254..564771) [4518 bp, 1505 aa] {ON} similar to
            Ashbya gossypii AGR047W
          Length = 1505

 Score =  165 bits (417), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 154/523 (29%), Positives = 247/523 (47%), Gaps = 54/523 (10%)

Query: 170  IVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSD 229
            I +    + +  ARL   +    L     F++T  VG +++R  +D Y V   + +  S 
Sbjct: 1003 ITLCMFCTIKASARLHDAMAKAVLRAPMSFFETTPVGRILNRFSNDIYKVDELLGRSFSQ 1062

Query: 230  GFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTR 289
             F  +    V   M+V  S  ++   +FF  P+      + +    TS++L+     +T+
Sbjct: 1063 FF--IHVTKVVFTMIVICS--ITWQFIFFILPLSVLYLFYQQYYLRTSRELRR-LASVTK 1117

Query: 290  VA-----EEQLSGVKTVQSFVAEQRELH----RYNGAIRGIY---NVGRKAAFINAEFFT 337
                   +E L+GV TV+SF  + R +H    R N  +   Y   N  R  AF   EF  
Sbjct: 1118 SPVYAHFQETLTGVTTVRSFKKQDRFIHINQSRINTYMCAYYLSINANRWLAF-RLEF-- 1174

Query: 338  STTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVG 397
                +G +  +   +   + + QG LT G L   + Y      S+  +     E+   + 
Sbjct: 1175 ----MGSIVILAAAVLSVFRLKQGKLTAGMLGLGLSYALQITQSLNWIVRMTVEVETNIV 1230

Query: 398  AASRLFDLTD---HISSISPT-KGQKYIPGKGDIEFKNVSFSYPTRPE-NQIFKDINIKV 452
            +  R+ + TD       I PT +  K  P  GDI+F++ S  Y  RPE + I +DIN+ +
Sbjct: 1231 SVERIKEYTDLKPEAPMIIPTSRPPKNWPANGDIKFEHFSTRY--RPELDLILEDINLHI 1288

Query: 453  PPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEP 512
             P   V IVG +G GKS++ + L R      G+IL+D   I  +    LR  + ++ Q+ 
Sbjct: 1289 HPREKVGIVGRTGAGKSSLTVSLFRLIEAAAGRILIDDLPIDSIGLNDLRSSLSIIPQDS 1348

Query: 513  ILMSGTIRDNITYGLAEPATK---EEIRSVAKQCFC-HNFITKFPDGYDTMIGAQGALLS 568
             +  GT R+NI     +P  K   +EI +  +      + +T   +G +T +   G+ LS
Sbjct: 1349 EVFEGTFRENI-----DPCNKFTDDEIWNALELAHLKQHVMTLGTEGLNTSLKEGGSNLS 1403

Query: 569  GGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLS 628
             GQRQ + +ARAL+    ILVLDEAT+A+DVE++  I  T     K    TI++IAHRL+
Sbjct: 1404 VGQRQLMCLARALLVPSKILVLDEATAAIDVETDKLIQRTIRTAFK--DRTILTIAHRLN 1461

Query: 629  TIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
            TI  S+ ++VL K       G+  E F  P    C LL +++S
Sbjct: 1462 TIMDSDKIVVLDK-------GRIAE-FDTP----CNLLKDETS 1492

 Score = 96.7 bits (239), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 78/301 (25%), Positives = 144/301 (47%), Gaps = 35/301 (11%)

Query: 425 GDIEFK---NVSFSYPTRPENQI-FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYN 480
           GDI      + ++ +  +PE ++  K+IN +   G   CIVG  G GKS +   +L    
Sbjct: 610 GDISVNISGDATYLWQRQPEYKVALKNINFQARKGELSCIVGKVGTGKSALIQAML---- 665

Query: 481 PTNGQILVDGQDISKVN-CKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSV 539
                      D+ +V    TL   +  V Q   +M+GTI+DNI +G    A  E     
Sbjct: 666 ----------GDLFRVKGSATLHGSVAYVSQVSWIMNGTIKDNILFGYKYDA--EFYEKT 713

Query: 540 AKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDV 599
            K C     +   PDG  T +G +G  LSGGQ+ R+A+ARA+  K ++  LD+  +A+D 
Sbjct: 714 IKACALSLDLNTLPDGDQTFVGERGISLSGGQKARLALARAVYAKADVYFLDDPLAAVDE 773

Query: 600 E-SEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANP 658
             S+  + Y  G      + T +   +++  +  ++++ +L  +G +++ G + ++ +N 
Sbjct: 774 HVSKHLVKYVIGPTGLLKTKTRILTTNKIHVLSVADSITLL-DNGVIVQQGSYDQVNSNK 832

Query: 659 NSELCKLLT----EKSSRSDGN-DSLPPPPPNATQDKVVEQ-------IAEKILERFPEA 706
           +S L KL+     +KS   + N D++     +++   +V++        A K + +F + 
Sbjct: 833 DSPLFKLIANFGKQKSQAIENNEDTVAEVKTSSSSSPLVQEDIIDWSKSASKDMNKFTDV 892

Query: 707 G 707
           G
Sbjct: 893 G 893

>Kwal_33.15561 s33 (1157299..1161192) [3894 bp, 1297 aa] {ON}
           YKL209C (STE6) - ABC transporter, glycoprotein,
           component of a-factor secretory pathway [contig 290]
           FULL
          Length = 1297

 Score =  163 bits (412), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 161/615 (26%), Positives = 276/615 (44%), Gaps = 50/615 (8%)

Query: 89  RDWRLLCAAIALLTISCVIGMSIPKV----IGLVLDVLRKG-IEGKDLQNVNMDDLGPIA 143
           RDW LL     +++I  V    +P V    +G V ++L+K  I+  D  N  M DL    
Sbjct: 24  RDWWLL----MIISICSVAYGIVPAVTSILMGAVFNLLQKPVIQQFDSVNTLMRDLTIRT 79

Query: 144 FGLTIYQXXXXXXXXXXXXXXXNFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTH 203
             + I                  +  I     L ER   RLR  ++     +   +YD +
Sbjct: 80  MAILI---------TGIASIPFCWLSIYAWMSLGERQGFRLRRKLLRSYFEKSMAWYDIN 130

Query: 204 -KVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPI 262
            ++    ++L      +  S  +  +  F+ L+     +G  +  S  L+ V++  +P +
Sbjct: 131 EQISGEYTQLNRCVEELRSSSAEASAIIFQNLVTVIALLGTALYYSWSLTLVIMANSPLV 190

Query: 263 LWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIY 322
           +  A    + +    K     T     +    L+  K V+    +  E+ ++  ++    
Sbjct: 191 IGFAIYCSRNVEKYGKIENSETSVAADIMAWSLNAAKMVRLLGTQDYEIAKFRASVLKCR 250

Query: 323 NVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGD-LTAFMLYTEYTGSS 381
               K +  ++  ++    L    F+    YG+  +  G+L  GD +T F        S 
Sbjct: 251 MNFNKMSLFSSLNYSILRFLTLCMFVQGFWYGNVRIKSGNLKPGDVMTCF-------SSC 303

Query: 382 VFGLTTFYSELMQGV----GAAS----RLFDLTDHISSISPTKGQKYIP---GKGDIEFK 430
           +   +T  S L Q V    GA      + F  +D +          ++P    +  I F+
Sbjct: 304 ILLASTLNSTLHQVVTLQKGAVGLKKIQEFLTSDVVQGKECVVNSMHLPLLWEQAQISFE 363

Query: 431 NVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDG 490
           NVSF+YP+R ++ + K++N+KVP G    IVG SG GKSTI+ LLL+ Y P +G I V+ 
Sbjct: 364 NVSFAYPSRSKHPVIKNLNLKVPGGRFTFIVGKSGSGKSTISNLLLKLYRPCSGLIKVND 423

Query: 491 QDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFIT 550
            DI ++N + L R I LV+Q   L   +I++NI     E      +    +       I 
Sbjct: 424 VDIREINQQDLFRSITLVEQNSPLFEDSIKNNIQLTSDEHRDDGRLSQACQAAMLEGVIR 483

Query: 551 KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFG 610
               G DT+IG+ G  LSGG++QR+A+ARA ++   IL+LDEA SA D   +  +     
Sbjct: 484 DLAKGLDTIIGSSGVDLSGGEQQRVALARAFVRDSPILILDEALSAQDRMHKDLLMEAI- 542

Query: 611 QLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS--------EL 662
           +  + G  TI+ + H L+ I   ++ ++L +DG+VIE G+  +L ++  S        +L
Sbjct: 543 RFWRKGRTTII-LTHELNDILE-DDFVLLMEDGNVIERGQKSDLLSDSTSKFSLLHAFQL 600

Query: 663 C-KLLTEKSSRSDGN 676
           C ++  E S+ +D N
Sbjct: 601 CDEIEDEASTITDSN 615

 Score =  162 bits (409), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 137/515 (26%), Positives = 234/515 (45%), Gaps = 19/515 (3%)

Query: 167  FARIVMLRILSERVVARLRSGVMNKTLHQD-SEFYDTHKVGDLISRLGSDAYVVSRSMTQ 225
            F +  +L    E  +  LR       + +D + F D++     I+ L  +     R++  
Sbjct: 790  FLKCYILSRCGENWIKELRINAFRSVMEKDFTWFQDSNNSTSNITSLILNDLRDLRALAS 849

Query: 226  KVSDGFKAL-ICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEAT 284
            +       L +    G+   +    +LS V +   P  +  + ++G  +++     +   
Sbjct: 850  EFLAALSTLAVVSLCGLLWALVAGWKLSLVCISLIPMFVLFSGIYGGLLQNYEARYKTCI 909

Query: 285  GQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGD 344
             +L     + +  +KT++    E +    Y           RK A        S+  L  
Sbjct: 910  AELENELYKAIRCMKTIKCLQMENKVARSYEMLEVTSKGAARKRAMGTGFGVASSNALTF 969

Query: 345  MSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFD 404
            ++  ++L +G  LV+ G  T G +   +    +T  +   L +   E+ +G  AA+ LF 
Sbjct: 970  ITQSILLYFGMKLVITGEYTPGKMLETLTLLLFTIMTCMTLMSQVPEISRGQRAATYLFK 1029

Query: 405  L--TDHISSISPTKGQ-----KYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSN 457
            L   +H    S  K +     K    +  I  K++ FSY       ++K++++KV  G  
Sbjct: 1030 LFGNEHEEGASVLKERHAPIIKTCSKQTLISIKHLKFSYSNINNPMVYKNLSLKVDRGEI 1089

Query: 458  VCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSG 517
            V ++G SG GKST+  LL R Y   NG I +DG DI++ + K LR  I +V+Q+P+  SG
Sbjct: 1090 VGLIGTSGSGKSTLWSLLTRLYPVENGSISIDGTDINQWDRKALRSCIAVVEQKPLFFSG 1149

Query: 518  TIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAI 577
            +I +N+TYGL    + EE+  +        F+   P    ++I  Q  LLSGGQ QR+AI
Sbjct: 1150 SIIENLTYGLMRKVSDEEVNELLLTLGMLEFVNSTPKRLHSVIDTQ--LLSGGQVQRLAI 1207

Query: 578  ARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG--SMTIVSIAHRLSTIKRSEN 635
             RAL++KP +LVLDE TSALD       ++   + +K      T + + H    ++    
Sbjct: 1208 VRALLRKPQLLVLDECTSALDARH----SFIMSEFVKHHLYHTTTLVVTHSEQMMRSCHR 1263

Query: 636  VIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKS 670
            ++   K G ++E G    LF N   EL ++LT  S
Sbjct: 1264 ILTFNK-GEIVEEGSIDNLF-NQKGELYRILTCNS 1296

>NDAI0J01150 Chr10 complement(262920..267473) [4554 bp, 1517 aa] {ON}
            Anc_8.303
          Length = 1517

 Score =  162 bits (411), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 145/506 (28%), Positives = 242/506 (47%), Gaps = 43/506 (8%)

Query: 184  LRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGM 243
            L + + N  L     F++T  +G +++R  +D Y V   + +  S  F   +     IG+
Sbjct: 1028 LHTLMTNAVLRAPMSFFETTPIGRILNRFSNDIYKVDSVLGRTFSQFFVNAVKVSFTIGV 1087

Query: 244  MVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVA-----EEQLSGV 298
            +   + +     +F   P+      + +    TS++L+     +TR       +E L G+
Sbjct: 1088 ICVTTWQF----IFVIVPLGVFYIYYQQYYLRTSRELRRL-DSITRSPVYSHFQETLGGI 1142

Query: 299  KTVQSFVAEQR----ELHRYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVL 351
             T++ +  ++R       R +  +   Y   N  R  A+   E   S  +LG  +  V+ 
Sbjct: 1143 VTIRGYGQQKRFSQINQCRVDNNMSAFYPSVNANRWLAY-RLELIGSIIILGAATLSVMR 1201

Query: 352  LYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISS 411
            L       QG+LT G +   + Y      S+  +     E+   + +  R+ +  D  S 
Sbjct: 1202 LK------QGTLTAGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYADLKSE 1255

Query: 412  ----ISPTKGQKYIPGKGDIEFKNVSFSYPTRPE-NQIFKDINIKVPPGSNVCIVGPSGR 466
                I   + Q+  P +GDI+F++ S  Y  RPE + + KDIN  + P   + IVG +G 
Sbjct: 1256 APEIIEDHRPQETWPEEGDIKFEHYSTRY--RPELDLVLKDINFHIKPKEKIGIVGRTGA 1313

Query: 467  GKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYG 526
            GKS++ L L R    + G I++D  DIS +    LR  + ++ Q+  +  GTIR+NI   
Sbjct: 1314 GKSSLTLALFRIIEASEGNIIIDNVDISDIGLYDLRHKLSIIPQDSQVFEGTIRENI--- 1370

Query: 527  LAEPA---TKEEIRSVAKQCFCHNFI-TKFPDGYDTMIGAQGALLSGGQRQRIAIARALI 582
              +P    T E+I  V +     + I T   DG DT +   G+ LS GQRQ + +ARAL+
Sbjct: 1371 --DPTNQYTDEQIWRVLELSHLRDHIATMGGDGLDTKLNEGGSNLSVGQRQLMCLARALL 1428

Query: 583  KKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKD 642
                ILVLDEAT+A+DVE++  +  T     K    TI++IAHR++TI  ++ ++VL  +
Sbjct: 1429 VPSKILVLDEATAAVDVETDKVLQETIRTSFK--DRTILTIAHRINTIMDNDRIMVL-DN 1485

Query: 643  GSVIEAGKFKELFANPNSELCKLLTE 668
            GS+ E  + K+L  N +S    L  E
Sbjct: 1486 GSIKEFDEPKKLLENKSSLFYSLCEE 1511

 Score =  103 bits (257), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 106/427 (24%), Positives = 193/427 (45%), Gaps = 42/427 (9%)

Query: 276 TSKDLQEATGQL----TRVAEEQLSGVKTVQSFVAE-----QRELHRYNGAIRGIYNVGR 326
           T K LQ++  Q     TRV  E L+ +K+++ +  E     + E  R N  ++ +  +G 
Sbjct: 467 TQKKLQKSQMQFKDERTRVISEILNNIKSLKLYAWETPYKAKLENVRNNKELKNLTKLGC 526

Query: 327 KAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLT 386
             A ++ +F      L   S   V +Y     L   L    LT F L        +  + 
Sbjct: 527 YMALMSFQF-NVVPFLVSCSTFAVFVYTEDRPLTTDLVFPALTLFNLL----HFPLMVIP 581

Query: 387 TFYSELMQGVGAASRLFD-LTDHISSISPTKGQKYIPGKGDIEFK---NVSFSYPTRPEN 442
              + L++   +  RLF  LT+        +    +   GD+      + +F +  +PE 
Sbjct: 582 NVLTALIECSVSVGRLFSFLTNEELQKDSVQRLPKVTEIGDVAINVGDDATFLWQRKPEY 641

Query: 443 QI-FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVN-CKT 500
           ++  K++N +   G   CIVG  G GKS +   +L               D+ +V    T
Sbjct: 642 KVALKNVNFQAKKGELTCIVGRVGSGKSALIQSIL--------------GDLFRVKGFAT 687

Query: 501 LRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMI 560
           +  ++  V Q   +M+GT++DNI +G    A  E      K C     ++   DG  T++
Sbjct: 688 IHGNVAYVSQVAWIMNGTVKDNILFGHKYDA--EFYEKTIKACALTIDLSVLVDGDQTLV 745

Query: 561 GAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSMT 619
           G +G  LSGGQ+ R+++ARA+  + +  +LD+  +A+D   +   I +  G      + T
Sbjct: 746 GEKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKT 805

Query: 620 IVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSL 679
            V   +++S +  +++V +L ++G +++ G + E+  +  S+L KL+ E   +S+GN   
Sbjct: 806 KVLATNKVSVLSVADSVSLL-ENGEIVQQGSYDEIMKDGASQLNKLIMEYGKKSNGN--- 861

Query: 680 PPPPPNA 686
            P   NA
Sbjct: 862 -PASSNA 867

>SAKL0H16016g Chr8 (1396707..1401206) [4500 bp, 1499 aa] {ON} similar
            to uniprot|P39109 Saccharomyces cerevisiae YDR135C
          Length = 1499

 Score =  161 bits (408), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 145/505 (28%), Positives = 236/505 (46%), Gaps = 46/505 (9%)

Query: 184  LRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGM 243
            L   + +  L     F++T  +G +++R  +D Y V   + +  S  F  ++     I +
Sbjct: 1010 LHDAMASSVLRAPMSFFETTPIGRILNRFSNDIYKVDELLGRTFSQFFVNVVKVTFTIVV 1069

Query: 244  MVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVA-----EEQLSGV 298
            + + + +   V+L    P+      + +    TS++L+     +TR       +E L GV
Sbjct: 1070 ICTSTWQFILVVL----PLSVLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGV 1124

Query: 299  KTVQSFVAEQRELH----RYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVL 351
             T++ +  ++R  H    R +  +   Y   N  R  AF   EF  S  +LG  +  V  
Sbjct: 1125 STIRGYGQQKRFAHINQARIDNNMSAFYPAVNANRWLAF-RLEFLGSIIILGAATLSV-- 1181

Query: 352  LYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDH--- 408
                + + QG+LT G +   + Y      S+  +     E+   + +  R+ +  +    
Sbjct: 1182 ----FRLKQGTLTAGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKPE 1237

Query: 409  ----ISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQ-IFKDINIKVPPGSNVCIVGP 463
                I S  P KG    P +GDI F++ S  Y  RPE Q I +D+N+ +     V IVG 
Sbjct: 1238 APAIIESSRPPKGW---PSQGDIRFEHYSTRY--RPELQLILRDVNLHIKAREKVGIVGR 1292

Query: 464  SGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNI 523
            +G GKS++ L L R      G I +DG     +    LR  + ++ Q+  + +GT+R+N+
Sbjct: 1293 TGAGKSSLTLALFRIIEAAEGHIFIDGLSTDTIGLADLRHKLSIIPQDSQVFAGTLRENV 1352

Query: 524  TYGLAEPATKEEIRSVAKQCFCHNFITKF-PDGYDTMIGAQGALLSGGQRQRIAIARALI 582
                 E  T EEI    +       +     DG  TM+   G+ LS GQRQ + +ARAL+
Sbjct: 1353 --DPTEEFTDEEIWHALELSHLKEHVMSMGNDGLQTMLTECGSNLSVGQRQLLCLARALL 1410

Query: 583  KKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKD 642
                ILVLDEAT+A+DVE++  I  T     K  + TI++IAHR++TI  S+ +IVL  +
Sbjct: 1411 IPSKILVLDEATAAVDVETDRVIQETIRTAFK--NRTILTIAHRINTIMDSDKIIVLN-E 1467

Query: 643  GSVIEAGKFKELFANPNS---ELCK 664
            G V E    + L   P+S    LCK
Sbjct: 1468 GQVAEFDTPENLLQRPDSLFYSLCK 1492

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 103/446 (23%), Positives = 209/446 (46%), Gaps = 50/446 (11%)

Query: 236 CGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQL 295
           C  VG+ +MV + P ++ +++ +   +        +KI+  +KD      + TRV  E L
Sbjct: 438 CMWVGVIIMVVMIP-INSIIMKYQKNL--------QKIQMKNKD------ERTRVISEIL 482

Query: 296 SGVKTVQSFVAE-----QRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVV 350
           + +K+++ +  E     + +  R    ++ +  +G   A  + +F     ++   +F V 
Sbjct: 483 NNIKSLKLYAWEVPYKKKLDYVRNEKELKNLTKMGCTLALASFQFNIVPFLVSCSTFAVF 542

Query: 351 LLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFD-LTDHI 409
           ++      L   L    LT F L +         +T+F    ++   + +RL   LT+  
Sbjct: 543 VMTQKGRALTTDLVFPALTLFNLLSFPLAVVPNAITSF----IEASVSVNRLHSFLTNEE 598

Query: 410 SSISPTKGQKYIPGKGDIEFK---NVSFSYPTRPENQI-FKDINIKVPPGSNVCIVGPSG 465
                   +  +  KGDI  K   + +F +  +PE ++  K+IN +   G   CIVG  G
Sbjct: 599 LQKDSVSREPSVTSKGDIAVKVGGDATFLWQRKPEYKVALKNINFQAKKGELTCIVGRVG 658

Query: 466 RGKSTIALLLLRYYNPTNGQILVDGQDISKVN-CKTLRRHIGLVQQEPILMSGTIRDNIT 524
            GKS +   +L               D+ +V    T+   +  V Q P +M+GT+++NI 
Sbjct: 659 SGKSALIQSIL--------------GDLFRVKGFATIHGSVAYVSQIPWIMNGTVKENIL 704

Query: 525 YGLA-EPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIK 583
           +G   +P+  E+     K C  +  ++  P G  T++G +G  LSGGQ+ R+++ARA+  
Sbjct: 705 FGHKYDPSFYEK---TVKACALNVDLSILPQGDQTLVGEKGISLSGGQKARLSLARAVYS 761

Query: 584 KPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKD 642
           + +  +LD+  +A+D   ++  ++   G      S T V   ++++ +  ++++ +L ++
Sbjct: 762 RADTYLLDDPLAAVDEHVAKHLVDNVLGVTGLLHSKTKVLATNKITVLSIADSIALL-EN 820

Query: 643 GSVIEAGKFKELFANPNSELCKLLTE 668
           G +++ G + E+  +  S L KL+ E
Sbjct: 821 GEIVQQGSYDEVVRDDGSALSKLIHE 846

>KAFR0B05630 Chr2 complement(1156621..1161168) [4548 bp, 1515 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1515

 Score =  160 bits (404), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 138/491 (28%), Positives = 233/491 (47%), Gaps = 43/491 (8%)

Query: 199  FYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFF 258
            F++T  +G +++R  +D Y +   + +  S  F       V +  ++++    +   +F 
Sbjct: 1039 FFETTPIGRILNRFSNDIYKIDSILGRTFSQFF----VNAVKVVFVMAVICATTWQFIFV 1094

Query: 259  APPILWSASVFGKKIRHTSKDLQEATGQLTRVA-----EEQLSGVKTVQSFVAEQRELH- 312
              P+      + +    TS++L+     +TR       +E L G+ T++ +  E+R  H 
Sbjct: 1095 IIPLGVFYIYYQQYYLRTSRELRRL-DSITRSPVYSHFQETLGGITTIRGYNQEKRFGHI 1153

Query: 313  ---RYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIG 366
               R +  +   Y   N  R  AF   E   S  +LG  +  +      + + +G+LT G
Sbjct: 1154 NQCRVDNNMSAFYPSINANRWLAF-RLELIGSIIILGAATLSI------FRLKEGTLTPG 1206

Query: 367  DLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISS----ISPTKGQKYIP 422
             +   + Y      ++  +     E+   + +  R+ +     S     +   +  +  P
Sbjct: 1207 MVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERVKEYAQLESEAPRIVEEKRPDEMWP 1266

Query: 423  GKGDIEFKNVSFSYPTRPE-NQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNP 481
             +GDI+F+N S  Y  RPE + + K+IN+ + P   V IVG +G GKS++ L L R    
Sbjct: 1267 TEGDIKFENYSTRY--RPELDLVLKNINVHIRPTEKVGIVGRTGAGKSSLTLALFRIIEA 1324

Query: 482  TNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPA---TKEEIRS 538
            T G I++DG  I+++    LR  + ++ Q+  +  GT+R+NI     +P    T EEI  
Sbjct: 1325 TAGNIIIDGIPINEIGLYDLRHKLSIIPQDSQVFEGTLRENI-----DPTNLFTDEEIWR 1379

Query: 539  VAKQCFCHNFITKF-PDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSAL 597
            V +       +     DG D  +   G+ LS GQRQ + +ARAL+    ILVLDEAT+A+
Sbjct: 1380 VLELSHLKEHVLSMGADGLDVQLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAV 1439

Query: 598  DVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFAN 657
            DVE++  +  T     K    TI++IAHRL+TI  S+ +IVL K G ++E     EL A 
Sbjct: 1440 DVETDKIVQETIRTAFK--DRTILTIAHRLNTIMDSDRIIVLDK-GEIVEFDTPDELLAK 1496

Query: 658  PNSELCKLLTE 668
            P S    L  E
Sbjct: 1497 PESLFYSLCNE 1507

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 71/267 (26%), Positives = 137/267 (51%), Gaps = 26/267 (9%)

Query: 421 IPGKGDIEFK---NVSFSYPTRPENQI-FKDINIKVPPGSNVCIVGPSGRGKSTIALLLL 476
           +  KGD+      N +F +  +PE ++  K+IN +   G   CIVG  G GKS +   +L
Sbjct: 615 VENKGDVAINLGDNATFLWKRKPEYKVALKNINFQAKKGDLTCIVGKVGSGKSALIQSIL 674

Query: 477 RYYNPTNGQILVDGQDISKVN-CKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEE 535
                          D+ +V    T+  ++  V Q P +M+GT+++NI +G      +E 
Sbjct: 675 --------------GDLFRVKGFATVHGNVAYVSQVPWIMNGTVKENILFG--HKYDQEF 718

Query: 536 IRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATS 595
                K C     +    DG  T++G +G  LSGGQ+ R+++ARA+  + +  +LD+  +
Sbjct: 719 YEKTIKACALTIDLGILVDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTYLLDDPLA 778

Query: 596 ALDVE-SEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKEL 654
           A+D   S+  + +  G      S T V   +++S +  ++++ +L ++G +++ G ++E+
Sbjct: 779 AVDEHVSKHLVEHVLGPTGLLHSKTKVLCTNKISVLSIADSITLL-ENGEIVQQGSYEEV 837

Query: 655 FANPNSELCKLLTE---KSSRSDGNDS 678
            ++ +S L KL+ E   K ++S G+ +
Sbjct: 838 NSDEDSPLFKLIKEYGRKENKSKGSST 864

>Smik_4.380 Chr4 complement(684148..688698) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  159 bits (402), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 136/494 (27%), Positives = 233/494 (47%), Gaps = 35/494 (7%)

Query: 184  LRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGM 243
            L + + N  L     F++T  +G +++R  +D Y V   + +  S  F       V +  
Sbjct: 1026 LHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQFF----VNAVKVTF 1081

Query: 244  MVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVA-----EEQLSGV 298
             +++    +   +F   P+      + +    TS++L+     +TR       +E L G+
Sbjct: 1082 TITVICATTWQFIFIIIPLGVFYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGL 1140

Query: 299  KTVQSFVAEQRELH----RYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVL 351
             TV+ +  ++R  H    R +  +   Y   N  R  A+   E   S  +LG  +  V  
Sbjct: 1141 ATVRGYSQQKRFSHINQCRIDNNMSAFYPSINANRWLAY-RLELIGSIIILGAATLSV-- 1197

Query: 352  LYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISS 411
                + + QG+LT G +   + Y      ++  +     E+   + +  R+ +  D  S 
Sbjct: 1198 ----FRLKQGTLTSGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYADLKSE 1253

Query: 412  ----ISPTKGQKYIPGKGDIEFKNVSFSYPTRPE-NQIFKDINIKVPPGSNVCIVGPSGR 466
                I   +  K  P +GDI F N S  Y  RPE + + K INI + P   V IVG +G 
Sbjct: 1254 APLIIEGHRPPKQWPAQGDIRFNNYSTRY--RPELDLVLKQINIHIKPNEKVGIVGRTGA 1311

Query: 467  GKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYG 526
            GKS++ L L R    + G I++DG  I+++    LR  + ++ Q+  +  GT+R+NI   
Sbjct: 1312 GKSSLTLALFRMIEASEGNIVIDGVSINEIGLYDLRHKLSIIPQDSQVFEGTVRENID-P 1370

Query: 527  LAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPN 586
            + + + +   R++       + ++   DG D  +   G+ LS GQRQ + +ARA++    
Sbjct: 1371 INQYSDEAIWRALELSHLKEHVLSMSNDGLDAQLSEGGSNLSVGQRQLLCLARAMLVPSK 1430

Query: 587  ILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVI 646
            ILVLDEAT+A+DVE++  +  T     K    TI++IAHRL+TI  S+ +IVL  +G V 
Sbjct: 1431 ILVLDEATAAVDVETDKVVQETIRTAFK--DRTILTIAHRLNTIMDSDRIIVL-DNGKVA 1487

Query: 647  EAGKFKELFANPNS 660
            E     +L +N  S
Sbjct: 1488 EFDTPGQLLSNSKS 1501

 Score = 94.4 bits (233), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 94/403 (23%), Positives = 181/403 (44%), Gaps = 34/403 (8%)

Query: 288 TRVAEEQLSGVKTVQSFVAEQ-----RELHRYNGAIRGIYNVGRKAAFINAEFFTSTTML 342
           TRV  E L+ +K+++ +  E+      E  R N  ++ +  +G   A  + +F     ++
Sbjct: 485 TRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLV 544

Query: 343 GDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL 402
              +F  V +Y     L   L    LT F L +      +  +    +  ++   +  RL
Sbjct: 545 SCCTF-AVFVYTEDRALTTDLVFPALTLFNLLS----FPLMIIPMVLNSFIEASVSIGRL 599

Query: 403 FDLTDHISSISPTKGQKY--IPGKGDIEFK---NVSFSYPTRPENQI-FKDINIKVPPGS 456
           F    +   + P   Q+   +   GDI      + +F +  +PE ++  K+I+ +   G+
Sbjct: 600 FSFFTN-EELQPDSVQRLPNVENIGDIAINIGDDATFLWQRKPEYKVALKNIDFQATKGN 658

Query: 457 NVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMS 516
             CIVG  G GK+ +   +L       G   V G       C      I  V Q P +M+
Sbjct: 659 LTCIVGKVGSGKTALLSCMLGDLFRVKGFATVHG-------C------IAYVSQVPWIMN 705

Query: 517 GTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIA 576
           GT+++NI +G    A  E      K C     +    DG  T++G +G  LSGGQ+ R++
Sbjct: 706 GTVKENILFGHKYDA--EFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLS 763

Query: 577 IARALIKKPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSEN 635
           +ARA+  + +  +LD+  +A+D   +   I +  G      + T +   +++S +  +++
Sbjct: 764 LARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTRILATNKVSALSIADS 823

Query: 636 VIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDS 678
           + +L  +G +I+ G + ++  + +S L KLL +   +++   S
Sbjct: 824 IALL-DNGEIIQQGAYSDITKDADSPLWKLLNDYGKKNNNKQS 865

>Suva_2.297 Chr2 complement(518369..522919) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  159 bits (401), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 141/517 (27%), Positives = 243/517 (47%), Gaps = 37/517 (7%)

Query: 170  IVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSD 229
            IV+    +      L + + N  L     F++T  +G +++R  +D Y V   + +  S 
Sbjct: 1012 IVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQ 1071

Query: 230  GFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTR 289
             F       V +   +++    +   +F   P+      + +    TS++L+     +TR
Sbjct: 1072 FF----VNAVKVTFTITVICVTTWQFIFIIVPLGVFYIYYQQYYLRTSRELRR-LDSITR 1126

Query: 290  VA-----EEQLSGVKTVQSFVAEQRELH----RYNGAIRGIY---NVGRKAAFINAEFFT 337
                   +E L G+ TV+ +  ++R  H    R +  +   Y   N  R  A+   E   
Sbjct: 1127 SPIYSHFQETLGGLATVRGYSQQKRFSHINQCRIDNNMSAFYPSVNANRWLAY-RLELIG 1185

Query: 338  STTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVG 397
            S  +LG  +  V      + + QG+LT G +   + Y      ++  +     E+   + 
Sbjct: 1186 SVIILGAATLSV------FRLKQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIV 1239

Query: 398  AASRLFDLTDHISSISP--TKGQ---KYIPGKGDIEFKNVSFSYPTRPE-NQIFKDINIK 451
            +  R+ +  D I S +P   +G    K  PG+GDI+F   S  Y  RPE + + K I+I 
Sbjct: 1240 SVERIKEYAD-IKSEAPLVIEGHRPPKEWPGQGDIKFNQYSTRY--RPELDLVLKQIDIH 1296

Query: 452  VPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQE 511
            + P   + IVG +G GKS++ L L R    + G I++DG  I+++    LR  + ++ Q+
Sbjct: 1297 IKPKEKIGIVGRTGAGKSSLTLALFRIIEASAGNIVIDGIPINEIGLYDLRHKLSIIPQD 1356

Query: 512  PILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQ 571
              +  GT+R+NI   + +   +   R++       + ++   DG D+ +   G+ LS GQ
Sbjct: 1357 SQVFEGTVRENID-PINQYTDEAMWRALELSHLKEHILSMSNDGLDSQLTEGGSNLSVGQ 1415

Query: 572  RQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIK 631
            RQ + +ARA++ +  ILVLDEAT+A+DVE++  I  T     K    TI++IAHRL+TI 
Sbjct: 1416 RQLLCLARAMLVQSKILVLDEATAAVDVETDKVIQETIRTAFK--DRTILTIAHRLNTIM 1473

Query: 632  RSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTE 668
             S+ +IVL  +G V E     +L  N  S    L  E
Sbjct: 1474 DSDRIIVL-DNGKVAEFDSPAQLLTNTKSLFYSLCAE 1509

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 92/400 (23%), Positives = 183/400 (45%), Gaps = 36/400 (9%)

Query: 288 TRVAEEQLSGVKTVQSFVAEQ-----RELHRYNGAIRGIYNVGRKAAFINAEFFTSTTML 342
           TRV  E L+ +K+++ +  E+      E  R N  +  +  +G   A  + +F     ++
Sbjct: 485 TRVISEILNNIKSLKLYAWEKPYREKLEDVRNNKELNNLTKLGCYMAVTSFQFNIVPFLV 544

Query: 343 GDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL 402
              +F  V +Y     L   L    LT F L +      +  +    +  ++   +  RL
Sbjct: 545 SCCTF-AVFVYTEDRALTTDLVFPALTLFNLLS----FPLMIIPMVLNSFIEASVSIGRL 599

Query: 403 FDLTDHISSISPTKGQKY--IPGKGDIEFK---NVSFSYPTRPENQI-FKDINIKVPPGS 456
           F    +   + P   Q+   +   GDI      + +F +  +PE ++  K+IN +   G 
Sbjct: 600 FSFFTN-EELQPDSVQRLPKVENVGDIAINIGDDATFLWQRKPEYKVALKNINFQAKKGE 658

Query: 457 NVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVN-CKTLRRHIGLVQQEPILM 515
             C+VG  G GK+  ALL     + T G       D+ +V    ++   +  V Q P +M
Sbjct: 659 LTCVVGKVGSGKT--ALL-----SSTLG-------DLFRVKGFASVHGSVAYVSQVPWIM 704

Query: 516 SGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRI 575
           +GT+++NI +G    A  E      K C     +    DG  T++G +G  LSGGQ+ R+
Sbjct: 705 NGTVKENILFGHKYDA--EFYEKTIKACALTIDLAILMDGDQTLVGEKGISLSGGQKARL 762

Query: 576 AIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSE 634
           ++ARA+  + +  +LD+  +A+D   +   + +  G      + T +   +++S +  ++
Sbjct: 763 SLARAVYSRADTYLLDDPLAAVDEHVARHLVEHVLGSNGLLHTKTKLLATNKVSALSVAD 822

Query: 635 NVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSD 674
           ++ +L  +G +I+ G + ++  + +S L KL+ +   +++
Sbjct: 823 SIALL-DNGEIIQQGTYDDITKDADSPLWKLIKDYGKKNN 861

>KNAG0E01120 Chr5 (214592..219745) [5154 bp, 1717 aa] {ON} Anc_4.6
            YHL035C
          Length = 1717

 Score =  159 bits (401), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 146/531 (27%), Positives = 243/531 (45%), Gaps = 79/531 (14%)

Query: 183  RLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIG 242
            ++ + ++NK +H    F+DT  +G +++R   D   V + +T  ++  F + +     I 
Sbjct: 1193 KIFAMLLNKVIHSKLRFFDTTPIGRIMNRFSKDIESVDQELTPYLTGAFYSFVECFSTII 1252

Query: 243  MMVSISPELSGVLLFFAPPILWSASVF--GKKIRHTSKDLQE----ATGQLTRVAEEQLS 296
            ++  I+P+      FF   IL S   +  G      S++L+         + +   E L 
Sbjct: 1253 LISWITPQ------FFVVAILISIMYYLVGYFYMAGSRELKRLDSITKSPIYQHFSETLV 1306

Query: 297  GVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSY 356
            GV T+++F  E R L         ++ +       N  FF        +SF + ++ GS+
Sbjct: 1307 GVTTIRAFGDEMRFLKE------NLFKIDEN----NKPFFYLWVANRWLSFRIDMI-GSF 1355

Query: 357  LVL-QGSLTIGD------------LTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL- 402
            +V   G   + D            LT  + +TE        L  FYSE+   + +  R+ 
Sbjct: 1356 VVFGAGVFILADIKNIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERIK 1411

Query: 403  ---------FDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVP 453
                     +D+ D I    PT      P +G IE  ++S  Y      ++ K+++  V 
Sbjct: 1412 EYMSVEQEPYDIKDEIVRTPPTVW----PDEGKIEVNDLSLRYAANLP-RVIKNVSFTVE 1466

Query: 454  PGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPI 513
            P S V +VG +G GKSTI   L R+ +P +G I +D  DI+ +    LRR I ++ Q+P 
Sbjct: 1467 PNSKVGVVGRTGAGKSTIITALFRFLDPESGYIKIDNMDITTIPLTRLRRAITIIPQDPT 1526

Query: 514  LMSGTIRDNI----TYG-------------LAEPATKEEIRSVAKQCFCH-NFITKFPDG 555
            L +GT++ N+     Y              ++      E  +V+ Q   H N   +F D 
Sbjct: 1527 LFAGTLKFNLDPYDEYNDKDIFAALTRVNLVSGEELNGETTAVSDQGSMHSNNENRFLD- 1585

Query: 556  YDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTF-GQLMK 614
                I   G  LS GQRQ I +AR+L++ P IL+LDEAT+++D ES+  +  T  G+   
Sbjct: 1586 LSNEITEGGGNLSQGQRQLICLARSLLRNPKILLLDEATASIDYESDARLQATIRGEF-- 1643

Query: 615  SGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKL 665
             G+ TI++IAHRL ++   + ++V+   G VIE      L  N NSE  K+
Sbjct: 1644 -GNSTILTIAHRLRSVIDYDKILVMDA-GEVIEYDHPYSLLLNRNSEFYKM 1692

 Score = 83.6 bits (205), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 108/234 (46%), Gaps = 9/234 (3%)

Query: 427 IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI 486
           + F N + S+ T       +++NI    G    ++G +G GK+++ + LL   +   G+I
Sbjct: 759 LAFDNSTTSWDTNGSGFKLRNLNIDFKVGKLNVVIGATGSGKTSLLMALLGEMHICQGRI 818

Query: 487 LV---DGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQC 543
           +V   + +     N       I    Q   L++ T+R+NI +       +     V + C
Sbjct: 819 IVPSLEPRSSLTANSDGFTNSIAYCSQAAWLLNDTVRNNILFN--SSFDENRYHKVVEAC 876

Query: 544 FCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEG 603
                      G  T IG +G  LSGGQ+QRI++ARAL      L+LD+  SA+D  +  
Sbjct: 877 GLKRDFDILKAGDLTEIGEKGITLSGGQKQRISLARALYSDSKHLLLDDCLSAVDSHTAS 936

Query: 604 AI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELF 655
            I  N   G LM   +  +VS  H ++   R+  ++V+ +DG V + G    LF
Sbjct: 937 WIYDNCITGPLMVGRTCILVS--HNIALTLRNAELVVILEDGRVKDQGDPLNLF 988

>Skud_4.395 Chr4 complement(694806..699356) [4551 bp, 1516 aa] {ON}
            YDR135C (REAL)
          Length = 1516

 Score =  157 bits (396), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 139/507 (27%), Positives = 239/507 (47%), Gaps = 45/507 (8%)

Query: 184  LRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGM 243
            L + + N  L     F++T  +G +++R  +D Y V   + +  S  F       V +  
Sbjct: 1026 LHNLMANSVLRAPMAFFETTPIGRILNRFSNDIYKVDALLGRTFSQFF----VNAVKVIF 1081

Query: 244  MVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVA-----EEQLSGV 298
             +++    +   +F   P+      + +    TS++L+     +TR       +E L G+
Sbjct: 1082 TITVICATTWQFIFIIIPLGVCYIYYQQYYLRTSRELRR-LDSITRSPIYSHFQETLGGL 1140

Query: 299  KTVQSFVAEQRELH----RYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVL 351
             TV+ +  ++R  H    R +  +   Y   N  R  A+   E   S  +LG  +  V  
Sbjct: 1141 ATVRGYSQQKRFSHINQCRIDNNMSAFYPSINANRWLAY-RLELIGSIIILGAATLSV-- 1197

Query: 352  LYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISS 411
                + + QG+LT G     + Y      ++  +     E+   + +  R+ +  D + S
Sbjct: 1198 ----FRLKQGTLTAGMAGISLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYAD-LKS 1252

Query: 412  ISPTKGQKYIPGK-----GDIEFKNVSFSYPTRPE-NQIFKDINIKVPPGSNVCIVGPSG 465
             +P   + ++P K     GDI+F N S  Y  RPE + + K INI + P   + IVG +G
Sbjct: 1253 EAPLTIEGHMPPKEWPSQGDIKFNNYSTRY--RPELDLVLKHINIHIKPNEKIGIVGRTG 1310

Query: 466  RGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITY 525
             GKS++ L L R    + G I++DG  I+++    LR  + ++ Q+  +  G++R+NI  
Sbjct: 1311 AGKSSLTLALFRMIEASAGNIVIDGIAINEIGLYDLRHRLSIIPQDSQVFEGSLRENI-- 1368

Query: 526  GLAEPA---TKEEI-RSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARAL 581
               +P    T E I R++       + ++   DG D  +   G  LS GQRQ + +ARA+
Sbjct: 1369 ---DPTNQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNLSVGQRQLLCLARAM 1425

Query: 582  IKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGK 641
            +    IL+LDEAT+A+DVE++  +  T     K    TI++IAHRL+TI  S+ +IVL  
Sbjct: 1426 LVPSKILILDEATAAVDVETDKVVQETIRTAFK--DRTILTIAHRLNTIMDSDRIIVL-D 1482

Query: 642  DGSVIEAGKFKELFANPNSELCKLLTE 668
            +G+V E     +L +N  S    L  E
Sbjct: 1483 NGTVAEFDSPSQLLSNSESLFHSLCAE 1509

 Score = 92.8 bits (229), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 95/408 (23%), Positives = 179/408 (43%), Gaps = 39/408 (9%)

Query: 288 TRVAEEQLSGVKTVQSFVAEQ-----RELHRYNGAIRGIYNVGRKAAFINAEFFTSTTML 342
           TRV  E L+ +K+++ +  E+      E  R N  ++ +  +G   A  + +F     ++
Sbjct: 485 TRVISEILNNIKSLKLYAWEKPYREKLEDIRNNKELKNLTRLGCYMAVTSFQFNIVPFLV 544

Query: 343 GDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL 402
              +F  V +Y     L   L    LT F L +      +  +    +  ++   +  RL
Sbjct: 545 SCCTF-AVFVYTEDRALTTDLVFPALTLFNLLS----FPLMIIPMVLNSFIEASVSIGRL 599

Query: 403 FDLTDHISSISPTKGQKY--IPGKGDIEFK---NVSFSYPTRPENQI-FKDINIKVPPGS 456
           F    +   + P   Q+   +   GD+      + +F +  +PE ++  K+IN +   G 
Sbjct: 600 FTFFTN-EELQPDSVQRLPKVENFGDVAINVGDDATFLWQRKPEYKVALKNINFQAKKGE 658

Query: 457 NVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMS 516
             C+VG  G GK+ +   +L       G   V G              +  V Q P +M+
Sbjct: 659 LTCVVGKVGSGKTALLSCMLGDLFRVKGFATVHGS-------------VAYVSQVPWIMN 705

Query: 517 GTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIA 576
           GT+ +NI +G       E      K C     +    DG  T++G +G  LSGGQ+ R++
Sbjct: 706 GTVMENILFG--HKYDVEFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARLS 763

Query: 577 IARALIKKPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSEN 635
           +ARA+  + +  +LD+  +A+D   +   I +  G      + T +   +++S +  +++
Sbjct: 764 LARAVYSRADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTRLLATNKVSALSIADS 823

Query: 636 VIVLGKDGSVIEAGKFKELFANPNSELCKLLTE-----KSSRSDGNDS 678
           V +L  +G +I+ G + E+  + +S L KLL +      + R+D  DS
Sbjct: 824 VALL-DNGEIIQKGTYDEITKDADSPLWKLLNDYGKKNNNKRNDSGDS 870

>NCAS0B03470 Chr2 complement(606008..610546) [4539 bp, 1512 aa] {ON}
            Anc_8.303
          Length = 1512

 Score =  156 bits (394), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 134/487 (27%), Positives = 231/487 (47%), Gaps = 35/487 (7%)

Query: 199  FYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFF 258
            F++T  +G +++R  +D Y V   + +  S  F       V +   + +    +   +F 
Sbjct: 1038 FFETTPIGRILNRFSNDVYKVDSVLGRTFSQFF----VNAVKVSFTIIVICFTTWQFIFI 1093

Query: 259  APPILWSASVFGKKIRHTSKDLQE----ATGQLTRVAEEQLSGVKTVQSFVAEQRELH-- 312
              P+      + +    TS++L+         +    +E L G+ T++ +  + R  H  
Sbjct: 1094 IIPLGVFYIYYQQYFLRTSRELRRLDSITKSPIFSHFQETLGGITTIRGYQQQHRFTHIN 1153

Query: 313  --RYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGD 367
              R +  +   Y   N  R  A+   E   S  +LG  +  V      + + QG+LT G 
Sbjct: 1154 QCRVDNNMSAFYPSVNANRWLAY-RLETIGSLIILGAATLSV------FRLRQGTLTAGM 1206

Query: 368  LTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISS----ISPTKGQKYIPG 423
            +   + Y      S+  +     E+   + +  R+ + +D  S     I   +  +  P 
Sbjct: 1207 VGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSDLKSEAPAVIEDHRPAETWPD 1266

Query: 424  KGDIEFKNVSFSYPTRPE-NQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPT 482
            +GDI+F++ S  Y  RPE + I KDIN+ + P   V IVG +G GKS++ L L R    +
Sbjct: 1267 EGDIKFEHYSTRY--RPELDLILKDINVHIKPKEKVGIVGRTGAGKSSLTLALFRIIEAS 1324

Query: 483  NGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQ 542
            +G+I++D   I+++    LR  + ++ Q+  +  GT+R+NI        T E+I +V   
Sbjct: 1325 SGRIVIDNVPINEIGLYDLRHKLSIIPQDSQVFEGTVRENI--DPTNEYTDEQIWNVLAL 1382

Query: 543  CFCHNFITKFPD-GYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVES 601
                + I    D G +  +   G  LS GQRQ + +ARAL+    IL+LDEAT+A+DVE+
Sbjct: 1383 SHLKDHIISMGDEGLNNQLTEGGNNLSVGQRQLLCLARALLVPSKILLLDEATAAVDVET 1442

Query: 602  EGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSE 661
            +  I  T     K    TI++IAHR++TI  S+ +IVL  +G++ E    ++L  NP+S 
Sbjct: 1443 DKVIQETIRTAFK--DRTILTIAHRINTIMDSDRIIVL-DNGTIKEFDSPEKLLENPSSL 1499

Query: 662  LCKLLTE 668
               L  E
Sbjct: 1500 FYSLCQE 1506

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 120/527 (22%), Positives = 235/527 (44%), Gaps = 45/527 (8%)

Query: 184 LRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKV----SDGFKALICGGV 239
           L S +  K L   +E   T   GD+++ +  D   + + M Q +    S  F+ ++C  V
Sbjct: 378 LTSVIYQKALVLSNEASATSSTGDIVNLMSVDVQKL-QDMCQFIQLLWSAPFQVILCL-V 435

Query: 240 GIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVK 299
            +  ++  S  +  ++L    PI        KK++ +    ++   + TRV  E L+ +K
Sbjct: 436 SLYKLLGKSMWVGVLILVIMIPINSYLVRVQKKLQKSQMTYKD---ERTRVISEMLNNIK 492

Query: 300 TVQSFVAE-----QRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYG 354
           +++ +  E     + E  R N  ++ +  +G   A ++ +F     ++   +F    +Y 
Sbjct: 493 SLKLYAWEVPYRQKLENVRNNKELKNLTKLGCYMALMSFQFNVVPFLVSCCTF-AAFIYT 551

Query: 355 SYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFD-LTDHISSIS 413
               L   L    LT F L   +    +  + T   E    +G   RLF  LT+      
Sbjct: 552 ENRPLTTDLVFPALTLFNL-LHFPLMVIPNVLTMIIETSVSIG---RLFSFLTNEELQKD 607

Query: 414 PTKGQKYIPGKGDIEFK---NVSFSYPTRPENQI-FKDINIKVPPGSNVCIVGPSGRGKS 469
             +    +   GD+      + +F +  +PE ++  K+IN +   G   CIVG  G GKS
Sbjct: 608 AVQRLPKVTNIGDVAINVGDDATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKS 667

Query: 470 TIALLLLRYYNPTNGQILVDGQDISKVN-CKTLRRHIGLVQQEPILMSGTIRDNITYGLA 528
            +   +L               D+ +V    T+  ++  V Q   +M+GT+++NI +G  
Sbjct: 668 AMIQSIL--------------GDLFRVKGFATIHGNVAYVSQVAWIMNGTVKENILFG-- 711

Query: 529 EPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNIL 588
               ++  +   K C     +    DG  T++G +G  LSGGQ+ R+++ARA+  + +  
Sbjct: 712 HKYDEDFYQKTIKACALTIDLAVLMDGDQTLVGEKGISLSGGQKARLSLARAVYSRADTY 771

Query: 589 VLDEATSALDVE-SEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIE 647
           +LD+  +A+D   +   + +  G      + T V   +++S +  +++V +L ++G +++
Sbjct: 772 LLDDPLAAVDEHVARHLVEHVLGPNGLLHTKTKVLATNKVSVLSIADSVSLL-ENGEIVQ 830

Query: 648 AGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPPPNATQDKVVEQ 694
            G + E+  + +S L KL+TE   +S   DS     P+ +   + EQ
Sbjct: 831 QGTYDEIMKDDSSPLSKLITEYGKKS--TDSTSNVTPSTSSSNIHEQ 875

>Smik_12.48 Chr12 (103624..108297) [4674 bp, 1557 aa] {ON} YLL015W
            (REAL)
          Length = 1557

 Score =  155 bits (391), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 142/521 (27%), Positives = 240/521 (46%), Gaps = 28/521 (5%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQ 225
            N   I+ML   S R   +L   +    +     F++T  VG +I+R  SD   V  S+  
Sbjct: 1036 NLRSIMMLLYCSIRGSKKLHESMAKSVIKSPMIFFETTPVGRIINRFSSDMDAVDSSLQY 1095

Query: 226  KVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATG 285
              S  FK+++   V + ++    P      +F     ++  + +    R   + +  +  
Sbjct: 1096 IFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLLGIYIYYQTFYIVLSRELKRLISISYS 1155

Query: 286  QLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTST---TML 342
             +  +  E L+G   + ++   +R ++     I+  YN+     F +   + S    T+ 
Sbjct: 1156 PIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQ--YNIDFVFNFRSTNRWLSVRLQTIG 1213

Query: 343  GDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYT-EYTGSSVFGL--TTFYSELMQGVGAA 399
              +     +L  + +  +  L+ G +   M Y+ E TGS  + +  T      +  V   
Sbjct: 1214 ATIVLATAMLTLATMNTKKQLSSGMVGLLMSYSLEVTGSLTWIVRTTVMIETNIVSVERI 1273

Query: 400  SRLFDLTDHISSISPTKG-QKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNV 458
                +L     SI+P K   K  P +G IEFK+ S  Y    +  + KDIN+K+ P   V
Sbjct: 1274 VEYCELPSEAQSINPEKRPDKNWPSRGSIEFKDYSTKYRENLD-PVLKDINVKIEPCEKV 1332

Query: 459  CIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGT 518
             IVG +G GKST++L L R   PT G+I++DG +IS +    LR H+ ++ Q+     GT
Sbjct: 1333 GIVGRTGAGKSTLSLALFRILEPTEGKIIIDGINISDLGLFDLRSHLAIIPQDAQAFEGT 1392

Query: 519  IRDNIT--YGLAEPATKEEIRSVAKQCFCHNFITKFP----------DGYDTMIGAQGAL 566
            ++ N+      +E   K+ +     +      +   P          D  D  I   G+ 
Sbjct: 1393 VKTNLDPFNRYSEDELKKAVELAHLKPHLEKMLENEPSDSEESCDIKDILDVKINENGSN 1452

Query: 567  LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHR 626
            LS GQRQ + +ARAL+ +  ILVLDEAT+++D+E++  I  T  +  K    TI++IAHR
Sbjct: 1453 LSVGQRQLLCLARALLNRSKILVLDEATASIDMETDKIIQDTIRREFKDR--TILTIAHR 1510

Query: 627  LSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS---ELCK 664
            + T+  S+ +IVL  +GSV E     +L +N  S    LC+
Sbjct: 1511 IDTVLDSDKIIVLD-EGSVKEFDSPSKLLSNKASIFYSLCE 1550

 Score = 93.6 bits (231), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 120/526 (22%), Positives = 229/526 (43%), Gaps = 76/526 (14%)

Query: 232 KALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVA 291
           KA+I G + + +M+ I+  LS                  +K++  SK          +  
Sbjct: 434 KAVIGGLITMAIMMPINAFLS------------------RKVKKLSKTQMRYKDMRIKTI 475

Query: 292 EEQLSGVKTVQSFVAEQRELHRYNGA-----IRGIYNVGRKAAFINAEFFTSTTMLGDMS 346
            E L+ +K+++ +  E+  + R N       ++    +G  +  I   +     M+   +
Sbjct: 476 TELLNAIKSIKLYAWEEPMMKRLNHVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVACST 535

Query: 347 FIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL--FD 404
           F +  L+     L  ++    L+ F +      S+++ + +  + +++   +  RL  F 
Sbjct: 536 FGLFSLFNDS-PLSPAIVFPSLSLFNI----LNSAIYSVPSMINTIIETSVSMKRLKSFL 590

Query: 405 LTDHISS-----ISPTKGQKYIPGKGDIEFKNVSFSYPTRP-------EN---------- 442
           L+D I       I P+  ++ +P    IE  N++F + ++        EN          
Sbjct: 591 LSDEIDDSFIERIDPSVDERTLPV---IEMNNITFLWKSKEALASSQLENNSRADEESAM 647

Query: 443 ---QI-FKDIN-IKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVN 497
              QI  K+I+  +   G+ VCIVG  G GKST    +L       GQ+         + 
Sbjct: 648 GSSQIALKNIDHFEAKRGNLVCIVGRVGAGKSTFLKAIL-------GQLPCMSGSKESIP 700

Query: 498 CKTLRRH--IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDG 555
            K + R   +    QE  +M+ ++++NI +G      K       K C     +   PDG
Sbjct: 701 PKLIIRSSSLAYCSQESWIMNASVKENILFG--HKFDKAYYDLTIKACQLLPDLRILPDG 758

Query: 556 YDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTF-GQLM 613
            +T++G +G  LSGGQ+ R+++ARA+  + +I +LD+  SA+D E S+  I Y   G+  
Sbjct: 759 DETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKKA 818

Query: 614 KSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELF--ANPNSELCKLLTEKSS 671
              + TI+   + +S +K S+ +  L ++G ++E G +  +    N  S+L KLL E  S
Sbjct: 819 LLKNKTIILTTNTVSILKHSQMIYAL-ENGEIVEQGNYDSVMNRENSTSKLKKLLEEFDS 877

Query: 672 RSDGNDSLPPPPPNATQDKVVEQIAEKILERFPEAGQSPDATVKEI 717
             D  +       + ++  + E +  K++E   E     D+ ++ I
Sbjct: 878 PIDKGNENDTHTGHRSESDIDEPLQLKVVESETEDEVITDSELELI 923

>YDR135C Chr4 complement(723004..727551) [4548 bp, 1515 aa] {ON}
            YCF1Vacuolar glutathione S-conjugate transporter; member
            of the ATP-binding cassette family; has a role in
            detoxifying metals such as cadmium, mercury, and
            arsenite; also transports unconjugated bilirubin,
            selenodigluthatione, and oxidized glutathione; similar to
            human cystic fibrosis protein CFTR
          Length = 1515

 Score =  155 bits (391), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 143/521 (27%), Positives = 242/521 (46%), Gaps = 45/521 (8%)

Query: 170  IVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSD 229
            IV+    +      L + + N  L     F++T  +G +++R  +D Y V   + +  S 
Sbjct: 1011 IVLWVFCTIHASKYLHNLMTNSVLRAPMTFFETTPIGRILNRFSNDIYKVDALLGRTFSQ 1070

Query: 230  GFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTR 289
             F       V +   +++    +   +F   P+      + +    TS++L+     +TR
Sbjct: 1071 FF----VNAVKVTFTITVICATTWQFIFIIIPLSVFYIYYQQYYLRTSRELRR-LDSITR 1125

Query: 290  VA-----EEQLSGVKTVQSFVAEQRELH----RYNGAIRGIY---NVGRKAAFINAEFFT 337
                   +E L G+ TV+ +  ++R  H    R +  +   Y   N  R  A+   E   
Sbjct: 1126 SPIYSHFQETLGGLATVRGYSQQKRFSHINQCRIDNNMSAFYPSINANRWLAY-RLELIG 1184

Query: 338  STTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVG 397
            S  +LG  +  V      + + QG+LT G +   + Y      ++  +     E+   + 
Sbjct: 1185 SIIILGAATLSV------FRLKQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIV 1238

Query: 398  AASRLFDLTDHISSISP--TKGQ---KYIPGKGDIEFKNVSFSYPTRPE-NQIFKDINIK 451
            +  R+ +  D + S +P   +G    K  P +GDI+F N S  Y  RPE + + K INI 
Sbjct: 1239 SVERIKEYAD-LKSEAPLIVEGHRPPKEWPSQGDIKFNNYSTRY--RPELDLVLKHINIH 1295

Query: 452  VPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQE 511
            + P   V IVG +G GKS++ L L R    + G I++D   I+++    LR  + ++ Q+
Sbjct: 1296 IKPNEKVGIVGRTGAGKSSLTLALFRMIEASEGNIVIDNIAINEIGLYDLRHKLSIIPQD 1355

Query: 512  PILMSGTIRDNITYGLAEP---ATKEEI-RSVAKQCFCHNFITKFPDGYDTMIGAQGALL 567
              +  GT+R+NI     +P    T E I R++       + ++   DG D  +   G  L
Sbjct: 1356 SQVFEGTVRENI-----DPINQYTDEAIWRALELSHLKEHVLSMSNDGLDAQLTEGGGNL 1410

Query: 568  SGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRL 627
            S GQRQ + +ARA++    ILVLDEAT+A+DVE++  +  T     K    TI++IAHRL
Sbjct: 1411 SVGQRQLLCLARAMLVPSKILVLDEATAAVDVETDKVVQETIRTAFK--DRTILTIAHRL 1468

Query: 628  STIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTE 668
            +TI  S+ +IVL  +G V E     +L ++  S    L  E
Sbjct: 1469 NTIMDSDRIIVL-DNGKVAEFDSPGQLLSDNKSLFYSLCME 1508

 Score = 94.4 bits (233), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 93/401 (23%), Positives = 181/401 (45%), Gaps = 36/401 (8%)

Query: 288 TRVAEEQLSGVKTVQSFVAEQ-----RELHRYNGAIRGIYNVGRKAAFINAEFFTSTTML 342
           TRV  E L+ +K+++ +  E+      E  R N  ++ +  +G   A  + +F     ++
Sbjct: 484 TRVISEILNNIKSLKLYAWEKPYREKLEEVRNNKELKNLTKLGCYMAVTSFQFNIVPFLV 543

Query: 343 GDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL 402
              +F  V +Y     L   L    LT F L +      +  +    +  ++   +  RL
Sbjct: 544 SCCTF-AVFVYTEDRALTTDLVFPALTLFNLLS----FPLMIIPMVLNSFIEASVSIGRL 598

Query: 403 FDLTDHISSISPTKGQKY--IPGKGDIEFK---NVSFSYPTRPENQI-FKDINIKVPPGS 456
           F    +   + P   Q+   +   GD+      + +F +  +PE ++  K+IN +   G+
Sbjct: 599 FTFFTN-EELQPDSVQRLPKVKNIGDVAINIGDDATFLWQRKPEYKVALKNINFQAKKGN 657

Query: 457 NVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVN-CKTLRRHIGLVQQEPILM 515
             CIVG  G GK+ +   +L               D+ +V    T+   +  V Q P +M
Sbjct: 658 LTCIVGKVGSGKTALLSCML--------------GDLFRVKGFATVHGSVAYVSQVPWIM 703

Query: 516 SGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRI 575
           +GT+++NI +G    A  E      K C     +    DG  T++G +G  LSGGQ+ R+
Sbjct: 704 NGTVKENILFGHRYDA--EFYEKTIKACALTIDLAILMDGDKTLVGEKGISLSGGQKARL 761

Query: 576 AIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSE 634
           ++ARA+  + +  +LD+  +A+D   +   I +  G      + T V   +++S +  ++
Sbjct: 762 SLARAVYARADTYLLDDPLAAVDEHVARHLIEHVLGPNGLLHTKTKVLATNKVSALSIAD 821

Query: 635 NVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDG 675
           ++ +L  +G + + G + E+  + +S L KLL     +++G
Sbjct: 822 SIALL-DNGEITQQGTYDEITKDADSPLWKLLNNYGKKNNG 861

>TDEL0E05610 Chr5 (1038912..1043519) [4608 bp, 1535 aa] {ON} Anc_4.52
            YLL015W
          Length = 1535

 Score =  154 bits (390), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 139/526 (26%), Positives = 239/526 (45%), Gaps = 39/526 (7%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQ 225
            N   IV+L   + R  A+L   +    L     F++T  VG +I+R  SD   V  ++  
Sbjct: 1012 NLRTIVLLLFCTIRGAAQLHDTMAKTVLRSPMSFFETTPVGRIINRFSSDVQAVDSTLQW 1071

Query: 226  KVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATG 285
              +  F++++   V + ++    P    V        ++  + +    R   +    +T 
Sbjct: 1072 VFAFFFRSILNYAVTVILISYNMPWFLIVNAVLLIIYIYYQAFYITLSRELKRLTSVSTS 1131

Query: 286  QLTRVAEEQLSGVKTVQSFVAEQR-ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGD 344
             +  +  E L G   + +F    R +   +N      +N+     F +   + S  +   
Sbjct: 1132 PIMSLFSETLGGHAVINAFKHFDRFDFINFNNVQ---FNINCSFNFRSTNRWLSVRLQTI 1188

Query: 345  MSFIVV---LLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASR 401
             +FIV+   LL  S +  +  L+ G +   M Y     SS+  +     ++   + +  R
Sbjct: 1189 GAFIVLATALLALSTINSERRLSPGMVGLLMSYALQVTSSLMWIVRMSVQIETNIVSVER 1248

Query: 402  LFDLTDHISS----ISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSN 457
            +++  +        I   + +K  P +G+I FKN S  Y T+ +  + K IN+ + P   
Sbjct: 1249 IYEYCNLTPEAPEVIESCRPKKTWPSEGEIIFKNYSTKYKTKGDLAL-KGINLSIKPQEK 1307

Query: 458  VCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSG 517
            + +VG +G GKST++L L R    T G I +DG DISK+  K LR H+G++ Q+     G
Sbjct: 1308 IGVVGRTGAGKSTLSLALFRLLEATEGTIEIDGLDISKMGLKDLRSHLGIIPQDAQAFEG 1367

Query: 518  TIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKF------------PDGYDTMIGAQGA 565
            T+R N+     + +T+E   S+       + +  F                D  I   G 
Sbjct: 1368 TVRSNLD-PFEQYSTEELWASIELSHLKPHIVEMFRKEDNSELPASKEKMLDVKISENGG 1426

Query: 566  LLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625
             LS GQRQ + ++RAL+    +LVLDEAT+A+D+E++  I  T    +K    TI++IAH
Sbjct: 1427 NLSVGQRQLLCLSRALLNTSKVLVLDEATAAVDMETDKIIQETIRSELKEK--TILTIAH 1484

Query: 626  RLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
            R+ T+  S+ +IVL       +AG+ KE F  P +    LL+ K S
Sbjct: 1485 RIDTVLDSDKIIVL-------DAGQVKE-FDTPEN----LLSNKQS 1518

 Score = 95.9 bits (237), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 125/246 (50%), Gaps = 26/246 (10%)

Query: 445 FKDIN-IKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRR 503
            ++IN  +   G   CIVG  G GKST+   +L       GQ+      +  +  K L R
Sbjct: 638 LENINGFQAKKGELTCIVGRVGSGKSTMLRAIL-------GQLPCVNASVGGLEPKVLIR 690

Query: 504 H--IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIG 561
              +    QEP +M+ +I+DNIT+G     T     +  K C     +   P+  +T++G
Sbjct: 691 ASTVAYCPQEPWIMNASIKDNITFGFRYDETY--YNATIKACQLLPDLDILPERDNTLVG 748

Query: 562 AQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-----SEGAINYTFGQLMKSG 616
            +G  LSGGQ+ RI++ARA+  + ++ +LD+  SA+D E      E  ++   G L    
Sbjct: 749 EKGISLSGGQKARISLARAVYSRADLFLLDDILSAVDAEVSKNIVEMVLDKKMGLLRNK- 807

Query: 617 SMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPN-SELCKLLTEKSSRSDG 675
             T+V   + +S + RS+ + +L + GS++E G F E+ ++P  S+L K++ E      G
Sbjct: 808 --TVVLTTNAISVLNRSQKIYML-EGGSIVEEGSFTEVTSSPEPSKLKKMIDEFG----G 860

Query: 676 NDSLPP 681
           N + PP
Sbjct: 861 NMNYPP 866

>KNAG0J02730 Chr10 complement(512373..516986) [4614 bp, 1537 aa] {ON} 
          Length = 1537

 Score =  153 bits (387), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 132/533 (24%), Positives = 242/533 (45%), Gaps = 56/533 (10%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQ 225
            N   I++L   + R   +L   + +  ++   +F++T  +G +++R  +D   V  ++  
Sbjct: 1022 NLRTIILLVYCTIRGAKKLHDNMAHAIVYSSMQFFETTPIGRILNRFSADIDTVDSTLQM 1081

Query: 226  KVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATG 285
                 FK++    + + ++    P      LF     ++   +F  + R   +    +  
Sbjct: 1082 VFMVFFKSIFSYLITVILITISMPLFLVFCLFLMVIYIYYQKLFIVQSRELKRMTSISYS 1141

Query: 286  QLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTST---TML 342
             +  +  E L G+  ++++  +   + +Y    R  +N+     + +   + S    T+ 
Sbjct: 1142 PIMSLVGESLGGLAVIRAY--KHFSMFKYLNNERVQFNINCVFDYRSTNRWLSIRLQTIG 1199

Query: 343  GDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL 402
              M  I  +L  S +     LT G +   M Y     +S+  +      +  G+ +  R+
Sbjct: 1200 ALMVLITGMLSLSTISSSKPLTAGMVGLLMSYVLQVTTSLMWIVRSSVMIETGIVSVERI 1259

Query: 403  FDLTDHISSISPTKGQKYI---------PGKGDIEFKNVSFSYPTRPENQIFKDINIKVP 453
             +  +      P++ ++ +         P KG I+FKN S  Y    +  + K+I+I + 
Sbjct: 1260 MEYCEL-----PSEAEQIVDDYRPASNWPSKGAIQFKNYSTRYRANLD-PVLKNISININ 1313

Query: 454  PGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPI 513
            PG  V IVG +G GKST+ L L R   P  G I++DG DISK+    LR H+ ++ Q+  
Sbjct: 1314 PGEKVGIVGRTGAGKSTLTLALFRLLEPIEGTIIIDGMDISKIGISDLRSHLAIIPQDAQ 1373

Query: 514  LMSGTIRDN---------------ITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDT 558
               GT+R N               IT    +P  K+ +     +   ++++       + 
Sbjct: 1374 AFEGTVRSNLDPFNMFSDKELDTAITLSHLKPHLKKLMEESGSELPLNDYL-------EL 1426

Query: 559  MIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSM 618
             I   G+ LS GQRQ + +ARAL+ +  ILVLDEAT+++DVE++  I  T  +       
Sbjct: 1427 GIKESGSSLSVGQRQLLCLARALLNRSKILVLDEATASVDVETDKIIQATIRE--SFSDR 1484

Query: 619  TIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
            TI++IAHR+ T+  S+ ++VL       E G+ KE F +P S    LL +KS+
Sbjct: 1485 TIITIAHRIDTVLDSDRILVL-------EQGEVKE-FNSPAS----LLADKST 1525

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 108/218 (49%), Gaps = 20/218 (9%)

Query: 459 CIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRR--HIGLVQQEPILMS 516
           C+VG  G GK+T+   +L       GQ+         +  K + R   +    QE  +M+
Sbjct: 663 CVVGRVGSGKTTLLKSIL-------GQLPCTSGSQKAIPPKLIIRGESVAYCPQEAWIMN 715

Query: 517 GTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIA 576
            +I++NI +G     T   +    K C         PDG +T++G +G  LSGGQ+ R++
Sbjct: 716 DSIKENILFGHRYDETFYNL--TVKACELRPDFKILPDGDNTLVGEKGITLSGGQKARLS 773

Query: 577 IARALIKKPNILVLDEATSALDVESEGAINYTFGQ----LMKSGSMTIVSIAHRLSTIKR 632
           +ARA+  + +I +LD+  SA+D     +I +        L+K+ +  I+   + +S ++ 
Sbjct: 774 LARAVYSRSDIYLLDDVLSAVDAGVRKSIIHRVLDSDTGLLKNKA--IILTTNDISVLEH 831

Query: 633 SENVIVLGKDGSVIEAGKFKELFANPNSE--LCKLLTE 668
           S+ + VL +DG +IE   + E   + + +  L KLL E
Sbjct: 832 SDRIYVL-QDGRIIEESTYAEAIEDNDVKPFLYKLLKE 868

>TDEL0F04300 Chr6 complement(802866..807410) [4545 bp, 1514 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1514

 Score =  152 bits (383), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 133/484 (27%), Positives = 226/484 (46%), Gaps = 48/484 (9%)

Query: 199  FYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFF 258
            F++T  +G +++R  +D Y V   + +     F         +   + +    +   +F 
Sbjct: 1042 FFETTPIGRILNRFSNDIYKVDELLGRT----FAQFFVNVTKVSFTIIVICVTTWQFIFL 1097

Query: 259  APPILWSASVFGKKIRHTSKDLQE----ATGQLTRVAEEQLSGVKTVQSFVAEQRELH-- 312
              P++     + +    TS++L+         +    +E L G+ T++ +  + R  H  
Sbjct: 1098 ILPMIVLYVYYQQYYLRTSRELRRLDSVTKSPVYAHFQESLGGLSTIRGYDQQDRFTHIN 1157

Query: 313  --RYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGD 367
              R +  +   Y   N  R  AF   EF  +  + G  S  ++ L        GSLT G 
Sbjct: 1158 QSRIDNNMSAFYPSVNANRWLAF-RLEFIGTIIIFGAASLSMLRLKA------GSLTPGM 1210

Query: 368  LTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKY-----IP 422
            +   + Y      S+  +     E+   + +  R+ + ++ I S +P   + +      P
Sbjct: 1211 IGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSE-IKSEAPLVIEDHRPPADWP 1269

Query: 423  GKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPT 482
             KGDI+F++ S  Y     N + KDIN+ V P   + IVG +G GKS++ L L R     
Sbjct: 1270 SKGDIKFEHYSTRY-RENMNLVLKDINLHVKPQEKIGIVGRTGAGKSSLTLALFRIIEAA 1328

Query: 483  NGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATK---EEIRSV 539
             G+I++DG  I+++    LR  + ++ Q+  +  GT+R+NI     +P  +   EEI  V
Sbjct: 1329 EGRIVIDGVPINEIGLHDLRHKLSIIPQDSQVFEGTVRENI-----DPTNQYSDEEIWRV 1383

Query: 540  AKQCFCHNFITKFP-DGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALD 598
             +     N +     DG  T +   GA LS GQRQ + +ARAL+    IL+LDEAT+A+D
Sbjct: 1384 LELSHLKNHVLSMSKDGLMTRLTEGGANLSVGQRQLMCLARALLIPSRILILDEATAAVD 1443

Query: 599  VESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANP 658
            VE++  I  T     K    TI++IAHRL+TI  S+ ++VL       +AG+ +E F  P
Sbjct: 1444 VETDQVIQETIRTAFK--DRTILTIAHRLNTIMDSDRILVL-------DAGEVRE-FDTP 1493

Query: 659  NSEL 662
             + L
Sbjct: 1494 ENLL 1497

 Score = 98.2 bits (243), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 120/518 (23%), Positives = 220/518 (42%), Gaps = 77/518 (14%)

Query: 184 LRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKV----SDGFKALICGGV 239
           L S +  K L   +E  D    GD+++ +  D   + + +TQ      S  F+ L+C  V
Sbjct: 386 LTSTIYKKALVLSNEAADMSSTGDIVNLMSVDVQRL-QDLTQYCHLIWSGPFQILLCL-V 443

Query: 240 GIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVK 299
            +  ++  S  +  ++L    P+    S+  +  +   K   +   + +R+  E L+ +K
Sbjct: 444 SLYKLLGRSMWIGVIILVIMMPL---NSMLMRIQKKLQKVQMKNKDERSRLISEILNNIK 500

Query: 300 TVQSFVAE-----QRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYG 354
           +++ +  E     + E  R +  ++ +  +G   A  + +F      L   S   V +Y 
Sbjct: 501 SLKLYSWEAPYKAKLEHVRNDKELKNLTKMGVYMALTSFQF-NIVPFLVSCSTFAVFVYT 559

Query: 355 SYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLF----------D 404
               L   L    L  F L +         LT F    ++   + +RL+          D
Sbjct: 560 EKKPLTTDLVFPALALFNLLSFPLNVVPMVLTAF----IEASVSVNRLYSFLTNEELQKD 615

Query: 405 LTDHISSISPTKGQKYIPGKGDIEFK---NVSFSYPTRPENQI-FKDINIKVPPGSNVCI 460
              H+      K QK     GD+  K   + +F +  +P+ Q+  K+IN++V  G   C+
Sbjct: 616 AVHHLP-----KAQK----AGDVAIKISDDANFLWKRKPQYQVALKNINLEVKKGELACV 666

Query: 461 VGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIR 520
           VG  G GKS +   LL       G   V G                 V Q P +M+GT++
Sbjct: 667 VGKVGSGKSALVQSLLGDLYRVKGYAAVHGST-------------AYVSQVPWIMNGTVK 713

Query: 521 DNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARA 580
           DNI +G        ++    K C     +   PDG  TM+G +G  LSGGQ+ R+++ARA
Sbjct: 714 DNILFGHKYDPVFYDL--TIKACALTIDLGILPDGDQTMVGEKGISLSGGQKARLSLARA 771

Query: 581 LIKKPNILVLDEATSALDVE-SEGAINYTFG---------QLMKSGSMTIVSIAHRLSTI 630
              + +  +LD+  +A+D   ++  I +  G         +L+ +  +T++SIA  +S +
Sbjct: 772 TYARADTYLLDDPLAAVDEHVAQHLIEHVLGPRGLLKSKTKLLATNKITVLSIASSISLV 831

Query: 631 KRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTE 668
                     + G +I+ G ++++  + +S L  L+ E
Sbjct: 832 ----------EGGEIIQHGSYEDISKDLDSPLSNLVKE 859

>YHL035C Chr8 complement(27978..32756) [4779 bp, 1592 aa] {ON}
            VMR1Vacuolar membrane protein involved in multiple drug
            resistance and metal sensitivity; ATP-binding cassette
            (ABC) family member involved in drug transport; potential
            Cdc28p substrate; induced under respiratory conditions
          Length = 1592

 Score =  151 bits (381), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 149/541 (27%), Positives = 257/541 (47%), Gaps = 88/541 (16%)

Query: 172  MLRILS-ERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDG 230
            M+  LS  R   ++ + +++  LH    F+D   VG +++R   D   V + +   +   
Sbjct: 1061 MMTFLSGMRASRKIFNNLLDLVLHAQIRFFDVTPVGRIMNRFSKDIEGVDQELIPYLEVT 1120

Query: 231  FKALICGGVGIGMMVSISPE------LSGVLLFFAPPILWSASVFGKKIRHTSKDLQEAT 284
               LI     I ++  I+P       +  VL FF      +AS   K++   +K      
Sbjct: 1121 IFCLIQCASIIFLITVITPRFLTVAVIVFVLYFFVGKWYLTASRELKRLDSITK------ 1174

Query: 285  GQLTRVAEEQLSGVKTVQSFVAEQR----ELHRYNGAIRGIYNVGRKAAFINAEFFT-ST 339
              + +   E L GV T+++F  E+R     +++ +   R  + +      +  ++F+   
Sbjct: 1175 SPIFQHFSETLVGVCTIRAFGDERRFILENMNKIDQNNRAFFYLS-----VTVKWFSFRV 1229

Query: 340  TMLGDMSFIVVLLYGSYLVLQ-----GSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQ 394
             M+G     +VL  GS+++L        L    LT  +L+T+        L   YS    
Sbjct: 1230 DMIGAF---IVLASGSFILLNIANIDSGLAGISLTYAILFTD----GALWLVRLYSTFEM 1282

Query: 395  GVGAASRL--FDLTDHISSISPTKGQKYI------PGKGDIEFKNVSFSY-PTRPENQIF 445
             + +  RL  +   +  + +   +G+  +      P  G+IE +N+S  Y P  P   + 
Sbjct: 1283 NMNSVERLKEYSSIEQENYLGHDEGRILLLNEPSWPKDGEIEIENLSLRYAPNLPP--VI 1340

Query: 446  KDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHI 505
            ++++ KV P S + IVG +G GKSTI   L R   P  G I +DGQDISK++  TLRR I
Sbjct: 1341 RNVSFKVDPQSKIGIVGRTGAGKSTIITALFRLLEPITGCIKIDGQDISKIDLVTLRRSI 1400

Query: 506  GLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFIT------------KFP 553
             ++ Q+PIL +GTI+ N+     +P  + + + + K     N I+            +F 
Sbjct: 1401 TIIPQDPILFAGTIKSNV-----DPYDEYDEKKIFKALSQVNLISSHEFEEVLNSEERFN 1455

Query: 554  DGYDTMIG-----AQGAL-LSGGQRQRIAIARALIKKPNILVLDEATSALDVES----EG 603
              ++  +      A+G L LS G+RQ + IAR+L+++P I++LDEATS++D +S    +G
Sbjct: 1456 STHNKFLNLHTEIAEGGLNLSQGERQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQG 1515

Query: 604  AINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELC 663
             I   F +       TI++IAHRL ++   + +IV+       +AG+ KE +  P SEL 
Sbjct: 1516 IIRSEFNK------STILTIAHRLRSVIDYDRIIVM-------DAGEVKE-YDRP-SELL 1560

Query: 664  K 664
            K
Sbjct: 1561 K 1561

 Score = 86.7 bits (213), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 123/515 (23%), Positives = 219/515 (42%), Gaps = 39/515 (7%)

Query: 205 VGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMM-----VSISPELSGVLLFFA 259
           +G +I+ +  D++ VS  +   +    +A+I   V +G++     VS    +S +L+ F 
Sbjct: 445 LGTIINLISIDSFKVSE-LANYLYVTVQAVIMIIVVVGLLFNFLGVSAFAGISIILVMF- 502

Query: 260 PPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNG--- 316
           P     A++ GK  + T K     T Q      E L  ++ V+ F  E+  ++       
Sbjct: 503 PLNFLLANLLGKFQKQTLK----CTDQRISKLNECLQNIRIVKYFAWERNIINEIKSIRQ 558

Query: 317 -AIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYT 375
             +R +       +  +  +F + T++  ++F  +  +  +  L   L    L+ F L  
Sbjct: 559 KELRSLLKKSLVWSVTSFLWFVTPTLVTGVTF-AICTFVQHEDLNAPLAFTTLSLFTLLK 617

Query: 376 EYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFS 435
               + +  L+   S + Q   +  R+ D    +            P K  IEFKN + +
Sbjct: 618 ----TPLDQLSNMLSFINQSKVSLKRISDFL-RMDDTEKYNQLTISPDKNKIEFKNATLT 672

Query: 436 YPTRPEN-QIFK--DINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDG-- 490
           +     +   FK   +NIK   G    I+G +G GKS + L LL   N  +G I+V    
Sbjct: 673 WNENDSDMNAFKLCGLNIKFQIGKLNLILGSTGSGKSALLLGLLGELNLISGSIIVPSLE 732

Query: 491 --QDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNF 548
              D+   +C+ L        Q   L++ T+++NI +       ++    V   C     
Sbjct: 733 PKHDLIP-DCEGLTNSFAYCSQSAWLLNDTVKNNIIFD--NFYNEDRYNKVIDACGLKRD 789

Query: 549 ITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAI--N 606
           +   P G  T IG +G  LSGGQ+QRI++ARA+      ++LD+  SA+D  +   I  N
Sbjct: 790 LEILPAGDLTEIGEKGITLSGGQKQRISLARAVYSSAKHVLLDDCLSAVDSHTAVWIYEN 849

Query: 607 YTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANP--NSELCK 664
              G LMK  + T + + H +S   R+ +  ++ ++G V   G   EL +      +  +
Sbjct: 850 CITGPLMK--NRTCILVTHNVSLTLRNAHFAIVLENGKVKNQGTITELQSKGLFKEKYVQ 907

Query: 665 LLTEKSSRSDGNDSLPPPPPNATQDKVVEQIAEKI 699
           L +  S      + L  P  N +Q   +E + E I
Sbjct: 908 LSSRDSINEKNANRLKAPRKNDSQK--IEPVTENI 940

>KLLA0F20075g Chr6 complement(1868786..1873336) [4551 bp, 1516 aa]
            {ON} similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1516

 Score =  151 bits (381), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 139/506 (27%), Positives = 232/506 (45%), Gaps = 43/506 (8%)

Query: 184  LRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGM 243
            L   + +  L     F++T  +G +++R  +D Y V   + +     F       V +  
Sbjct: 1028 LHDAMASSVLKAPMSFFETTPIGRILNRFSNDIYKVDEILGRT----FAQFFANVVKVSF 1083

Query: 244  MVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVA-----EEQLSGV 298
             + +    +   +F   P+      + +    TS++L+     +TR       +E L G+
Sbjct: 1084 TIVVICMATWQFIFIVLPLSVLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGL 1142

Query: 299  KTVQSFVAEQRELH----RYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVL 351
             T++ +  + R +H    R +  +   Y   N  R  AF   EF  S  +L   S + V+
Sbjct: 1143 TTIRGYSQQNRFVHINQTRVDNNMSAFYPSVNANRWLAF-RLEFIGSVIILA-ASMLAVI 1200

Query: 352  LYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISS 411
              G+     G+LT G +   + +      S+  +     E+   + +  R+ +  +  S 
Sbjct: 1201 RLGN-----GTLTAGMIGLSLSFALQITQSLNWIVRMTVEVETNIVSVERIKEYAELKSE 1255

Query: 412  ----ISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQ-IFKDINIKVPPGSNVCIVGPSGR 466
                I   +     P  G+I+F N S  Y  RPE + I KDI++ + P   + IVG +G 
Sbjct: 1256 APYIIKDHRPPASWPESGEIKFVNYSTRY--RPELELILKDIDLHIHPKEKIGIVGRTGA 1313

Query: 467  GKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYG 526
            GKS++ L L R     +G I++DG  I  +    LR  + ++ Q+  +  GT+R+NI   
Sbjct: 1314 GKSSLTLALFRIIEAASGHIVIDGIPIDSIGLADLRHGLSIIPQDSQIFEGTVRENI--- 1370

Query: 527  LAEPA---TKEEIRSVAKQCFCHNFITKF-PDGYDTMIGAQGALLSGGQRQRIAIARALI 582
              +P    T EEI +        + I     +G +TM+   G+ LS GQRQ + +ARAL+
Sbjct: 1371 --DPTNRYTDEEIWNALALSHLKDHILGMGSNGLETMLTEGGSNLSVGQRQLMCLARALL 1428

Query: 583  KKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKD 642
               NIL+LDEAT+A+DVE++  I  T     K    TI++IAHR++TI  S+ +IVL K 
Sbjct: 1429 ISSNILILDEATAAVDVETDQLIQKTIRNAFK--ERTILTIAHRINTIMDSDRIIVLDK- 1485

Query: 643  GSVIEAGKFKELFANPNSELCKLLTE 668
            G V E    + L    +S    L  E
Sbjct: 1486 GRVTEFDTPQNLLQKKDSIFYSLCLE 1511

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 113/471 (23%), Positives = 207/471 (43%), Gaps = 69/471 (14%)

Query: 271 KKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAE-----QRELHRYNGAIRGIYNVG 325
           +KI+  +KD      + TRV  E L+ +K+++ +  E     + +  R    ++ +  +G
Sbjct: 471 QKIQMKNKD------ERTRVTSEILNNIKSLKVYGWEIPYKAKLDHVRNEKELKNLKKMG 524

Query: 326 RKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGL 385
              A  N +F      L   S   V +Y     L   L    LT F L +         +
Sbjct: 525 CTLALANFQF-NIVPFLVSCSTFAVFVYTEERPLSTDLVFPALTLFNLLSFPLAVVPNAI 583

Query: 386 TTFYSELMQGVGAASRLFD-LTDHISSISPTKGQKYIPGKGD--IEFKNVSFSYPTRPEN 442
           ++F    ++   + +RLF  LT+          +  +   GD  ++  + +F +  +PE 
Sbjct: 584 SSF----IEASVSINRLFAFLTNEELQNDAVLREPKVKNIGDEGVKVNDATFLWQRKPEY 639

Query: 443 QI-FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTL 501
           ++  K+IN     G   CIVG  G GKS +   LL             G  I      T+
Sbjct: 640 KVALKNINFVAKKGELTCIVGKVGSGKSALIQSLL-------------GDLIRVKGFATV 686

Query: 502 RRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIG 561
              +  V Q P +M+GT++DNI +G       E  +   K C     ++  PDG  T++G
Sbjct: 687 HGDVANVSQVPWIMNGTVKDNILFG--HKYDPEFYQLTIKACALSIDLSMLPDGDQTLVG 744

Query: 562 AQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFG---------Q 611
            +G  LSGGQ+ R+++ARA+  + +  +LD+  +A+D   ++  I +  G         +
Sbjct: 745 EKGISLSGGQKARLSLARAVYSRADTYLLDDPLAAVDEHVAKHLIEHVLGPHGLLHSKTK 804

Query: 612 LMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
           ++ +  +T++SIA          + I L ++G +I+ G + ++  + NS L KL+ E   
Sbjct: 805 VLATNKITVLSIA----------DSITLMENGEIIQQGSYDQVNESTNSPLSKLIAEF-- 852

Query: 672 RSDGNDSLPPPPPNATQDKVVEQIAEKILERFPEAGQSPDATVKEIFKDVS 722
              G    P P  + T    + ++A + +E +       D+ + EI  D++
Sbjct: 853 ---GKKGKPTPSQSTTS---LAKLASEGIESY------SDSKISEITVDIN 891

>CAGL0L06402g Chr12 (720723..725330) [4608 bp, 1535 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1 or uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1
          Length = 1535

 Score =  150 bits (378), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 137/500 (27%), Positives = 238/500 (47%), Gaps = 47/500 (9%)

Query: 184  LRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGM 243
            L + + N        F++T  +G +++R  +D Y V   + +  S  F   +     IG+
Sbjct: 1047 LHNLMTNAVFRAPMSFFETTPIGRILNRFSNDIYKVDSILGRTFSQFFVNTVKVLFTIGV 1106

Query: 244  MVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVA-----EEQLSGV 298
            +   + +     +F   P+      + +    TS++L+     +TR       +E L G+
Sbjct: 1107 IAYTTWQF----VFVIVPLGIFYIYYQQYYLRTSRELRRLES-VTRSPIFSHFQETLGGL 1161

Query: 299  KTVQSFVAEQRELH----RYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVL 351
             T++ +  ++R  H    R +  +   Y   N  R  A+   EF  S  +LG  +  +  
Sbjct: 1162 ATIRGYGQQKRFEHINECRVDNNMSAFYPSINANRWLAY-RLEFIGSVIILGAATLSIFK 1220

Query: 352  LYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISS 411
            L        G++T G +   + Y      ++  +     E+   + +  R+ + ++  S 
Sbjct: 1221 LRA------GTMTAGMIGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSE 1274

Query: 412  ----ISPTKGQKYIPGKGDIEFKNVSFSYPTRPE---NQIFKDINIKVPPGSNVCIVGPS 464
                I   +  K  P  G+I+F++    Y TR     + + KDIN+++ P   + IVG +
Sbjct: 1275 APLVIESNRPPKEWPVAGEIKFEH----YYTRYREDLDYVLKDINLEIKPREKIGIVGRT 1330

Query: 465  GRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNIT 524
            G GKS++ L L R    T+G IL+DG  I+++    LR H+ ++ Q+  +  GTIR+NI 
Sbjct: 1331 GAGKSSLTLALFRIIEATSGGILIDGVHINEIGLHDLRHHLSIIPQDSQVFEGTIRENI- 1389

Query: 525  YGLAEPA---TKEEI-RSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARA 580
                +P    T  +I R++       + +    DG  TM+   G+ LS GQRQ + +ARA
Sbjct: 1390 ----DPTNQFTDADIWRALELSHLKEHIMQMGGDGLMTMMTEGGSNLSVGQRQLMCLARA 1445

Query: 581  LIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLG 640
            L+    +LVLDEAT+A+DVE++  I  T     K    TI++IAHR++TI  ++ +IVL 
Sbjct: 1446 LLVPSKVLVLDEATAAVDVETDKVIQETIRTSFK--DRTILTIAHRINTIMDNDRIIVLD 1503

Query: 641  KDGSVIEAGKFKELFANPNS 660
            K G V+E    + L  N NS
Sbjct: 1504 K-GKVVEFDTPEALLKNTNS 1522

 Score = 97.1 bits (240), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 121/518 (23%), Positives = 227/518 (43%), Gaps = 51/518 (9%)

Query: 180 VVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKV----SDGFKALI 235
           V + L S +  K L   +E  +T   GD+++ +  D   + + +TQ +    S   + ++
Sbjct: 396 VKSALTSIIYQKALVLSNEASNTSSTGDIVNLMSVDVQKL-QDLTQWIHLIWSGPLQIVL 454

Query: 236 CGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQL----TRVA 291
           C  + +  ++  S  +  ++L    P+    + F  KI+   K+LQ++  +     TRV 
Sbjct: 455 CL-ISLYKLLGHSMWVGVLILTIMIPV----NSFLMKIQ---KNLQKSQMKFKDERTRVI 506

Query: 292 EEQLSGVKTVQSFVAEQ-----RELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMS 346
            E L+ +K+++ +  EQ      E  R    ++ +  +G   A  + +F      L   S
Sbjct: 507 SEILNNMKSLKLYAWEQPYKEKLEYVRNEKELKNLKKLGVYMACTSFQF-NIVPFLVSCS 565

Query: 347 FIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFD-L 405
              V +Y     L   L    LT F L +      +  +    + +++   + SRLF+ L
Sbjct: 566 TFAVFVYTEDKALTTDLVFPALTLFNLLS----FPLMVIPNVITAIIESSVSVSRLFNFL 621

Query: 406 TDHISSISPTKGQKYIPGKGDIEFK---NVSFSYPTRPENQI-FKDINIKVPPGSNVCIV 461
           T+        +    +   GD+      N +F +  +PE ++  K+IN +   G   CIV
Sbjct: 622 TNEELQKDAVQRLPKVKEIGDVAVNVGDNATFLWKRKPEYKVALKNINYQAKKGELSCIV 681

Query: 462 GPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVN-CKTLRRHIGLVQQEPILMSGTIR 520
           G  G GKS     LL               D+ +V    T+   +  V Q   +M+GT+R
Sbjct: 682 GKVGSGKSAFLQSLL--------------GDLFRVKGFATIHGSVAYVSQVAWIMNGTVR 727

Query: 521 DNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARA 580
           DN+ +G       E      K C     +    DG  T++G +G  LSGGQ+ R+++ARA
Sbjct: 728 DNVLFG--HKYDPEFYEKTIKACALTIDLATLVDGDQTLVGEKGISLSGGQKARLSLARA 785

Query: 581 LIKKPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVL 639
           +  + +  +LD+  +A+D   S   + +  G      S T +   +++S +  ++++ +L
Sbjct: 786 VYARADTYLLDDPLAAVDEHVSRHLVEHVLGPNGLLHSKTRILATNKISVLSAADSITLL 845

Query: 640 GKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGND 677
            ++G + + G + +   +  S L KLL E   +   ND
Sbjct: 846 -ENGEITQQGTYADCRKDEESALGKLLKEFGRKESKND 882

>Kwal_56.23844 s56 complement(733654..738138) [4485 bp, 1494 aa] {ON}
            YDR135C (YCF1) - metal resistance protein, similar to
            multidrug resistance proteins and cystic fibrosis protein
            CFTR [contig 171] FULL
          Length = 1494

 Score =  150 bits (378), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 136/497 (27%), Positives = 228/497 (45%), Gaps = 43/497 (8%)

Query: 199  FYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFF 258
            F++T  +G +++R  +D Y V   + +  S  F       V +   + +    +   +F 
Sbjct: 1020 FFETTPIGRVLNRFSNDIYKVDELLGRTFSQFF----VNAVKVSFTIIVICSSTWQFVFV 1075

Query: 259  APPILWSASVFGKKIRHTSKDLQEATGQLTRVA-----EEQLSGVKTVQSFVAEQRELH- 312
              P+      + +    TS++L+     +TR       +E L G+ T++ +  + R LH 
Sbjct: 1076 IIPLGTLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGISTIRGYQQQGRFLHI 1134

Query: 313  ---RYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIG 366
               R +  +   Y   N  R  AF   EF  S  +LG  +  V      + + QG+LT G
Sbjct: 1135 NQARVDNNMSAFYPSVNANRWLAF-RLEFIGSIIILGAATLSV------FRLKQGALTPG 1187

Query: 367  DLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHI----SSISPTKGQKYIP 422
             +   + Y      S+  +     E+   + +  R+ +  +      + I   +  +  P
Sbjct: 1188 MIGLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANITPEAPAVIESNRPAEDWP 1247

Query: 423  GKGDIEFKNVSFSYPTRPENQI-FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNP 481
              G I+F+N S  Y  RPE  +  ++INI + P   + IVG +G GKS++ L L R    
Sbjct: 1248 THGAIKFENYSARY--RPELDLSLRNINIDIKPQERIGIVGRTGAGKSSLTLALFRIIEA 1305

Query: 482  TNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPA---TKEEIRS 538
              G+I++DG     +  + LR H+ ++ Q+  +  GT+R+NI     +P    T EEI  
Sbjct: 1306 AEGRIIIDGVPTDSIGLRDLRHHLSIIPQDSQVFEGTVRENI-----DPTNEYTDEEIWH 1360

Query: 539  VAKQCFCHNFITKF-PDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSAL 597
              +     + I     D  ++M+   G  LS GQRQ + +ARAL+    ILVLDEAT+A+
Sbjct: 1361 ALELAHLKDHIKSLGKDELESMLTEGGGNLSVGQRQLMCLARALLIPTRILVLDEATAAV 1420

Query: 598  DVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFAN 657
            DVE++  I  T     K  + TI++IAHR++TI  S+ ++VL   G + E    + L  N
Sbjct: 1421 DVETDQVIQETIRTAFK--NRTILTIAHRINTILDSDRILVL-DSGKIAEFDSPEALLKN 1477

Query: 658  PNSELCKLLTEKSSRSD 674
              S    L  E     D
Sbjct: 1478 RESLFYSLCQEAGVTKD 1494

 Score = 94.7 bits (234), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 70/269 (26%), Positives = 137/269 (50%), Gaps = 25/269 (9%)

Query: 431 NVSFSYPTRPENQI-FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVD 489
           + +F +  +PE ++  K+IN +   G   CIVG  G GKS +   +L       G   V 
Sbjct: 616 DATFLWQRKPEYKVALKNINFQAKKGELTCIVGKVGSGKSALIQGILGDLFRVKGFASVH 675

Query: 490 GQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFI 549
           G              I  V Q P +M+GT+++NI +G    A  +   +  + C     +
Sbjct: 676 GS-------------IAYVSQVPWIMNGTVKENILFGHKYDA--DFYDTTLRACALAVDL 720

Query: 550 TKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYT 608
           +  P G +T++G +G  LSGGQ+ RI++ARA+  + +  +LD+  +A+D   ++  I + 
Sbjct: 721 SILPKGDETLVGEKGISLSGGQKARISLARAVYARADTYLLDDPLAAVDEHVAKHLIEHV 780

Query: 609 FGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLT- 667
            G      S   V   +++S +  ++++ +L ++G +I+ G ++E+ ++ +S L K++  
Sbjct: 781 LGSQGLLSSKVKVLATNKISVLSIADHISLL-ENGEIIQQGSYEEVTSDKSSALSKIIAN 839

Query: 668 --EKSSRSDGNDSLPPPPPNATQDKVVEQ 694
             +K ++  G++S    P ++T D  V +
Sbjct: 840 YGKKQTKGKGDES----PESSTPDSEVAE 864

>Smik_8.6 Chr8 complement(11717..16474) [4758 bp, 1585 aa] {ON}
            YHL035C (REAL)
          Length = 1585

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 139/529 (26%), Positives = 240/529 (45%), Gaps = 78/529 (14%)

Query: 183  RLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIG 242
            ++ + +++  LH    F+D   VG +++R   D   + + +   +      LI     + 
Sbjct: 1073 KIFNSMLDLVLHAKIRFFDVTPVGRIMNRFSKDIEGIDQELIPYLEVTVFCLIQCSSILL 1132

Query: 243  MMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQE----ATGQLTRVAEEQLSGV 298
            ++V I+P    V    A  +       GK     S+DL+         + +   E L GV
Sbjct: 1133 LIVVITPRFFSV----AVIVFILYYFVGKWYLKASRDLKRIDSITKSPIFQHFSETLVGV 1188

Query: 299  KTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLV 358
             T+++F  E+R +      +  +  + +     N  FF  +  +   +F V ++ G+++V
Sbjct: 1189 CTIRAFGDEKRFI------LENMEKIDQN----NKAFFYLSVAVKWFAFRVDMI-GAFIV 1237

Query: 359  L-QGSLTIGD------------LTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDL 405
            L  GS  + +            LT  +L+T+    S   L   YS     + +  RL + 
Sbjct: 1238 LGSGSFILFNIDNIDSGLAGISLTYAILFTD----SALWLVQLYSRFEMNMNSVERLKEY 1293

Query: 406  T------------DHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVP 453
            +            DHI +++ +      P  G IE +N+S  Y +     + K++  KV 
Sbjct: 1294 SSIVQEKYLGYDEDHIQALNDSSW----PKHGKIEVENLSLRYASNLP-LVLKNVCFKVD 1348

Query: 454  PGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPI 513
            P S V IVG +G GKSTI   L R   P  G I +D QDISK++  TLRR I ++ Q+P+
Sbjct: 1349 PQSKVGIVGRTGAGKSTIIAALFRLLEPVTGCIKIDDQDISKIDLITLRRSITIIPQDPV 1408

Query: 514  LMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFP-----------DGYDTMIGA 562
            L +GTI+ NI     +P  + + R + K     N I+              + ++  +  
Sbjct: 1409 LFAGTIKSNI-----DPHDEYDERRIFKVLLQVNLISSLEFKQVFNLKENFNIHNKFLNL 1463

Query: 563  Q------GALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG 616
            Q      G  LS G+RQ + IAR+L+++  I++LDEATS++D +S+  I        K  
Sbjct: 1464 QSEIVEGGLNLSQGERQLLFIARSLLRESKIILLDEATSSIDYDSDHLIQSIIRS--KFN 1521

Query: 617  SMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKL 665
              TI++IAHRL ++   + ++V+   G + E G   EL  N  S   ++
Sbjct: 1522 KSTILTIAHRLRSVIYYDKILVMDA-GEIKEYGHPYELLKNERSTFYRM 1569

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 115/243 (47%), Gaps = 16/243 (6%)

Query: 422 PGKGDIEFKNVSFSYPTRPENQIFK----DINIKVPPGSNVCIVGPSGRGKSTIALLLLR 477
           P +  IEFK  +  +    +N I K    D+NI    G    ++G +G GKS + + LL 
Sbjct: 659 PDRNKIEFKKANLVW-NENDNDINKFKLCDLNIIFSIGKLNLVLGSTGSGKSALLMSLLG 717

Query: 478 YYNPTNGQILVDG----QDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATK 533
             +  +G I++ G     D+   +   L        Q   L+S TI++NI +       K
Sbjct: 718 ELDLVSGFIIIPGLEPRHDLIP-DHDGLTNSFAYCSQSAWLVSDTIKNNIVFN--GSYDK 774

Query: 534 EEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEA 593
              + V   C  +  +   P G  T IG +G  LSGGQ+QRI++ARA+      ++LD+ 
Sbjct: 775 SRYKKVIDACGLNRDLNILPAGDLTEIGEKGITLSGGQKQRISLARAVYSHAKHVLLDDC 834

Query: 594 TSALDVESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKF 651
            SA+D  +   I  N   GQLMK  + T + + H +    R+ +  ++ +DG V   G  
Sbjct: 835 LSAVDSHTAVWIYENCITGQLMK--NRTCILVTHNVPLAIRNAHFAIILEDGKVKNQGTI 892

Query: 652 KEL 654
           KEL
Sbjct: 893 KEL 895

>KLTH0G12716g Chr7 (1080818..1085320) [4503 bp, 1500 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1500

 Score =  149 bits (375), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 139/491 (28%), Positives = 231/491 (47%), Gaps = 43/491 (8%)

Query: 199  FYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFF 258
            F++T  +G +++R  +D + V   + +  +  F   I     I ++   + +   V+L  
Sbjct: 1026 FFETTPIGRILNRFSNDIFKVDELLGRTFAQFFVNAIKVSFTIIVICFSTWQFILVIL-- 1083

Query: 259  APPILWSASVFGKKIRHTSKDLQEATGQLTRVA-----EEQLSGVKTVQSFVAEQRELH- 312
              P+      + +    TS++L+     +TR       +E L G+ T++ +  ++R +H 
Sbjct: 1084 --PMGTLYIYYQQYYLRTSRELRR-LDSVTRSPIYAHFQETLGGISTIRGYNQQKRFVHI 1140

Query: 313  ---RYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIG 366
               R +  +   Y   N  R  AF   EF  S  +L   S  V+ L       QG+LT G
Sbjct: 1141 NQARVDNNMSAYYPSVNANRWLAF-RLEFIGSVIILAASSLSVLRLK------QGALTPG 1193

Query: 367  DLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISS----ISPTKGQKYIP 422
             +   + Y      S+  +     E+   + +  R+ +  +  S     I   +  +  P
Sbjct: 1194 MIGLSVSYALQITQSLNWIVRMTVEVETNIVSVERIKEYANLESEAPAVIESNRPSEDWP 1253

Query: 423  GKGDIEFKNVSFSYPTRPENQI-FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNP 481
             +G I+F+N S  Y  RPE ++  KDIN+ + P   + IVG +G GKS++ L L R    
Sbjct: 1254 SQGSIKFENYSARY--RPELELSLKDINLDIKPQERIGIVGRTGAGKSSLTLALFRIIEA 1311

Query: 482  TNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPA---TKEEIRS 538
             +G+I +DG  I  +  + LR H+ ++ Q+  L  GTIR+NI     +P    T E+I  
Sbjct: 1312 ASGRIYIDGLPIDSIGLRDLRHHLSIIPQDSQLFEGTIRENI-----DPTNEYTDEQIWR 1366

Query: 539  VAKQCFCHNFITKF-PDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSAL 597
              +     + +     +  D  +   G+ LS GQRQ + +ARAL+    ILVLDEAT+A+
Sbjct: 1367 ALELSHLKDHVKGLGKEELDAPLTEGGSNLSVGQRQLMCLARALLIPSKILVLDEATAAV 1426

Query: 598  DVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFAN 657
            DVE++  I  T     K  + TI++IAHR++TI  S+ ++VL   G V E      L  N
Sbjct: 1427 DVETDQVIQETIRTAFK--NRTILTIAHRINTILDSDRILVL-DSGKVAEFDTPDNLLKN 1483

Query: 658  PNSELCKLLTE 668
            P S    L  E
Sbjct: 1484 PESLFYSLCYE 1494

 Score = 85.5 bits (210), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 117/239 (48%), Gaps = 18/239 (7%)

Query: 431 NVSFSYPTRPENQI-FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVD 489
           + +F +  +PE ++  K+IN     G   C+VG  G GKS +   +L       G   V 
Sbjct: 621 DATFLWQRKPEYKVALKNINFAAKKGKLTCVVGKVGSGKSALIQAILGDLFRVKGFASVH 680

Query: 490 GQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFI 549
           G              I  V Q P +M+GT++DNI +G      +       K C     +
Sbjct: 681 GS-------------IAYVSQVPWIMNGTVKDNILFG--HKYDESFYTMTLKACALIVDL 725

Query: 550 TKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYT 608
              P G  T++G +G  LSGGQ+ R+++ARA+  + +  +LD+  +A+D   ++  + + 
Sbjct: 726 AVLPKGDQTLVGEKGISLSGGQKARLSLARAVYARADTYLLDDPLAAVDEHVTKHLVEHV 785

Query: 609 FGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLT 667
            G      S T V   ++++ +  ++++ +L ++G +I+ G + ++ +  +S L K+++
Sbjct: 786 LGPNGLLASKTKVLATNKITVLSIADHIALL-ENGEIIQQGSYDDVTSAKSSALSKIIS 843

>TBLA0G00710 Chr7 (157927..163002) [5076 bp, 1691 aa] {ON} Anc_4.6
            YHL035C
          Length = 1691

 Score =  149 bits (375), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 131/518 (25%), Positives = 234/518 (45%), Gaps = 65/518 (12%)

Query: 183  RLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI-CGGVGI 241
            ++ + ++  +LH    F+D+  +G +++R   D   V + +   +   F  L+ C  + I
Sbjct: 1169 KMFNSLLKNSLHAKLRFFDSTPLGRIMNRFSKDIEAVDQEVPMYLGGTFACLVECFSI-I 1227

Query: 242  GMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTV 301
             ++  I+P+  GV +F A    +  +V+    R   +        + +   E L+G+ TV
Sbjct: 1228 VLITLITPQFLGVAIFIAVFYWFVGAVYISGSRELKRFDSITKSPIYQHFSETLAGITTV 1287

Query: 302  QSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVL-Q 360
            +++  E R +           N+  K    N  FF        +SF   ++ G++++L  
Sbjct: 1288 RAYGDESRFMRE---------NL-EKIDENNKPFFYMWVSNRWLSFRTQII-GAFVILGA 1336

Query: 361  GSLTIGDLTAF--------MLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTD----- 407
            G  +I ++           + Y      +   L  FY +    + +  R+ +  +     
Sbjct: 1337 GGFSIWNINKIDSGLAGISLTYALTFSDAALWLVRFYGDTEMNMNSTERIQEYMNIDQEP 1396

Query: 408  -HISSISPTKGQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSG 465
             +  ++ P       P  G IE  +VS  Y P  P  ++ K+++  V   S V IVG +G
Sbjct: 1397 YNEGTVEPPADW---PENGKIEINDVSLRYAPNLP--RVIKNVSFTVDSKSKVGIVGRTG 1451

Query: 466  RGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITY 525
             GKSTI   L R+  P  G I +D  DI  ++ + LRR I ++ Q+P L +GTIR N+  
Sbjct: 1452 AGKSTIITALFRFLEPETGNIKIDNIDIVSIDLQKLRRSISIIPQDPTLFTGTIRSNL-- 1509

Query: 526  GLAEPATKEEIRSVAKQCFCHNFITK-------FPDGYDTM----------------IGA 562
               +P T+   + +     C N +++        P   DT                 +  
Sbjct: 1510 ---DPYTQYSDKEIFDSLICVNLVSREELAQVQSPSSNDTSSIVSENFNHFLDLEYNVSE 1566

Query: 563  QGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVS 622
             G+ +S GQRQ + +AR+L+ KP I++LDEAT+++D ES+  I  T     + G+ TI++
Sbjct: 1567 GGSNISQGQRQLLCLARSLLGKPKIILLDEATASIDYESDKKIQETIRN--EFGNSTILT 1624

Query: 623  IAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS 660
            IAHRL ++   + ++V+   G V E      L  N NS
Sbjct: 1625 IAHRLRSVIDYDKILVMDA-GEVEEYDHPYSLLLNKNS 1661

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 124/516 (24%), Positives = 222/516 (43%), Gaps = 67/516 (12%)

Query: 175 ILSERVVARLRSGVMNKT-----------LHQDS------EFYDTHKVGDLISRLGSDAY 217
           I+SE  +  LR  ++ KT           L++DS      E   +  VG +I+ +  DA+
Sbjct: 492 IISEIYIKALRRQIITKTKKSTDEVDPEQLNEDSKIDGDEESTASANVGAIINLIAVDAF 551

Query: 218 VVSRSMTQKVSDGFKALICGGVGIGMMVSI--SPELSGVL-LFFAPPIL-----WSASVF 269
            V+  +   +      +I   V I ++ ++  S    G L +    P+      W  ++ 
Sbjct: 552 KVAE-IGAYLHTFIGTIIMTFVSIYLLFNLLGSAAFIGALTIIVLIPVNYKIANWLGNLQ 610

Query: 270 GKKIRHTSKDLQE--ATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRK 327
            K ++ T K +Q+   T Q  R+ +   S  K  ++ + + RE   Y   +R +  V   
Sbjct: 611 QKNLKTTDKRIQKLNETFQAIRIIKF-FSWEKNFENDIHKIREEELYILLLRCL--VWSF 667

Query: 328 AAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGL-- 385
           + FI   FF S T++  +SF        Y+ +Q      +LT+      +T  S+F L  
Sbjct: 668 STFI---FFISPTIVTSLSF------AYYIFIQKQ----ELTS---PVAFTALSLFALLK 711

Query: 386 ------TTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIP-GKGDIEFKNVSFSYPT 438
                     S ++Q   +  R+    D   +      Q  +P  K  + FKN + S+  
Sbjct: 712 IPLDQMANMLSYVVQSKVSLDRVQTFLDEPDT--KKYEQLTVPVEKNKLSFKNATMSWGN 769

Query: 439 RPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISK--- 495
             ++   ++++I    G    ++GP+G GK+++ + LL     T GQI +   D      
Sbjct: 770 DNDSFKLRNLDIDFKIGQLNVVIGPTGSGKTSLLMALLGEMTLTEGQINIPSLDPRHDLI 829

Query: 496 VNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDG 555
           +        I    Q   L++ T+R+NI +    P  K+   +                G
Sbjct: 830 IESDGHTNSIAYCSQAAWLLNDTVRNNILFN--SPYNKDRYDAAIVAAGLKRDFEILAAG 887

Query: 556 YDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAI--NYTFGQLM 613
             T IG +G  LSGGQ+QRI++ARAL      ++LD+  SA+D  +   I  N   G LM
Sbjct: 888 DLTEIGERGITLSGGQKQRISLARALYSNARHVLLDDCLSAVDAHTAAWIYDNCISGPLM 947

Query: 614 KSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAG 649
           +  +  +VS  H ++   ++ +++V+ K+G V + G
Sbjct: 948 EGRTCVLVS--HNIALTLKNASLVVMLKNGRVADQG 981

>KNAG0I00990 Chr9 (188695..193302) [4608 bp, 1535 aa] {ON} Anc_8.303
            YDR135C
          Length = 1535

 Score =  148 bits (374), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 131/503 (26%), Positives = 231/503 (45%), Gaps = 37/503 (7%)

Query: 184  LRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGM 243
            L + + N        F++T  +G +++R  +D Y V   + +     F   +   V +  
Sbjct: 1030 LHTVMTNAVFRAPMSFFETTPIGRILNRFSNDIYKVDSLLGRT----FSQFLVNAVKVVF 1085

Query: 244  MVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVA-----EEQLSGV 298
             + +    +   +F   P+      + +    TS++L+     +TR       +E L G+
Sbjct: 1086 TMIVICWTTWQFIFIIGPLGVLYIYYQQYYLRTSRELRRL-DSITRSPIYSHFQETLGGM 1144

Query: 299  KTVQSFVAEQRELH----RYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVL 351
             T++ +  ++R  H    R +  +   Y   N  R  AF   E   S  +LG  +  +  
Sbjct: 1145 STIRGYNQQRRFDHINHCRIDNNMSAFYPSINANRWLAF-RLESIGSVIILGAATLSI-- 1201

Query: 352  LYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISS 411
                Y + QG+LT G +   + Y      ++  +     E+   + +  R+ + ++  S 
Sbjct: 1202 ----YRLGQGTLTAGMVGLSLSYALQITQTLNWIVRMTVEVETNIVSVERIKEYSELKSE 1257

Query: 412  ----ISPTKGQKYIPGKGDIEFKNVSFSYPTRPE-NQIFKDINIKVPPGSNVCIVGPSGR 466
                I   +   + P  GDI F + S  Y  RPE + + +D+N+ + P   + IVG +G 
Sbjct: 1258 APLVIEEKRPAAHWPDSGDIRFDHYSTRY--RPELDLVLRDVNLHIKPREKIGIVGRTGA 1315

Query: 467  GKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYG 526
            GKS++ L L R    ++G I++DG  I ++    LR ++ ++ Q+  +  GTIR+N+   
Sbjct: 1316 GKSSLTLALFRIVEASSGGIVIDGVRIDEIGLHDLRHNLSIIPQDSQVFQGTIRENV--D 1373

Query: 527  LAEPATKEEIRSVAKQCFCHNFITKF-PDGYDTMIGAQGALLSGGQRQRIAIARALIKKP 585
              E  T +EI  V +    +  +    P G    +   G+ LS GQRQ + +ARAL+   
Sbjct: 1374 PTETYTDDEIWRVLELSHLNRHVESMGPRGLLNEVNEGGSNLSVGQRQLMCLARALLVPS 1433

Query: 586  NILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSV 645
             IL+LDEAT+A+DVE++  I  T     +    TI++IAHR++TI  S+ ++VL   G V
Sbjct: 1434 KILILDEATAAVDVETDQVIQETIRSAFR--DRTILTIAHRINTIMDSDRIVVL-DGGRV 1490

Query: 646  IEAGKFKELFANPNSELCKLLTE 668
             E      L  N  S+   L  E
Sbjct: 1491 TEFDTPTNLLRNEGSQFHSLCQE 1513

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 123/532 (23%), Positives = 235/532 (44%), Gaps = 75/532 (14%)

Query: 180 VVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKV----SDGFKALI 235
           V + L S + NK L    E   T   GD+++ +  D   + + + Q +    S  F+ +I
Sbjct: 376 VKSALTSIIYNKALVLSREASATSSTGDIVNLMSVDVQKL-QDLCQFIHLLWSGPFQVVI 434

Query: 236 CGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEA----TGQLTRVA 291
           C  V +  ++  S  +  V+L    P+    + F  KI+   K LQ++      + T V 
Sbjct: 435 CL-VSLYKLLGPSMWIGVVILLVMTPL----NTFLAKIQ---KRLQKSQMGFKDERTSVI 486

Query: 292 EEQLSGVKTVQSFVAEQ-----RELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMS 346
            E L+ +K+++ +  E+      E  R +  ++ +  +G   A  + +F     ++   +
Sbjct: 487 SEILNNIKSLKLYAWEEPYKKKLEHVRNDKELKNLTKLGCFMAITSFQFNVVPFLVSCCT 546

Query: 347 FIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFD-L 405
           F  V +Y     L   L    LT F L +      +F +    +  ++   + +RLF+ L
Sbjct: 547 F-AVFVYTEDRALTVDLVFPALTLFNLLS----FPLFVIPNVMTSFIEASVSVTRLFNFL 601

Query: 406 TDHISSISPTKGQKYIPGKGDIEFK---NVSFSYPTRPENQI-FKDINIKVPPGSNVCIV 461
           T+        +    +   GD+  K   + +F +  +PE ++  K+IN +   G   C+V
Sbjct: 602 TNEELQKDSVQRLPKVTNVGDVAVKVGDDATFLWRRKPEYKVALKNINFEAKKGQLTCVV 661

Query: 462 GPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVN-CKTLRRHIGLVQQEPILMSGTIR 520
           G  G GKS +   L                D+ +V    T+   +  V Q   +M+GT++
Sbjct: 662 GRVGSGKSALIQSL--------------SGDLFRVKGFATVHGSVAYVSQVAWIMNGTVK 707

Query: 521 DNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARA 580
           +NI +G       E      K C     +    DG +T++G +G  LSGGQ+ R+++ARA
Sbjct: 708 ENILFG--HRYDPEFYDKTIKACALTIDLAVLVDGDETLVGEKGISLSGGQKARLSLARA 765

Query: 581 LIKKPNILVLDEATSALDVE-SEGAINYTFG---------QLMKSGSMTIVSIAHRLSTI 630
           +  + +  +LD+  +A+D    +  + +  G         +++ +  ++++SIA R    
Sbjct: 766 VYARADTYLLDDPLAAVDEHVGKHLLEHVLGPTGLLRTKTKILATNKISVLSIADR---- 821

Query: 631 KRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTE------KSSRSDGN 676
                 I L ++G ++E G + E+ A+ +S L KL+ +      K  + DGN
Sbjct: 822 ------IALLENGEIVEQGSYDEVTADGDSALSKLIRDYGRKDNKPKKDDGN 867

>Skud_12.52 Chr12 (107860..112545) [4686 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  147 bits (371), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 144/532 (27%), Positives = 241/532 (45%), Gaps = 46/532 (8%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQ 225
            N   IVML   S R   +L   +    +     F++T  VG +I+R  SD   V  S+  
Sbjct: 1036 NLRSIVMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQY 1095

Query: 226  KVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATG 285
              S  FK+++   V + ++    P      +F     ++  + +    R   + +  +  
Sbjct: 1096 IFSFFFKSILTYLVTVILVGYNMPWFFVFNMFLLVIYIYYQTFYIVLSRELKRLISISYS 1155

Query: 286  QLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTST---TML 342
             +  +  E L+G   + ++   +R ++     I+  YN+     F +   + S    T+ 
Sbjct: 1156 PIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQ--YNIDFVFNFRSTNRWLSVRLQTIG 1213

Query: 343  GDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYT-EYTGSSVFGL--TTFYSELMQGVGAA 399
              +     +L  + +  +  L+ G +   M Y+ E TGS  + +  T      +  V   
Sbjct: 1214 ATIVLATAMLALTTMNTKKQLSSGMVGLLMSYSLEVTGSLTWIVRTTVMIETNIVSVERI 1273

Query: 400  SRLFDLTDHISSISP-TKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNV 458
                +L     SI+P  +  +  P KG IEFKN S  Y    +  + KDIN+++ P   +
Sbjct: 1274 VEYCELPSEARSINPENRPDESWPSKGSIEFKNYSTKYRENLD-PVLKDINVRIKPCEKI 1332

Query: 459  CIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGT 518
             IVG +G GKST++L L R   PT G I++D  +IS +    LR H+ ++ Q+     GT
Sbjct: 1333 GIVGRTGAGKSTLSLALFRILEPTEGSIVIDDINISDLGLFDLRSHLAIIPQDAQAFEGT 1392

Query: 519  IRDNI-------------TYGLA------EPATKEEIRSVAKQCFCHNFITKFPDGYDTM 559
            +R N+                LA      E     EIR        +  ++   D  +  
Sbjct: 1393 VRTNLDPFNRYSEGELKKAVDLAHLGPHLEKMLDNEIRGADGAAEENGNVS---DVLNVK 1449

Query: 560  IGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMT 619
            I   G  LS GQRQ + +ARAL+ +  ILVLDEAT+++D+E++  I  T  +  K    T
Sbjct: 1450 INENGTNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTIRREFK--DRT 1507

Query: 620  IVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
            I++IAHR+ T+  S+ +IVL       + G  KE F +P+    KLL++K+S
Sbjct: 1508 ILTIAHRIDTVLDSDKIIVL-------DEGTVKE-FDSPS----KLLSDKAS 1547

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 116/510 (22%), Positives = 223/510 (43%), Gaps = 76/510 (14%)

Query: 232 KALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVA 291
           KA+I G + + +M+ I+  LS                  +K++  SK   +      +  
Sbjct: 434 KAVIGGLITMAIMMPINAYLS------------------RKVKKLSKTQMKYKDLRIKTI 475

Query: 292 EEQLSGVKTVQSFVAEQRELHRYNGA-----IRGIYNVGRKAAFINAEFFTSTTMLGDMS 346
            E L+ +K+++ +  E+  + R N       ++    +G  +  I   +     M+   +
Sbjct: 476 TEILNAIKSIKLYAWEEPMMERLNHVRNDMELQNFRKIGIVSNLIYFAWNCVPLMVTCST 535

Query: 347 FIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL--FD 404
           F +  L+ S   L  ++    L+ F +      S+++ + +  + +++   +  RL  F 
Sbjct: 536 FGLFSLF-SDTPLSPAIVFPSLSLFNI----LNSAIYSVPSMINTIIETSVSMERLKSFL 590

Query: 405 LTDHISS-----ISPTKGQKYIPGKGDIEFKNVSFSYPTRP------------------- 440
           L+D I       I P+  ++ +P    IE  N++F + ++                    
Sbjct: 591 LSDEIDDSFIERIDPSMSERTLPV---IEMNNITFLWKSKEALASGQFEGNSNADEESII 647

Query: 441 -ENQI-FKDIN-IKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVN 497
             +QI  K+I+  +   G  VC+VG  G GKST    +L       GQ+         + 
Sbjct: 648 GSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKGIL-------GQLPCMSGSKGSIP 700

Query: 498 CKTLRR--HIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDG 555
            K + R   +    QE  +M+ ++R+NI +G      K       K C     +   PDG
Sbjct: 701 PKLIIRASSLAYCSQESWIMNSSVRENILFG--HKFDKAYYDLTIKACQLLPDLKILPDG 758

Query: 556 YDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTF-GQLM 613
            +T++G +G  LSGGQ+ R+++ARA+  + +I +LD+  SA+D E S+  + Y   G+  
Sbjct: 759 DETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDVLSAVDAEVSKNIVEYVLIGKAA 818

Query: 614 KSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELF--ANPNSELCKLLTEKSS 671
              + TI+   + +  +K S+ +  L ++G +IE G ++ +    N NS+L KLL E  S
Sbjct: 819 LLKNKTIILATNTVPILKHSQMIYAL-ENGEIIEQGNYEGVMNRENTNSKLKKLLEEFDS 877

Query: 672 RSDGNDSLPPPPPNATQDKVVEQIAEKILE 701
             D          + ++  + E +  K++E
Sbjct: 878 PIDNGSKSDIQTEHRSESDMDEPLQLKVVE 907

>NCAS0C05930 Chr3 (1220180..1225153) [4974 bp, 1657 aa] {ON} Anc_4.6
          Length = 1657

 Score =  147 bits (370), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 137/535 (25%), Positives = 245/535 (45%), Gaps = 63/535 (11%)

Query: 168  ARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKV 227
            ++ V+  +L  R   ++   ++ +TLH    F+D   +G +++R   D   V + +T  +
Sbjct: 1125 SKSVLNFVLGIRASRKIFESLLYRTLHAKLGFFDATPIGRIMNRFSKDIESVDQELTPYL 1184

Query: 228  SDGFKALICGGVGIGMMVSISPE------LSGVLLFFAPPILWSASVFGKKIRHTSKDLQ 281
               F  L+     + ++  I+P+      L G L +       +AS   K+    SK   
Sbjct: 1185 EAAFFCLVQCIATMALITFITPQFLSVAILVGCLYYLVGYFYMAASRELKRFESISK--- 1241

Query: 282  EATGQLTRVAEEQLSGVKTVQSFVAEQR----ELHRY---NGAIRGIYNVGRKAAFINAE 334
                 + +   E L GV T++++  E R     LH+    N     ++   R  +F   +
Sbjct: 1242 ---SPIYQHFSETLVGVATIRAYGDESRFMLENLHKIDENNKPFFYLWVFNRWLSF-RID 1297

Query: 335  FFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQ 394
               +  + G   FI+  +      +   +    LT  + +TE        L  FY+++  
Sbjct: 1298 MIGAFVIFGAGVFILTNIKN----IDSGMAGISLTYAISFTE----GALWLVRFYADVEM 1349

Query: 395  GVGAASRLFDLTD----HISSISPTKGQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDIN 449
             + +  RL +  +           T      P  G IE K++S  Y P  P  ++ K+++
Sbjct: 1350 NMNSVERLKEYMEIEQEPYDEYKDTLLHDEWPSNGKIEVKDLSLRYAPNLP--KVIKNVS 1407

Query: 450  IKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQ 509
              V P + + IVG +G GKSTI   + R+ NP +G I +D  +I+ +N   LRR I ++ 
Sbjct: 1408 FVVEPKTKIGIVGRTGAGKSTIITAMFRFLNPESGYIKIDDVNIASINLTKLRRSITIIP 1467

Query: 510  QEPILMSGTIRDNI-------------TYGLAEPATKEEIRSVAKQCFCHNFITKFPDGY 556
            Q+P L +GTI+ N+                     T+EE+++   Q        KF +  
Sbjct: 1468 QDPTLFTGTIKLNLDPYNEFTDDAIFEALKRVNLVTEEELQNNGTQTGTSENANKFLN-L 1526

Query: 557  DTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG 616
            +  I   G+ LS GQRQ + +AR+L++ P I++LDEAT+++D  S+  I  T  +  +  
Sbjct: 1527 ENEITEGGSNLSHGQRQLVCLARSLLRNPKIILLDEATASIDYASDAKIQETIRK--EFS 1584

Query: 617  SMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
              TI++IAHRL ++   + +IV+       +AG+ KE + +P S    LL +K+S
Sbjct: 1585 QSTILTIAHRLRSVIDYDKIIVM-------DAGEVKE-YDHPYS----LLLDKNS 1627

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 73/230 (31%), Positives = 122/230 (53%), Gaps = 13/230 (5%)

Query: 427 IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI 486
           I FKNV+ ++    E+   +D+NI+  PG+   ++GP+G GK+++ L LL       G+I
Sbjct: 711 IAFKNVTVTWDNGEEDFKLRDLNIEFKPGALNVVIGPTGSGKTSLLLALLGEMCLEKGEI 770

Query: 487 LVDG----QDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQ 542
           +V      QD+  ++   L   I    Q   L++ T+R+NI +    P  +E   +V   
Sbjct: 771 IVPALNPRQDLV-IDKFGLTNSIAYCSQAAWLLNETVRNNILFN--SPYNEERYNAVIDA 827

Query: 543 CFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESE 602
           C     +        T IG +G  LSGGQ+QR+++ARAL      ++LD+  SA+D  + 
Sbjct: 828 CGLRRDLKILKASDMTEIGEKGITLSGGQKQRVSLARALYSNSKHVLLDDCLSAVDSHTA 887

Query: 603 GAI--NYTFGQLMKSGSMTIVSIAHRLS-TIKRSENVIVLGKDGSVIEAG 649
             I  N   G LM SG  T + ++H ++ T+K +E V++L ++G V + G
Sbjct: 888 LWIYDNCITGPLM-SGR-TCILVSHNIALTLKNAELVVIL-ENGRVKDQG 934

>CAGL0E03982g Chr5 (378442..383421) [4980 bp, 1659 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1659

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 139/529 (26%), Positives = 243/529 (45%), Gaps = 81/529 (15%)

Query: 183  RLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIG 242
            R+   +++K LH    F D+  +G +++R   D   V + +T  +   F  L+     I 
Sbjct: 1141 RIFKKLLSKVLHSRLRFIDSTPIGRIMNRFSKDIEAVDQELTPFLEAAFFCLVQCISTII 1200

Query: 243  MMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQE----ATGQLTRVAEEQLSGV 298
            ++  I+P+     LF A  +     + G    +TS++L+         + +   E L+GV
Sbjct: 1201 LITFITPQF----LFVAVLVCVLYYLVGYFYINTSRELKRIESITKSPIYQHFSETLTGV 1256

Query: 299  KTVQSFVAEQR-------ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVL 351
             T+++F  E R       ++   N     ++   R  AF          M+G      ++
Sbjct: 1257 ATIRAFGDEIRFIMHNLEKIDENNKPFFYLWVANRWLAF-------RIDMIG-----ALI 1304

Query: 352  LYGSYLVLQGSLTIGD-------LTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFD 404
            ++GS + +  +L   D       LT  + +TE        L  FYS +   + +  RL +
Sbjct: 1305 IFGSGVFILLNLNRIDSGMAGISLTYAISFTE----GALWLVRFYSTVEMNMNSVERLKE 1360

Query: 405  LTD------HISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPEN--QIFKDINIKVPPGS 456
              D      +  +I+ +      P +G IE K++S  Y    EN  ++ K+++  + P +
Sbjct: 1361 YMDVPQEPYNEGTITTSTNW---PTEGKIEVKDLSLRYA---ENLPRVIKEVSFDIEPHN 1414

Query: 457  NVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMS 516
             V IVG +G GKSTI   L R+  P  G I +DG DI+ ++ +TLRR I ++ Q+P L +
Sbjct: 1415 MVGIVGRTGAGKSTIITALFRFLEPETGSIKIDGIDITSIDLQTLRRSITIIPQDPTLFT 1474

Query: 517  GTIRDNITYGLAEPATK---EEIRSVAKQC-----------------FCHNFITKFPDGY 556
            GTIR N+     +P  K   EEI  V  +                     + + KF +  
Sbjct: 1475 GTIRSNL-----DPFGKYPDEEIFRVLHRVNLIDDDEMTAQSSDNNSLSSDNVNKFLN-L 1528

Query: 557  DTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG 616
            +  I   G  LS GQ+Q + +ARAL++ P +++LDEAT+++D  S+  I  T   +    
Sbjct: 1529 ENEITEGGNNLSQGQKQLMCLARALLRNPKVILLDEATASIDYASDAKIQQTIRNVFDKS 1588

Query: 617  SMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKL 665
              T+++IAHRL ++   + ++V+   G VIE  +   L  + NS    +
Sbjct: 1589 --TVLTIAHRLRSVIDYDKILVMDA-GEVIEYDQPYTLLLDKNSHFYSM 1634

 Score =  107 bits (266), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 129/556 (23%), Positives = 239/556 (42%), Gaps = 44/556 (7%)

Query: 189  MNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSI- 247
            +N    + SE   T  +G +I+ +  DA+ VS  +   +    +A++   V   ++  + 
Sbjct: 478  LNDGDKESSEKDQTSNIGAIINLMAVDAFKVSE-ICAYLHTFIEAMVMSVVAFSLLYKLL 536

Query: 248  -SPELSGVLLFFA--PPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSF 304
                + G+L+     P      S+ GK   +  K L     ++ ++  E L  ++ ++ F
Sbjct: 537  GYAAIVGILIVIGMIPVNFKLVSLMGK---YQKKALGITDKRIQKL-NEALQAIRIIKFF 592

Query: 305  VAEQRELHRYN----GAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQ 360
              E       +      I+   N     AF    +F + T++   SF  V +Y    VL 
Sbjct: 593  SWEDNFFSEIDEIREAEIQMYINKAYAWAFSAFIWFLTPTIVTGASF-TVYIYVQKQVLT 651

Query: 361  GSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKY 420
              +    L  F L  +        L+   S ++Q   +  R+ +  D           K 
Sbjct: 652  APVAFTALALFQLLKQPLDQ----LSNMLSYVIQSKVSLDRVQNFLDE-EDTQKYNQLKV 706

Query: 421  IPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYN 480
             P    + F+N + ++    ++   KD++I    G    ++GP+G GK+++ L LL    
Sbjct: 707  APDGNKLAFENATIAWSNNNQDFKLKDLDINFKIGKLNVVIGPTGSGKTSLLLALLGEMQ 766

Query: 481  PTNGQILV---DGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIR 537
              +G+I+V   D +    ++   +   I    Q   L++ T+R+NI +    P  ++  +
Sbjct: 767  LLSGRIVVPSLDARHEMLIDSDGMTNSIAYCSQSAWLLNDTVRNNILF--YSPYNEDRYK 824

Query: 538  SVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSAL 597
             V   C        F  G  T IG +G  LSGGQ+QRI++ARAL      L+LD+  SA+
Sbjct: 825  EVIIACGLKRDFELFDAGDQTEIGEKGITLSGGQKQRISLARALYSNCRHLLLDDCLSAV 884

Query: 598  DVESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELF 655
            D  +   I  N   G LM+  +  +VS  H ++   ++  ++V+ ++G +   G    L 
Sbjct: 885  DSHTAAWIYDNCITGPLMEGRTCVLVS--HNIALTLKNAELVVMLENGRITNRGDPISLL 942

Query: 656  AN---PNSELCK--LLTEKSSRSDGNDSLPPPPPNATQDKVVEQIAEKILERFPEAGQSP 710
             +      EL K  +L+  +S S+          N++ D  + ++A++   R PE  ++P
Sbjct: 943  KDGILGEDELVKSSILSRNNSTSNF--------ANSSAD--LRKMADESNARKPEESENP 992

Query: 711  DATV-KEIFKDVSSEG 725
            D    K I ++  SEG
Sbjct: 993  DLKKGKLIMEETKSEG 1008

>NDAI0B00640 Chr2 (141258..145733) [4476 bp, 1491 aa] {ON} Anc_5.10
          Length = 1491

 Score =  145 bits (365), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 148/542 (27%), Positives = 259/542 (47%), Gaps = 84/542 (15%)

Query: 168  ARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKV 227
            ++  +L  +  R    L    +++ LH    + DT  +G +++R   D    + S+  ++
Sbjct: 968  SQFTLLCAIGIRASKWLNLKAVHRILHTPMSYLDTTPLGRILNRFTKD----TDSLDNEL 1023

Query: 228  SDGFKALI---CGGVGIGMMVSISPELSGVLLFFA---PPILWSASVFGKKIRHTSKDLQ 281
            ++  + ++      VG+ +M  I       L +FA   P +    ++     + T ++++
Sbjct: 1024 TESIRLMLFQTANIVGVCVMCII------YLPWFAIAIPFLFIGFTLITDHYQSTGREVK 1077

Query: 282  --EATGQ--LTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFT 337
              EA  +  +     E L G+ T++S+ +E+R L + +  I    N   +A +++     
Sbjct: 1078 RLEAIQRSFVYNNFNEILGGMDTIKSYGSEERFLAKSDYLI----NKMNEAGYLSVALQR 1133

Query: 338  STTMLGDM-----SFIVVLLYGSYLVLQGSLTIGDLTAFMLY--------------TEYT 378
               +  D+     + I+ LL  +      ++++G L  ++L               TE  
Sbjct: 1134 WVAIFLDLVAVCFALIITLLCVTRAFHISAVSVGVLLTYVLQLPGLLNGVLRALTQTEND 1193

Query: 379  GSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSY-P 437
             +S   L ++ +EL   + AA R          +SP +     P +G IEFK+V FSY P
Sbjct: 1194 MNSAERLVSYATEL--PLEAAYRR-------PEVSPPENW---PSEGKIEFKHVDFSYRP 1241

Query: 438  TRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVN 497
              P   + KD+++ +  G  + I G +G GKSTI   L R    + G+IL+D  DISK+ 
Sbjct: 1242 GLP--IVLKDLDLDIKSGEKIGICGRTGAGKSTIMSALYRLNEISQGEILIDNVDISKLG 1299

Query: 498  CKTLRRHIGLVQQEPILMSGTIRDN----------------ITYGLAEPATKEEIRS--V 539
               LRR + ++ Q+P+L  GTIR N                +  G  E A   +I++  V
Sbjct: 1300 LYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHDDDLLWDSLVRGGAIERAALNKIKNQKV 1359

Query: 540  AKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDV 599
             K    H  + KF    D ++  +GA  S G+RQ +A+ RAL+++  +L+LDEATS++D 
Sbjct: 1360 DKDG-THADMFKF--HLDQLVEEEGANFSLGERQLLALTRALVRQAKVLILDEATSSVDY 1416

Query: 600  ESEGAINYTFGQLMKS-GSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANP 658
            E++G I     +++K  G  TI+ IAHRL+TI   + ++VL K G V E  K K LF   
Sbjct: 1417 ETDGKIQ---ARIVKEFGDCTILCIAHRLNTILNYDRILVLEK-GEVAEFEKPKVLFDQE 1472

Query: 659  NS 660
            +S
Sbjct: 1473 DS 1474

 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 118/235 (50%), Gaps = 21/235 (8%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           F DI + +  G  + +VGP G GK++    L  + N T G+I V+G D+           
Sbjct: 627 FHDITLDIKKGEFIIMVGPIGTGKTSFLNALAGFMNKTEGRIQVNG-DL----------- 674

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
             L+   P + + T+RDNI +G   P  K++   V + C     +   P G  T IG +G
Sbjct: 675 --LLCGYPWIQNATVRDNILFG--SPYDKKKYEEVLRCCSLEADLDILPAGDSTEIGERG 730

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSMTIVSI 623
             LSGGQ+ RI +AR + KK +I + D+  SA+D    +  ++  F  L+K+ +  + + 
Sbjct: 731 ITLSGGQKARINLARCVYKKKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKNETRILAT- 789

Query: 624 AHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDS 678
            H+LS ++R+  VIVLG DGS  E G   ++    N  L  LL   +  S   D+
Sbjct: 790 -HQLSLLERASRVIVLGTDGS-FEIGPV-DVLKRTNQTLINLLLFSNQESKEEDT 841

>ZYRO0D06160g Chr4 (524435..529012) [4578 bp, 1525 aa] {ON} highly
            similar to uniprot|P39109 Saccharomyces cerevisiae
            YDR135C
          Length = 1525

 Score =  144 bits (364), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 136/520 (26%), Positives = 233/520 (44%), Gaps = 43/520 (8%)

Query: 184  LRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGM 243
            L +G+ N        F++T  +G +++R  +D + V   + +     F   +   + +  
Sbjct: 1032 LHAGMANSVFRAPMRFFETTPIGRILNRFSNDIFKVDELLGRT----FSQFVNNVIKVSF 1087

Query: 244  MVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQ--EATGQLTRVA--EEQLSGVK 299
             + +    +     F  P+      + +    TS++L+  ++T +    A  +E L G+ 
Sbjct: 1088 TIIVICFTTWQFTLFVIPLGILYVYYQQYYLRTSRELRRLDSTTRSPIYAHFQESLGGLS 1147

Query: 300  TVQSFVAEQRELH----RYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVLL 352
            T++ +  ++R +H    R +  +   Y   N  R  A+   EF  +  + G  S  ++ L
Sbjct: 1148 TIRGYNQQRRFIHINQSRMDNNMSAYYPSVNANRWLAY-RLEFIGTIIIFGASSLSILRL 1206

Query: 353  YGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISS- 411
                    GSLT G +   + Y      S+  +     E+   + +  R+ + ++  S  
Sbjct: 1207 KS------GSLTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSEIPSEA 1260

Query: 412  ---ISPTKGQKYIPGKGDIEFKNVSFSYPTRPE-NQIFKDINIKVPPGSNVCIVGPSGRG 467
               I   +     P  G I+F++ S  Y  RP  + I KDIN+ + P   + IVG +G G
Sbjct: 1261 PYLIEDRRPSPNWPTDGAIQFQHYSTRY--RPGLDLILKDINLDIKPKEKIGIVGRTGAG 1318

Query: 468  KSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGL 527
            KS++ L L R      G+I++DG  I ++    LR  + ++ Q+  +  G++R+NI    
Sbjct: 1319 KSSLTLALFRLIEAAEGRIVIDGVPIDQMGLYDLRHKLSIIPQDSQVFEGSVRENI--DP 1376

Query: 528  AEPATKEEIRSVAKQCFCHNFITKF-PDGYDTMIGAQGALLSGGQRQRIAIARALIKKPN 586
             E  + EEI  V       N +     DG  T +   G  LS GQRQ + +ARAL+    
Sbjct: 1377 TEQYSDEEIWRVLDLSHLKNHVLNMGNDGLLTQLSEGGGNLSVGQRQLMCLARALLVPTK 1436

Query: 587  ILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVI 646
            ILVLDEAT+A+DVE++  +  T          TI++IAHRL+TI  S+ ++VL   G V 
Sbjct: 1437 ILVLDEATAAVDVETDKVLQETIRTAF--ADRTILTIAHRLNTIMDSDRILVLDA-GRVA 1493

Query: 647  EAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPPPNA 686
            E    + L  NP +    L  +            P P NA
Sbjct: 1494 EFDTPENLLKNPGTMFYGLCQDA--------GFVPRPSNA 1525

 Score =  108 bits (270), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 126/503 (25%), Positives = 226/503 (44%), Gaps = 47/503 (9%)

Query: 184 LRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGM 243
           L S +  K+L   SE  D    GD+++ +  D   V R   Q ++     +  G   I +
Sbjct: 385 LTSVIYKKSLVLSSEAADMSSTGDIVNLMSVD---VQR--LQDLAQWCHLIWSGPFQIIL 439

Query: 244 MVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEA----TGQLTRVAEEQLSGVK 299
            ++   +L G  ++    IL         +    K+LQ+       Q TR+  E L+ +K
Sbjct: 440 CLTSLYKLLGKSMWVGVIILIVMMPLNSSLMRVQKNLQKGQMKNKDQRTRLINEILNNMK 499

Query: 300 TVQSFV-----AEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYG 354
           +++ +       E+ E  R    ++ +  +G   A IN +F      +   +F  V +Y 
Sbjct: 500 SLKLYAWEKPYKEKLEYVRNEKELKNLTKIGVYNAIINFQFNIVPFFVSCSTF-AVFVYT 558

Query: 355 SYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFD-LTDHISSIS 413
               L   L    LT F L + +  + V  +   Y E    +G   RL+  LT+      
Sbjct: 559 EDRPLTTDLVFPALTLFGLLS-FPLAVVPLVLNSYIEASVSIG---RLYSFLTNEELQRD 614

Query: 414 PTKGQKYIPGKGDIEFK---NVSFSYPTRPENQI-FKDINIKVPPGSNVCIVGPSGRGKS 469
             +    +   GD+  K   N +F +  +PE ++  K++N +   G   C+VG  G GKS
Sbjct: 615 SVQRLPRVKNIGDVAMKLGDNATFLWKRKPEYKVALKNVNFQAKKGELNCVVGRVGSGKS 674

Query: 470 TIALLLLRYYNPTNGQILVDGQDISKVN-CKTLRRHIGLVQQEPILMSGTIRDNITYGLA 528
            +   LL               D+ +V    T+  +I  V Q   +M+GT++DNI +G  
Sbjct: 675 ALIQSLL--------------GDLFRVKGFATVHGNIAYVSQVAWIMNGTVKDNILFG-- 718

Query: 529 EPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNIL 588
                E      K C     +   PDG  T++G +G  LSGGQ+ R+++ARA+  + +I 
Sbjct: 719 HKYDPEFYEKTIKACALTIDLAILPDGDKTIVGEKGISLSGGQKARLSLARAVYSRADIF 778

Query: 589 VLDEATSALDVE-SEGAINYTFGQ--LMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSV 645
           +LD+  +A+D   S   I++  G   L+K+ +  + +  +++S +  +++V +L ++G +
Sbjct: 779 LLDDPLAAVDEHVSTHLIDHVLGPNGLLKTKTKILAT--NKISALSIADSVTLL-ENGEI 835

Query: 646 IEAGKFKELFANPNSELCKLLTE 668
           I+ G F E+    +S L KL+ E
Sbjct: 836 IQQGTFCEITKAADSPLSKLIKE 858

>SAKL0H26026g Chr8 (2287664..2292625) [4962 bp, 1653 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1653

 Score =  143 bits (361), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 137/522 (26%), Positives = 231/522 (44%), Gaps = 74/522 (14%)

Query: 188  VMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSI 247
            V+ K L+    F+D+  +G +++R   D   V + +T  V   F +L+     + ++  I
Sbjct: 1138 VLKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1197

Query: 248  SPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAE 307
            +P    V +F           +    R   +    +   + +   E L G+ T+++F  E
Sbjct: 1198 TPGFLVVAIFIGFLYYLVGYFYMAGSRELKRFESVSRSPIHQHFSETLVGITTIRAFGDE 1257

Query: 308  QR-------ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQ 360
            +R       ++   N     ++   R  AF          M+G     VV   G +++L 
Sbjct: 1258 RRFMLENLQKIDENNKPFFYLWVANRWLAF-------RIDMIGAC---VVFAAGVFILLN 1307

Query: 361  -----GSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPT 415
                   L    LT  + +TE        L   YS +   + +  RL +    +    P+
Sbjct: 1308 IKKLDSGLAGISLTYAISFTE----GALWLVRLYSNVEMTMNSVERLKEYM--VIEQEPS 1361

Query: 416  KGQKY-----IPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKST 470
                +      P +G IE  ++S  Y T    ++ K+++  V P   V IVG +G GKST
Sbjct: 1362 NDGAFNPPIEWPDQGKIEVNDLSLRYATNLP-RVIKNVSFTVDPKCKVGIVGRTGAGKST 1420

Query: 471  IALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEP 530
            I   L R+ +P  G I +D  DI+ +  K LR+ I ++ Q+P L SGT++ N+     + 
Sbjct: 1421 IITALFRFLDPETGHIKIDNVDITSIGLKRLRQSITIIPQDPTLFSGTVKSNL--DPYDE 1478

Query: 531  ATKEEIRSVAKQCFCHNFIT-----KFPDGYDTM----------------IGAQGALLSG 569
             T E+I    K+    N +T       PD  D                  I   GA LS 
Sbjct: 1479 YTDEQIFKALKRV---NLVTADELDHVPDSADNASVNSENVNKFLDLRNEITEGGANLSQ 1535

Query: 570  GQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLST 629
            GQRQ + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + G  TI++IAHRL +
Sbjct: 1536 GQRQLVCLARSLLRSPKIILLDEATASIDYSSDAKIQQTIRE--EFGDSTILTIAHRLRS 1593

Query: 630  IKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
            I   + ++V+       +AG+ +E + +P S    LL  KSS
Sbjct: 1594 IIDYDKILVM-------DAGEVRE-YDHPYS----LLLNKSS 1623

 Score = 87.8 bits (216), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 119/234 (50%), Gaps = 11/234 (4%)

Query: 423 GKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPT 482
            +  I F+N +F++  +  +   K++N++   G    ++G +G GK+++ + LL   +  
Sbjct: 688 SRNKIAFENATFAWDKKNPSFKLKNLNVEFKLGKLNVVIGSTGSGKTSLLMGLLGEMDLI 747

Query: 483 NGQILV---DGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSV 539
            G++ V   D ++   +    +   I    Q   L++ T+R+NI +    P  +   ++V
Sbjct: 748 EGKVYVPSLDPREELVIESDGMTNSIAYCSQAAWLLNDTVRNNILFN--SPYNETRYKAV 805

Query: 540 AKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDV 599
            + C           G  T IG +G  LSGGQ+QR+++ARAL      ++LD+  SA+D 
Sbjct: 806 VEACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHVLLDDCLSAVDS 865

Query: 600 ESEGAI--NYTFGQLMKSGSMTIVSIAHRLS-TIKRSENVIVLGKDGSVIEAGK 650
            +   I  N   G LM+  +  +VS  H ++ T+K +E V+VL  +G + + G+
Sbjct: 866 HTALWIYENCITGPLMQGRTCILVS--HNVALTLKNAEWVVVL-DNGRIKDQGE 916

>Kpol_1033.28 s1033 complement(69924..74519) [4596 bp, 1531 aa] {ON}
            complement(69924..74519) [4596 nt, 1532 aa]
          Length = 1531

 Score =  143 bits (360), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 134/512 (26%), Positives = 232/512 (45%), Gaps = 52/512 (10%)

Query: 184  LRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGM 243
            L S +++  L     F++T  +G +++R  +D Y +   + +  S  F       V +  
Sbjct: 1033 LHSSMVSSILRAPMTFFETTPIGRILNRFSNDVYKIDEVLGRSFSQFF----VNAVKVSF 1088

Query: 244  MVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQE----ATGQLTRVAEEQLSGVK 299
             + +    +   +    P+      + +    TS++L+         +    +E L G+ 
Sbjct: 1089 TILVICWNTWQFILLVIPMGVLYLYYQQYYLRTSRELRRLDSITKSPIYAHFQESLGGLA 1148

Query: 300  TVQSFVAEQRELH----RYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVLL 352
            T++ +  ++R +H    R +  +   Y   N  R  A+   EF  S  + G  S  ++ L
Sbjct: 1149 TIRGYEQQKRFIHINQARVDNNMSAYYPSINSNRWLAY-RLEFLGSLIIFGAASLSILKL 1207

Query: 353  YGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISS- 411
                    G+LT G +   + Y      S+  +     E+   + +  R+ +  +  S  
Sbjct: 1208 R------DGTLTAGMIGLSLSYALQVTQSLNWIVRMTVEVETNIVSVERIKEYAELKSEA 1261

Query: 412  ---ISPTKGQKYIPGKGDIEFKNVSFSYPTRPE-NQIFKDINIKVPPGSNVCIVGPSGRG 467
               I   +  +  P +G I+F+N S  Y  RP+ + + K+I++ + P   V IVG +G G
Sbjct: 1262 PLIIEEKRPSENWPERGAIKFENYSTRY--RPDLDLVLKNISLDIKPQEKVGIVGRTGAG 1319

Query: 468  KSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGL 527
            KS++ L L R      G I+VDG +IS++    LR  + ++ Q+  +  GTIR+NI    
Sbjct: 1320 KSSLTLALFRIIEAAEGSIIVDGLNISEIGLYDLRHKLSIIPQDSQVFEGTIRENI---- 1375

Query: 528  AEPA---TKEEIRSVAKQCFCHNFITKFPD---------GYDTMIGAQGALLSGGQRQRI 575
             +P    T E+I +  +       I +  +            T +   G  LS GQRQ +
Sbjct: 1376 -DPTNIYTDEQIWNALELSHLKQHILRMNEESVNGSENNALYTRVTEGGNNLSVGQRQLM 1434

Query: 576  AIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSEN 635
             +ARAL+    IL+LDEAT+A+DVE++  I  T     K    TI++IAHRL+TI  S+ 
Sbjct: 1435 CLARALLVPSKILILDEATAAVDVETDSLIQETIRTAFK--DRTILTIAHRLNTIMDSDK 1492

Query: 636  VIVLGKDGSVIEAGKFKELFANPNS---ELCK 664
            ++VL K G V E    + L  N  S    LC+
Sbjct: 1493 IVVLDK-GEVAEFDTPQNLLKNTESLFYSLCE 1523

 Score =  128 bits (322), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 112/409 (27%), Positives = 189/409 (46%), Gaps = 46/409 (11%)

Query: 288 TRVAEEQLSGVKTVQSFVAEQ-----RELHRYNGAIRGIYNVGRKAAFINAEFFTSTTML 342
           TRV  E L+ +K+++ +  EQ      E  R    ++ +  +G   A  N +F      L
Sbjct: 485 TRVINEILNNIKSLKLYAWEQPYKEKLEHVRNEKELKNLTRIGVFNAMTNFQF-NLVPFL 543

Query: 343 GDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL 402
              S   V +Y     L   L    LT F L T    +    +T F    ++   + SRL
Sbjct: 544 VSCSTFAVFVYIEDKPLTTDLVFPALTLFNLLTFPLAALPIVITAF----IEASVSMSRL 599

Query: 403 FDL-------TDHISSISPTKGQKYIPGKGDIEFK---NVSFSYPTRPENQI-FKDINIK 451
           F         TD I  + P K Q      GDI      N +F +  +PE ++  K+I  +
Sbjct: 600 FSFMTNEELQTDAIQRLPPVKKQ------GDIAVNIGDNATFLWKRKPEYKVALKNIEFQ 653

Query: 452 VPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVN-CKTLRRHIGLVQQ 510
              G   CIVG  G GKS     +L               D+ +V    T+  ++  V Q
Sbjct: 654 AKKGELACIVGKVGSGKSAFIQSIL--------------GDLFRVKGFATIHGNVAYVSQ 699

Query: 511 EPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGG 570
            P +M+GT++DNI +G      +E      + C     ++  PDG  T++G +G  LSGG
Sbjct: 700 LPWIMNGTVKDNILFG--HKYNQEFYEKTLRACALTIDLSILPDGDQTLVGEKGISLSGG 757

Query: 571 QRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSMTIVSIAHRLST 629
           Q+ R+++ARA+  + ++ +LD+  +A+D   S+  I +  G      + T V   +++S 
Sbjct: 758 QKARLSLARAVYARADVYLLDDPLAAVDEHVSKHLIQHVIGPNGLLHTKTRVLATNKISV 817

Query: 630 IKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDS 678
           +  ++N+ +L  DG +++ G + E+  N NS LCKL++E  ++++ N S
Sbjct: 818 LSIADNITLL-DDGEIVQQGTYNEVTDNINSPLCKLISEYGNKNNVNSS 865

>Suva_8.16 Chr8 complement(29573..34372) [4800 bp, 1599 aa] {ON}
            YHL035C (REAL)
          Length = 1599

 Score =  143 bits (360), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 141/518 (27%), Positives = 235/518 (45%), Gaps = 85/518 (16%)

Query: 183  RLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIG 242
            ++   +++  LH    F+D   +G +++R   D   V + +T  +      LI     I 
Sbjct: 1079 KIFDNMLDLVLHAKIRFFDVTPIGRIMNRFAKDIEGVDQELTPYLEVTMFCLIQCTSIIF 1138

Query: 243  MMVSISPEL------SGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLS 296
            ++  I+P          +L +F      +AS   K+I   +K        + +   E L 
Sbjct: 1139 LITIITPHFLIVAVVVFILYYFVGMWYLTASRELKRIDSITK------SPIFQHFSETLV 1192

Query: 297  GVKTVQSFVAEQR----ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLL 352
            GV T+++F  E+R     L + +   R  + +     +    F     ++G     +VL 
Sbjct: 1193 GVCTIRAFGDEKRFILENLDKIDQNNRAFFYLSVAVKW----FAFRVDIIGAF---IVLA 1245

Query: 353  YGSYLVLQ-GSLTIG----DLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL----- 402
             GS++++  G++  G     LT  +L+T+        L   YS     + +  RL     
Sbjct: 1246 SGSFILINIGNIDSGLAGISLTYAILFTD----GALWLVRLYSTFEMSMNSVERLKEYSS 1301

Query: 403  ------FDLT-DHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPG 455
                  FD   DHI  +     Q   P  G IE  N+S  Y +     + K+++  + P 
Sbjct: 1302 IEQENYFDYNKDHIQELQ----QSSWPEHGQIEVDNLSLRYASNLP-PVIKNVSFTIEPQ 1356

Query: 456  SNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILM 515
            S V IVG +G GKSTI   L R   P  G I +DG DIS+++  TLRR I ++ Q+PIL 
Sbjct: 1357 SKVGIVGRTGAGKSTIITALFRLLEPETGHIKIDGYDISQIDLVTLRRAITIIPQDPILF 1416

Query: 516  SGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFIT-------------------KFPDGY 556
            +GTI+ N+     +P  + + + + K     N I+                   KF +  
Sbjct: 1417 TGTIKSNV-----DPCDEYDNKKIFKVLSQVNLISTGEMEAAQNMGDDSNTARNKFVN-L 1470

Query: 557  DTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTF-GQLMKS 615
             T I   G  +S G+RQ + IAR+L+++P I++LDEATS++D ES+  I      +  KS
Sbjct: 1471 QTEITEGGQNISQGERQLLFIARSLLREPKIILLDEATSSIDYESDHLIQGIIRNEFNKS 1530

Query: 616  GSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKE 653
               TI++IAHRL ++   + V+V+       +AG+ KE
Sbjct: 1531 ---TILTIAHRLRSVIDYDRVLVM-------DAGEIKE 1558

 Score = 83.2 bits (204), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 115/478 (24%), Positives = 211/478 (44%), Gaps = 55/478 (11%)

Query: 205 VGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMM-----VSISPELSGVLLFFA 259
           +G +I+ +  D++ VS  ++       +A+I   + +G++     +S    +S +L+ F 
Sbjct: 447 LGTIINLISIDSFKVSE-ISTYFYMTVQAIIMVLIVVGLLFKFLGISALAGISIILMMF- 504

Query: 260 PPILWSASVFGKKIRHTSKDLQEATGQLT--RVAE--EQLSGVKTVQSFVAEQR-----E 310
           P     A + GK         Q++  Q T  R+A+  E L  ++ V+ F  E       +
Sbjct: 505 PLNFRLAELLGK--------FQKSALQCTDKRIAKLNECLQNIRIVKYFAWENNISKDIK 556

Query: 311 LHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTA 370
             R N  +R ++      A  +  +F + T++  ++F  + ++  +  L   L    L+ 
Sbjct: 557 SIRQN-ELRFLFQKALVWALSSFLWFVTPTLVTGVTF-AIYIFVQHQELNAPLAFTTLSL 614

Query: 371 FMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKY-----IPGKG 425
           F L      + +  L+   S + Q + +  R+      +  I+    +KY      P + 
Sbjct: 615 FTL----LKTPLDQLSNMLSFMNQSIVSLDRI------VKFINEDDTEKYNQLTVSPDEN 664

Query: 426 DIEFKNVSFSY-PTRPENQIFK--DINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPT 482
            IEFKN + ++     ++ IFK   +NI    G    I+G +G GKS + + LL   +  
Sbjct: 665 KIEFKNATLTWNENDKDSTIFKLCGLNITFQIGKLNLILGSTGSGKSALLMGLLGELHLI 724

Query: 483 NGQILVDG----QDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRS 538
           +G I V G     D+   +   L        Q   L++ T+++NI +  A    +   + 
Sbjct: 725 SGSITVPGLEPRHDLIP-DHNGLTNSFAYCSQSAWLLNDTVKNNIIFNGAYDDVR--YKE 781

Query: 539 VAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALD 598
           V   C     +   P G  T IG +G  LSGGQ+QRI++ARA+      ++LD+  SA+D
Sbjct: 782 VIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAVYSNAKHVLLDDCLSAVD 841

Query: 599 VESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKEL 654
             +   I  N   G +M+  + T + + H +S   R     V+ ++G V   G  K+L
Sbjct: 842 SHTAVWIYENCITGPIME--NRTCILVTHNVSLTIREAYFAVILENGKVKNQGTIKQL 897

>ZYRO0G07612g Chr7 complement(601181..606268) [5088 bp, 1695 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1695

 Score =  143 bits (360), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 130/510 (25%), Positives = 233/510 (45%), Gaps = 53/510 (10%)

Query: 188  VMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSI 247
            ++ K LH    F+D+  +G +++R   D   V + +T      F +L+     + ++  I
Sbjct: 1182 LLQKVLHAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFFEGAFYSLVTCLSTVVLITFI 1241

Query: 248  SPE------LSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTV 301
            +P+      +  VL +F      + S   K++   S+        + +   E L GV T+
Sbjct: 1242 TPQFLIVAVIVAVLYYFIGYFYLAGSRELKRLDSISR------SPIYQHFSETLVGVTTI 1295

Query: 302  QSFVAE----QRELHRYNGAIRGIYN--VGRKAAFINAEFFTSTTMLGDMSFIVVLLYGS 355
            ++F  E    Q  LH+ +   R  +   V  +   +  +   S  + G   FI++ +   
Sbjct: 1296 RAFGDESRFIQENLHKIDENNRPFFYLWVANRWLAMRIDLIGSLVVFGAGVFILLNIDH- 1354

Query: 356  YLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL--FDLTDHISSIS 413
               +   +    LT  + +TE        L   YS +   + +  RL  + + +      
Sbjct: 1355 ---IDAGMAGISLTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMVVEQEPYNQ 1407

Query: 414  P--TKGQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKST 470
            P  T    + P  G +E  +VS  Y P  P  ++ K+++  V P S V +VG +G GKST
Sbjct: 1408 PIMTPPSDW-PQHGRVEMSDVSLRYAPGLP--RVIKNVSFTVEPKSKVGVVGRTGAGKST 1464

Query: 471  IALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNI------- 523
            I   L R+ +P  G I +D  DIS ++ + LRR I ++ Q+P L +GTI+ N+       
Sbjct: 1465 IITALFRFLDPETGHIKIDNVDISLIDLQMLRRSITIIPQDPTLFTGTIKSNLDPYDEYS 1524

Query: 524  ------TYGLAEPATKEEI--RSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRI 575
                          ++EE+   ++         + KF D  ++ I   G  LS GQRQ +
Sbjct: 1525 DEDIFAALKRVNLVSQEELDRSNIDAASVGSENVNKFLD-LNSEINEGGGNLSQGQRQLV 1583

Query: 576  AIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSEN 635
             +AR+L++ P I++LDEAT+++D +S+  I  T  +  +    TI++IAHRL ++   + 
Sbjct: 1584 CLARSLLRSPKIILLDEATASIDYQSDAKIQETIRKEFQGN--TILTIAHRLRSVIDYDK 1641

Query: 636  VIVLGKDGSVIEAGKFKELFANPNSELCKL 665
            ++V+ + G V E      L  N NS+   +
Sbjct: 1642 ILVMDQ-GEVKEYDHPYSLLLNKNSQFYSM 1670

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 117/233 (50%), Gaps = 9/233 (3%)

Query: 422 PGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNP 481
           PG   + F+N + S+ +  ++   +++NI    G    ++GP+G GK++I + LL     
Sbjct: 741 PGGQKLGFENATISWDSEKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSILMALLGEMKL 800

Query: 482 TNGQILV---DGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRS 538
            NG I+V   D + +  ++   +   I    Q   L++ T+R+NI +    P ++     
Sbjct: 801 LNGNIVVPSLDPRALLPIDADGMTNSIAYCSQAAWLLNDTVRNNILFN--SPYSEARYND 858

Query: 539 VAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALD 598
           V + C           G  T IG +G  LSGGQ+QRI++AR+L      L+LD+  SA+D
Sbjct: 859 VIEACGLKRDFEILSAGDMTEIGERGITLSGGQKQRISLARSLYSNSRHLLLDDCLSAVD 918

Query: 599 VESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAG 649
             +   I  N   G LM+    T + I+H ++   R+  ++VL ++G V E G
Sbjct: 919 SHTASWIYDNCITGPLMQ--GRTCILISHNIALTLRNAELVVLLENGQVKEQG 969

>YLL048C Chr12 complement(41280..46265) [4986 bp, 1661 aa] {ON}
            YBT1Transporter of the ATP-binding cassette (ABC) family
            involved in bile acid transport; similar to mammalian
            bile transporters
          Length = 1661

 Score =  143 bits (360), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 138/510 (27%), Positives = 230/510 (45%), Gaps = 61/510 (11%)

Query: 188  VMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSI 247
            ++NK LH    F+D    G +++R   D   + + +T  +   F +LI     + ++  I
Sbjct: 1141 ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFI 1200

Query: 248  SPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAE 307
            +P+   V +  +    +    +    R   +    +   + +   E L GV T+++F  E
Sbjct: 1201 TPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDE 1260

Query: 308  ----QRELHRY---NGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQ 360
                Q  LH+    N     ++   R  AF   +   S  + G   FI+  +      L 
Sbjct: 1261 GRFMQENLHKIDENNKPFFYLWVANRWLAF-RIDMIGSLVIFGAGLFILFNINN----LD 1315

Query: 361  GSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKY 420
              +    LT  + +TE        L   YSE+   + +  R+ +  +      P    K 
Sbjct: 1316 SGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYME--IEQEPYNEHKE 1369

Query: 421  IP-----GKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALL 474
            IP       G IE  ++S  Y P  P  ++ K+++  V   S + IVG +G GKSTI   
Sbjct: 1370 IPPPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAGKSTIITA 1427

Query: 475  LLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNI----------- 523
            L R+  P  G I +D  DIS V+ + LRR I ++ Q+P L SGTI+ N+           
Sbjct: 1428 LFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRQI 1487

Query: 524  -----------TYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQR 572
                          L + AT+E   + A      N + KF D   + I   G+ LS GQR
Sbjct: 1488 FEALKRVNLISEEQLQQGATRET-SNEASSTNSEN-VNKFLD-LSSEISEGGSNLSQGQR 1544

Query: 573  QRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKR 632
            Q + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + GS TI++IAHRL ++  
Sbjct: 1545 QLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQ-GS-TILTIAHRLRSVID 1602

Query: 633  SENVIVLGKDGSVIEAGKFKELFANPNSEL 662
             + ++V+       +AG+ KE + +P S L
Sbjct: 1603 YDKILVM-------DAGEVKE-YDHPYSLL 1624

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 115/233 (49%), Gaps = 9/233 (3%)

Query: 422 PGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNP 481
           P      F+N + S+    ++   KD+NI+   G    ++GP+G GK+++ + LL     
Sbjct: 689 PNGNRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 482 TNGQILVDGQDISK---VNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRS 538
            NG+++V   +  +   V+       I    Q   L++ T+++NI +    P  +   ++
Sbjct: 749 LNGKVVVPALEPRQELIVDANGTTNSIAYCSQAAWLLNDTVKNNILFN--SPFNEARYKA 806

Query: 539 VAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALD 598
           V + C           G  T IG +G  LSGGQ+QR+++ARAL      ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 599 VESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAG 649
             +   I  N   G LM+  +  +VS  H ++   R+  ++VL +DG V + G
Sbjct: 867 SHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>CAGL0E03355g Chr5 complement(307479..312086) [4608 bp, 1535 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015w BPT1 or uniprot|P39109 Saccharomyces cerevisiae
            YDR135c YCF1
          Length = 1535

 Score =  142 bits (359), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 140/534 (26%), Positives = 243/534 (45%), Gaps = 53/534 (9%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQ 225
            N   + ML   S R   +L + +    +     F++T   G +I+R  SD   V  ++  
Sbjct: 1010 NMRSLTMLLYGSLRGSRKLHNKMAKTIMRSPMSFFETTPTGRIINRFSSDMDSVDTTLQN 1069

Query: 226  KVSDGFKALICGGVGIGMMVSISPEL----SGVLLFFAPPILWSASVFGKKIRHTSKDLQ 281
              S  F++++   + + ++    P      +G+L+ +    L+  S +    R   +   
Sbjct: 1070 VFSLFFRSILDYIITVILVTFNMPLFFLLNAGLLVIY----LYYQSFYIVLSRELKRLTS 1125

Query: 282  EATGQLTRVAEEQLSGVKTVQSFVAEQRELH----RYNGAIRGIYNVGRKAAFINAEFFT 337
             +   +  +  E LSG  T+ ++   +R  H    R   +I   +N      +++     
Sbjct: 1126 ISYSPIMSLMGESLSGHFTISAYEQIRRFSHLNYERIQFSINCFFNYRSSNRWLSVR--- 1182

Query: 338  STTMLGDMSFIVVLLYG----SYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELM 393
                L  +  ++VL  G    S L     L+ G +   M Y     SS+  +      + 
Sbjct: 1183 ----LQSIGALIVLSTGLLALSSLGTDHQLSSGLVGLLMSYALQVTSSLIWIIRSSVLIE 1238

Query: 394  QGVGAASRLFDLTDHISSISPTKGQKY-----IPGKGDIEFKNVSFSYPTRPENQIFKDI 448
              + +  R+ +  D IS  +P   +++      P +G IEFKN S SY    +  + K I
Sbjct: 1239 TNIVSVERIVEYCD-ISPEAPEVKEEHRLDDNWPNQGQIEFKNYSTSYRENLD-PVLKHI 1296

Query: 449  NIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLV 508
            N+ + PG  + +VG +G GKST+++ L R   PT G I +D  DI+ +  + LR HI ++
Sbjct: 1297 NLVISPGEKIGVVGRTGAGKSTLSMALFRLLEPTAGTISIDNIDITSIGLRDLRSHIAII 1356

Query: 509  QQEPILMSGTIR-----------DNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDG-- 555
             Q+     GTIR           D++ + +     K  + ++AK+    N  +++ D   
Sbjct: 1357 PQDAQAFEGTIRSNLDPFEKFSDDDLWHAIELSHLKFHLETIAKEI---NDDSEYSDRSR 1413

Query: 556  ----YDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQ 611
                 D  +   G+ LS GQ+Q + +ARAL+ K  ILVLDEAT+++DVE++  I  T  +
Sbjct: 1414 LESPLDIPVREAGSNLSVGQKQLLCLARALLNKSKILVLDEATASVDVETDKIIQETIRK 1473

Query: 612  LMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKL 665
              +    TI++IAHRL T+  S+ +IVL   G V E  K + L    +S   KL
Sbjct: 1474 --EFADRTILTIAHRLDTVFDSDRIIVLD-GGEVKEFDKPETLLEQKDSIFYKL 1524

 Score = 87.8 bits (216), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 120/231 (51%), Gaps = 27/231 (11%)

Query: 449 NIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI-LVDGQDIS-----KVNCKTLR 502
           N +VP  S +C+VG  G GKSTI   +L       GQ+  + G +       ++N  T  
Sbjct: 639 NFEVPKSSLICVVGRVGAGKSTILKCIL-------GQLPCISGNNDHLSPQFQINATT-- 689

Query: 503 RHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGA 562
             +    QE  +M+ +++DNI +G      +   ++  K C     I   PDG +TM+G 
Sbjct: 690 --VAYCPQEAWIMNASVKDNILFG--HKYDEAFYKATIKACQLLPDIKVLPDGDETMVGE 745

Query: 563 QGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQ---LMKSGSM 618
           +G +LSGGQ+ R+++ARA+  + ++ +LD+  SA+D E  +  I     +   L+K  S 
Sbjct: 746 KGIVLSGGQKTRLSLARAVYSRADLYLLDDILSAVDTEVCKTIIKEVLDEKTGLLKDKS- 804

Query: 619 TIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFAN-PNSELCKLLTE 668
            IV   + +S +K S  + +L ++ S+ + G + ++  N  +S+L  +L E
Sbjct: 805 -IVLATNTISVLKHSTKIYLL-ENKSIAQEGNYDDIMNNQQDSKLKNILHE 853

>ZYRO0G22176g Chr7 (1822665..1827377) [4713 bp, 1570 aa] {ON} similar
            to uniprot|P14772 Saccharomyces cerevisiae YLL015W BPT1
            ABC type transmembrane transporter of MRP/CFTR family
            found in vacuolar membrane involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates along with Ycf1p
          Length = 1570

 Score =  142 bits (357), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 131/496 (26%), Positives = 225/496 (45%), Gaps = 58/496 (11%)

Query: 199  FYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFF 258
            F+++  +G +I+R  SD   V R++    +  FK ++   V I ++    P      L F
Sbjct: 1077 FFESTPIGRIINRFSSDMSTVDRNLKYNFAFFFKCVLDYFVTILLIGYNMPWF----LVF 1132

Query: 259  APPILWSASVFGKKIRHTSKDLQE----ATGQLTRVAEEQLSGVKTVQSFVAEQRELHRY 314
               +L     +       S++L+     A   +  +  E L G   + +F    R   R+
Sbjct: 1133 NAGLLVVYVYYQVFYVTLSRELKRLSSTAFSPIMSLFSETLGGHMVITAF----RHSERF 1188

Query: 315  NGAIRGIYNVGRKAAFINAEFFTSTT----------MLGDMSFIVVLLYGSYLVLQGSLT 364
            +       N  +    I+A+F   +T          + G M  I  LL  + +  +  +T
Sbjct: 1189 H-----FLNFNKTQFQIDAQFNLRSTNRWLSIRLQIIGGAMVLITALLTLATIGTKKQMT 1243

Query: 365  IGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISS----ISPTKGQKY 420
             G +   M Y     +S+  +    + +   + +  R+++     S     I  ++ +K 
Sbjct: 1244 AGLVGLLMSYVLQVTNSLMWIVRMTTMIETNIISVERIYEYCQLPSEAPAIIESSRPEKS 1303

Query: 421  IPGKGDIEFKNVSFSYPTRPE-NQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYY 479
             P  G+I FK+ S  Y  RPE + + K IN+ + P   + +VG +G GKS+++L L R  
Sbjct: 1304 WPSMGEIIFKDYSTKY--RPELDPVLKKINLSIKPREKIGVVGRTGAGKSSLSLALFRLL 1361

Query: 480  NPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNI----TYGLAEPATKEE 535
              T G I +DG DISK+    LR H+ ++ Q+     GT+R N+     Y + E     E
Sbjct: 1362 ESTGGSIEIDGVDISKIGLYDLRSHLSIIPQDAQAFEGTVRSNLDPFNQYSVQEIWKAVE 1421

Query: 536  IRSVAKQCFCHNFITKFPD---------GYDTMIGAQGALLSGGQRQRIAIARALIKKPN 586
            +  + K         + PD           D  I   G  +S GQRQ + ++RAL+ K  
Sbjct: 1422 LAHL-KPHIIKMMTDEDPDKSSPEDEISALDVKISENGNNMSMGQRQLLCLSRALLSKSK 1480

Query: 587  ILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVI 646
            +LVLDEAT+A+D+E++  I  T     +    TI++IAHR+ T+  S+ ++VL K     
Sbjct: 1481 VLVLDEATAAVDMETDQIIQETIRNEFQDK--TILTIAHRIDTVLDSDKILVLDK----- 1533

Query: 647  EAGKFKELFANPNSEL 662
              G+ KE F +P++ L
Sbjct: 1534 --GEVKE-FESPDTLL 1546

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 71/258 (27%), Positives = 127/258 (49%), Gaps = 28/258 (10%)

Query: 455 GSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTL--RRHIGLVQQEP 512
           G+  C+VG  G GKST+   +L       GQ+         ++ + L   R +    Q P
Sbjct: 667 GALTCVVGRVGSGKSTLLRAIL-------GQLPCRSGPKEFISPEILVRARSVAYCPQAP 719

Query: 513 ILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQR 572
            +M+ +I+DNI +G     T   +    K C     +    +G +T++G +G  LSGGQ+
Sbjct: 720 WVMNASIKDNILFGHRYDETYYNL--TIKACQLIPDLKILSEGDETLVGEKGISLSGGQK 777

Query: 573 QRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQ---LMKSGSMTIVSIAHRLS 628
            R+++ARA+  + ++ ++D+  SA+D E S+  I+   G+   L+K    TI+   + +S
Sbjct: 778 ARLSLARAVYSRADLYLMDDILSAVDAEVSKNIIDKVLGEENGLLKHK--TIILTTNAVS 835

Query: 629 TIKRSENVIVLGKDGSVIEAGKFKELFAN-PNSELCKLLTEKSSRSDGNDSLPPPPPNAT 687
            +K S N+I   + G ++E G +++  +   +S L KL+ E        D+    P +  
Sbjct: 836 VLKHS-NMIYALQGGRIVEEGTYEQAVSRGDDSVLQKLIKEF-------DTFAENPSDKK 887

Query: 688 QDKVVEQIAEKILERFPE 705
           +D+  E  +  I E F E
Sbjct: 888 KDE--ENDSHSISEDFEE 903

>Kwal_34.15770 s34 complement(51755..56065) [4311 bp, 1436 aa] {ON}
            YLL048C (YBT1) - bile acid transporter of ABC family
            [contig 274] PARTIAL
          Length = 1436

 Score =  141 bits (356), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 133/506 (26%), Positives = 225/506 (44%), Gaps = 52/506 (10%)

Query: 188  VMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSI 247
            ++ K L+    F+D+  +G +++R   D   V + +T  V   F +L+     + ++  I
Sbjct: 920  ILKKVLYAKLRFFDSTPIGRIMNRFSKDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 979

Query: 248  SPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAE 307
            +P    V +F A         +    R   +    +   + +   E L G+ T+++F  E
Sbjct: 980  TPGFFVVAIFIAILYYLVGYFYMAGSRELKRFESISRSPIHQHFSETLVGITTIRAFGDE 1039

Query: 308  QR-------ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQ 360
            +R       ++   N     ++   R  AF          M+G     V+   G +++L 
Sbjct: 1040 RRFMQENLEKIDENNKPFFYLWVANRWLAF-------RIDMIGA---CVIFAAGIFVLLN 1089

Query: 361  -GSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTD-----HISSISP 414
              SL  G     + Y          L   YS +   + +  RL +  +     H  S + 
Sbjct: 1090 IKSLDSGLAGISLTYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQS-TH 1148

Query: 415  TKGQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIAL 473
            T   ++ P +G IE  ++S  Y P+ P  ++ K+++  V P   V IVG +G GKSTI  
Sbjct: 1149 TPPPEW-PSQGKIEVNDLSLRYAPSLP--KVIKNVSFTVDPNCKVGIVGRTGAGKSTIIT 1205

Query: 474  LLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNI---------- 523
             L R+ +P +G I +D  DI+ V  K LR+ I ++ Q+P L +GT++ N+          
Sbjct: 1206 ALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDGQ 1265

Query: 524  ---TYGLAEPATKEEIRSV-----AKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRI 575
                       T+EE+ S               + KF    D  I   GA LS GQRQ +
Sbjct: 1266 IFEALKRVNLLTEEELNSAGSPAPGNSSIHSENVNKFLR-LDNEITEGGANLSQGQRQLV 1324

Query: 576  AIARALIKKPNILVLDEATSALDVESEGAINYTF-GQLMKSGSMTIVSIAHRLSTIKRSE 634
             +AR+L++ P +++LDEAT+++D  S+  I  T  G+   S   TI++IAHRL +I   +
Sbjct: 1325 CLARSLLRSPKVMLLDEATASIDYTSDARIQQTIRGEFSNS---TILTIAHRLRSIIDYD 1381

Query: 635  NVIVLGKDGSVIEAGKFKELFANPNS 660
             ++V+   G V E      L  N NS
Sbjct: 1382 KILVMDA-GEVKEYDHPYSLLLNKNS 1406

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 119/234 (50%), Gaps = 9/234 (3%)

Query: 427 IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI 486
           I F+N +FS+  +  +   K+++I+   G    ++GP+G GK+++ + LL   +   G++
Sbjct: 475 IGFENATFSWDRKNPDFKLKNMSIEFRLGKLNVVIGPTGSGKTSLLMGLLGEMDLLEGKV 534

Query: 487 L---VDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQC 543
               +D ++   V    +   I    Q   L++ T+++NI +  + P  +    +V + C
Sbjct: 535 YAPCLDPREDLIVENDGMTNSIAYCSQGAWLLNDTVKNNILF--SSPFNEARYDAVVEAC 592

Query: 544 FCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEG 603
                      G  T IG +G  LSGGQ+QR+++ARAL      L+LD+  SA+D  +  
Sbjct: 593 GLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSHTAL 652

Query: 604 AI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELF 655
            I  N   G LM+  +  +VS  H ++   ++ + +V  ++G V + G+  ELF
Sbjct: 653 WIYENCITGPLMEGRTCILVS--HNVALTLKNADWVVFMENGKVKDQGEPLELF 704

>Suva_10.59 Chr10 (121460..126142) [4683 bp, 1561 aa] {ON} YLL015W
            (REAL)
          Length = 1561

 Score =  141 bits (356), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 135/532 (25%), Positives = 239/532 (44%), Gaps = 46/532 (8%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQ 225
            N   I+ML   S R   +L   +    +     F++T  VG +I+R  SD   V  S+  
Sbjct: 1036 NLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQY 1095

Query: 226  KVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATG 285
              S  FK+++   V I ++    P      +F     ++  + +    R   + +  +  
Sbjct: 1096 VFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVIYIYYQTFYIVLSRELKRLISISYS 1155

Query: 286  QLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDM 345
             +  +  E L+G   + ++   +R ++     I+   ++      IN         +G  
Sbjct: 1156 PIMSLMSESLNGYSIIDAYNHYERFIYLNYDKIQSNIDLVFNFRSINRWLSVRLQTIGAT 1215

Query: 346  SFIVVLLYGSYLV-LQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFD 404
              +   L     +  +  L+ G +   M Y+    SS+  +      +   + +  R+ +
Sbjct: 1216 IVLATALLALATINTKNQLSSGMVGLLMAYSFEVTSSLTWIVRTTVMIETNIVSVERIVE 1275

Query: 405  LTD---HISSISPTKG-QKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCI 460
              +      SI+P K   +  P +G IEFKN S  Y    +  + KDIN+ + P   + I
Sbjct: 1276 YCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTKYRENLD-PVLKDINVSIQPCEKIGI 1334

Query: 461  VGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIR 520
            VG +G GKST++L L R   P+ G+I++D  +IS++    LR ++ ++ Q+     GT+R
Sbjct: 1335 VGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISELGLFDLRSNLAIIPQDAQAFEGTVR 1394

Query: 521  DNITYGLAEP---ATKEEIRSVAKQCFCHNFITKF------------------PDGYDTM 559
             N+     +P    +++E++   +     + + K                    D  D  
Sbjct: 1395 TNL-----DPFNRYSEDELKRAIELAHLKSHLEKMLGNEAENNDINVEERGNAKDILDVK 1449

Query: 560  IGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMT 619
            I   G+ LS GQRQ + +ARAL+    ILVLDEAT+++D+E++  I  T  +  K    T
Sbjct: 1450 INENGSNLSVGQRQLLCLARALLSHSKILVLDEATASVDMETDKIIQDTIRREFKDR--T 1507

Query: 620  IVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
            I++IAHR+ T+  S+ +IVL K       G  KE F +P+    KLL++K S
Sbjct: 1508 ILTIAHRIDTVLDSDKIIVLDK-------GNVKE-FDSPS----KLLSDKGS 1547

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/257 (29%), Positives = 124/257 (48%), Gaps = 24/257 (9%)

Query: 455 GSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRR--HIGLVQQEP 512
           G  +C+VG  G GKST    +L       GQ+         +  K + R   +    QE 
Sbjct: 665 GDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIRASSLAYCSQES 717

Query: 513 ILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQR 572
            +M+ ++R+NI +G      K       K C     +   PDG +T++G +G  LSGGQ+
Sbjct: 718 WIMNASVRENILFG--HKFDKAYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQK 775

Query: 573 QRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTF-GQLMKSGSMTIVSIAHRLSTI 630
            R+++ARA+  + +I +LD+  SA+D E S+  I +   G+     + TI+   + +S +
Sbjct: 776 ARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTTNTVSIL 835

Query: 631 KRSENVIVLGKDGSVIEAGKFKELF--ANPNSELCKLLTEKSSRSDG-------NDSLPP 681
           K S+ +  L ++G ++E G ++ +    N +S+L KLL E  +  D         D  P 
Sbjct: 836 KHSQMIYAL-ENGEIVEQGNYESVMKRENDSSKLKKLLEEFDTPIDNMNESDRRTDQSPE 894

Query: 682 PPPNAT-QDKVVEQIAE 697
                T Q KVVE  AE
Sbjct: 895 RDEEETLQLKVVESEAE 911

>Ecym_8418 Chr8 (874901..879937) [5037 bp, 1678 aa] {ON} similar to
            Ashbya gossypii ACL072C
          Length = 1678

 Score =  141 bits (356), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 132/483 (27%), Positives = 218/483 (45%), Gaps = 49/483 (10%)

Query: 188  VMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSI 247
            ++ K L+    F+D+   G +++R   D   +   +       F +L+     I ++  I
Sbjct: 1163 LLKKVLYAKLRFFDSTPTGRIMNRFSRDVEAIDEELIPFFEGAFASLVQCITTILLIGYI 1222

Query: 248  SPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQE----ATGQLTRVAEEQLSGVKTVQS 303
            +P    V LFFA  I  S  + G      S++LQ         + +   E L GV T+++
Sbjct: 1223 TP----VFLFFAIVICVSYYIVGYFYLVGSRELQRFESITKSPIHQHFSETLVGVTTIRA 1278

Query: 304  FVAEQR-------ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSY 356
            F  E+R       ++  +N     ++   R  AF   +F  +  +L    FI        
Sbjct: 1279 FGDERRFLADNLSKVDTHNRPFFYLWVTNRWLAF-RIDFIGAFVILASGIFI-------- 1329

Query: 357  LVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL--FDLTDHISSISP 414
            L+   SL  G     ++Y          L   YS +   + +  RL  +   +   S   
Sbjct: 1330 LLNVNSLDAGLAGISLIYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMKIEQEPSTGL 1389

Query: 415  TKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALL 474
             +     P +G IE  N+S  Y +    ++ K++   V P S V IVG +G GKSTI   
Sbjct: 1390 YEPPPEWPDRGKIEVNNLSLRYASNLP-KVIKNVTFTVEPQSKVGIVGRTGAGKSTIITA 1448

Query: 475  LLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDN------------ 522
            L R+ +P  G I +D  DI+ +  K LR+ I ++ Q+P+L +GTI+ N            
Sbjct: 1449 LFRFLDPDTGTIKLDNVDITSIRLKRLRQSITIIPQDPVLFAGTIKSNLDPYSEYADDRI 1508

Query: 523  ------ITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIA 576
                  +   + E  T  +I S +      N + KF D   + I   G+ LS GQRQ + 
Sbjct: 1509 FEALKRVNLIVQEELTPTDIPSSSSSLSFEN-VNKFLD-LTSEITEGGSNLSQGQRQLVC 1566

Query: 577  IARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENV 636
            +AR+L++ P  ++LDEAT+++D  S+  I  T  +   SGS TI++IAHRL +I   + V
Sbjct: 1567 LARSLLRNPKAILLDEATASIDYASDAKIQQTIREEF-SGS-TILTIAHRLRSIIDYDKV 1624

Query: 637  IVL 639
            +V+
Sbjct: 1625 LVI 1627

 Score = 84.7 bits (208), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 116/238 (48%), Gaps = 10/238 (4%)

Query: 424 KGDIEFKNVSFSYPTRPENQI-FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPT 482
           K  + F N +  +          K++NI    G    IVGP+G GK+++ + LL   N +
Sbjct: 708 KDRLGFSNATIGWDHDSATDFKLKNLNIDFKIGKLNVIVGPTGSGKTSLLMGLLGEINLS 767

Query: 483 NGQILVDGQDISK---VNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSV 539
            G+I V   +  +   V+   +   IG   Q   L++ T+R+NI +  + P       +V
Sbjct: 768 EGKIYVPALNPREDLVVDADGMTDSIGYCSQSAWLLNDTLRNNILF--SAPYEANRYNAV 825

Query: 540 AKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDV 599
              C     +     G  T +G +G  LSGGQ+QR+++ARA+  +   ++LD+  SA+D 
Sbjct: 826 IHACGLTRDLEILNAGDQTEVGEKGITLSGGQKQRVSLARAMYSRARHILLDDCLSAVDS 885

Query: 600 ESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELF 655
            +   I  +   G LM+  +  +VS    L T+K ++ V++L ++  V   G+  ELF
Sbjct: 886 HTAQWIYKHCITGPLMEGRTCVLVSHNTAL-TLKNADWVVIL-ENAKVTAQGEPLELF 941

>Suva_10.60 Chr10 (123173..126145) [2973 bp, 990 aa] {ON} YLL015W
           (REAL)
          Length = 990

 Score =  140 bits (354), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 135/532 (25%), Positives = 239/532 (44%), Gaps = 46/532 (8%)

Query: 166 NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQ 225
           N   I+ML   S R   +L   +    +     F++T  VG +I+R  SD   V  S+  
Sbjct: 465 NLRSIIMLLYCSIRGSKKLHENMAKSVIRSPMVFFETTPVGRIINRFSSDMDAVDSSLQY 524

Query: 226 KVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATG 285
             S  FK+++   V I ++    P      +F     ++  + +    R   + +  +  
Sbjct: 525 VFSFFFKSILTYLVTIVLVGYNMPWFLVFNMFLLVIYIYYQTFYIVLSRELKRLISISYS 584

Query: 286 QLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDM 345
            +  +  E L+G   + ++   +R ++     I+   ++      IN         +G  
Sbjct: 585 PIMSLMSESLNGYSIIDAYNHYERFIYLNYDKIQSNIDLVFNFRSINRWLSVRLQTIGAT 644

Query: 346 SFIVVLLYGSYLV-LQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFD 404
             +   L     +  +  L+ G +   M Y+    SS+  +      +   + +  R+ +
Sbjct: 645 IVLATALLALATINTKNQLSSGMVGLLMAYSFEVTSSLTWIVRTTVMIETNIVSVERIVE 704

Query: 405 LTD---HISSISPTKG-QKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCI 460
             +      SI+P K   +  P +G IEFKN S  Y    +  + KDIN+ + P   + I
Sbjct: 705 YCELPPEAQSINPEKRPDENWPSEGRIEFKNYSTKYRENLD-PVLKDINVSIQPCEKIGI 763

Query: 461 VGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIR 520
           VG +G GKST++L L R   P+ G+I++D  +IS++    LR ++ ++ Q+     GT+R
Sbjct: 764 VGRTGAGKSTLSLALFRILEPSEGEIIIDDVNISELGLFDLRSNLAIIPQDAQAFEGTVR 823

Query: 521 DNITYGLAEP---ATKEEIRSVAKQCFCHNFITKF------------------PDGYDTM 559
            N+     +P    +++E++   +     + + K                    D  D  
Sbjct: 824 TNL-----DPFNRYSEDELKRAIELAHLKSHLEKMLGNEAENNDINVEERGNAKDILDVK 878

Query: 560 IGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMT 619
           I   G+ LS GQRQ + +ARAL+    ILVLDEAT+++D+E++  I  T  +  K    T
Sbjct: 879 INENGSNLSVGQRQLLCLARALLSHSKILVLDEATASVDMETDKIIQDTIRREFK--DRT 936

Query: 620 IVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
           I++IAHR+ T+  S+ +IVL K       G  KE F +P+    KLL++K S
Sbjct: 937 ILTIAHRIDTVLDSDKIIVLDK-------GNVKE-FDSPS----KLLSDKGS 976

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/257 (29%), Positives = 124/257 (48%), Gaps = 24/257 (9%)

Query: 455 GSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRR--HIGLVQQEP 512
           G  +C+VG  G GKST    +L       GQ+         +  K + R   +    QE 
Sbjct: 94  GDLICVVGRVGAGKSTFLKAIL-------GQLPCMSGSKESLAPKLIIRASSLAYCSQES 146

Query: 513 ILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQR 572
            +M+ ++R+NI +G      K       K C     +   PDG +T++G +G  LSGGQ+
Sbjct: 147 WIMNASVRENILFG--HKFDKAYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQK 204

Query: 573 QRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTF-GQLMKSGSMTIVSIAHRLSTI 630
            R+++ARA+  + +I +LD+  SA+D E S+  I +   G+     + TI+   + +S +
Sbjct: 205 ARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEHVLIGKTALLKNKTIILTTNTVSIL 264

Query: 631 KRSENVIVLGKDGSVIEAGKFKELF--ANPNSELCKLLTEKSSRSDG-------NDSLPP 681
           K S+ +  L ++G ++E G ++ +    N +S+L KLL E  +  D         D  P 
Sbjct: 265 KHSQMIYAL-ENGEIVEQGNYESVMKRENDSSKLKKLLEEFDTPIDNMNESDRRTDQSPE 323

Query: 682 PPPNAT-QDKVVEQIAE 697
                T Q KVVE  AE
Sbjct: 324 RDEEETLQLKVVESEAE 340

>Suva_10.23 Chr10 complement(44719..49704) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  141 bits (355), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 133/515 (25%), Positives = 232/515 (45%), Gaps = 71/515 (13%)

Query: 188  VMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSI 247
            ++NK LH    F+D    G +++R   D   + + +T  +   F +LI     + ++  I
Sbjct: 1141 ILNKVLHSKLRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFI 1200

Query: 248  SPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAE 307
            +P+   V +  +    +    +    R   +    +   + +   E L GV T+++F  E
Sbjct: 1201 TPQFLSVAIVVSIMYYFIGYFYMAGSRELKRYESISRSPIYQHFSETLVGVTTIRAFGDE 1260

Query: 308  QR-------ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQ 360
             R       ++   N     ++   R  AF          M+G +     +++G+ L + 
Sbjct: 1261 GRFMQENLQKIDENNKPFFYLWVANRWLAF-------RIDMIGSL-----VIFGAGLFIL 1308

Query: 361  GSLTIGD-------LTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSIS 413
             ++   D       LT  + +TE        L   YSE+   + +  R+ +  +      
Sbjct: 1309 SNIDHLDSGMAGISLTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYME--IEQE 1362

Query: 414  PTKGQKYIP-----GKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRG 467
            P    K +P       G IE  ++S  Y P  P  ++ K+++  V   S V IVG +G G
Sbjct: 1363 PYNQHKEVPPPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQSKVGIVGRTGAG 1420

Query: 468  KSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDN----- 522
            KSTI   L R+  P  G I +D  DIS V+ + LRR I ++ Q+P L SGTI+ N     
Sbjct: 1421 KSTIITALFRFLEPDTGHIKIDNIDISNVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYN 1480

Query: 523  -------------ITYGLAEPATKEEIRSVAKQCFCHNF--ITKFPDGYDTMIGAQGALL 567
                         +     E   +  +R VA      +   + KF D  ++ +   G+ L
Sbjct: 1481 EFSNQKIFEALKRVNLVSEEQLQQGTVREVATDTSSADSENVNKFLD-LESEVSEGGSNL 1539

Query: 568  SGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRL 627
            S GQRQ + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + GS TI++IAHRL
Sbjct: 1540 SQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQ-GS-TILTIAHRL 1597

Query: 628  STIKRSENVIVLGKDGSVIEAGKFKELFANPNSEL 662
             ++   + ++V+       +AG+ KE + +P S L
Sbjct: 1598 RSVIDYDKILVM-------DAGEVKE-YDHPYSLL 1624

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 114/233 (48%), Gaps = 9/233 (3%)

Query: 422 PGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNP 481
           P      F+N + S+    ++   KD+NI+   G    ++GP+G GK+++ + LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 482 TNGQILVDGQDISK---VNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRS 538
            NG+++V   D  +   V        I    Q   L++ T+++NI +      T+   ++
Sbjct: 749 LNGKVVVPALDPRQELVVEANGTTNSIAYCSQAAWLLNDTVKNNILFNSQFNETR--YKA 806

Query: 539 VAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALD 598
           V + C           G  T IG +G  LSGGQ+QR+++ARAL      ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 599 VESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAG 649
             +   I  N   G LM+  +  +VS  H ++   R+  ++VL +DG V + G
Sbjct: 867 SHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>KNAG0K00170 Chr11 complement(15700..20028) [4329 bp, 1442 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1442

 Score =  140 bits (354), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 145/542 (26%), Positives = 246/542 (45%), Gaps = 86/542 (15%)

Query: 169  RIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVS 228
            +  +L  L  R    L    + + LH    + DT  +G +++R   D   +   +T+   
Sbjct: 918  QFTLLCTLGLRASKWLNLKAVERILHTPMSYLDTTPLGRILNRFTKDTDSLDNELTE--- 974

Query: 229  DGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASV--FGKKIRHTSKDLQEATGQ 286
                        I +M+S    L GV++     + W A    F   I     D  ++TG+
Sbjct: 975  -----------SIRLMLSQVGNLIGVIVMCIVYLPWFAIAVPFLLIIFVLICDHYQSTGR 1023

Query: 287  LTRVAE------------EQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAE 334
              +  E            E L G+ T++++ +++R L + +  I    N   +A ++   
Sbjct: 1024 EIKRLEAVQRSFVYNNFNEVLGGMDTIKAYGSQERFLAKTDYLI----NKMNEAGYLIVA 1079

Query: 335  FFTSTTMLGDMSFIVVLLYGSYLVLQGSL-----TIGDLTAFMLY--------------T 375
                  +L D   +V  L  + L +  +      ++G L  ++L               T
Sbjct: 1080 VQRWVAILLDSVAVVFALIITLLCVTRAFPISAGSVGVLLTYVLQLPGLLNTILRALTQT 1139

Query: 376  EYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFS 435
            E   +S   L T+ +EL   + AA R          +SP +     P KGDI+F +V+F+
Sbjct: 1140 ENDMNSAERLVTYATEL--PLEAAYRK-------PEVSPPESW---PEKGDIDFIDVNFA 1187

Query: 436  Y-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDIS 494
            Y P  P   + K++N+K+  G  + I G +G GKSTI   L R    ++G+I++DG DI 
Sbjct: 1188 YRPGLP--VVLKNMNLKINNGEKIGICGRTGAGKSTIMSALYRLNELSDGKIVIDGVDIR 1245

Query: 495  KVNCKTLRRHIGLVQQEPILMSGTIRDN----------------ITYGLAEPATKEEIRS 538
            K+    LR+ + ++ Q+P+L  GTIR N                I  G+ E     +I+ 
Sbjct: 1246 KIGLYDLRKKLTIIPQDPVLFRGTIRKNLDPFKECSDDLLWDALIRTGVVERENLNDIK- 1304

Query: 539  VAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALD 598
            + K    +++        D ++  +G+  S G+RQ +A+ RAL++   IL+LDEATS++D
Sbjct: 1305 LEKPDENNSYSNMHKFHLDELVEEEGSNFSLGERQMLALTRALVRNSKILILDEATSSVD 1364

Query: 599  VESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANP 658
             E++G I      + + G  TI+ IAHRL TI   + ++VL K G + E  K  ELF + 
Sbjct: 1365 YETDGKIQSRI--VSEFGDCTILCIAHRLKTILSYDKILVLEK-GVIAEYEKPWELFNDK 1421

Query: 659  NS 660
            NS
Sbjct: 1422 NS 1423

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 114/232 (49%), Gaps = 23/232 (9%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           F D+N+++  G  + + GP G GK+++   +  +   T+G++ V+G+             
Sbjct: 581 FTDLNLEIFKGEFIIVTGPIGTGKTSLLNAMAGFMKQTSGRVEVNGE------------- 627

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
             L+   P +++ T+RDNI +G   P  +     + + C     +   P G  T IG +G
Sbjct: 628 -LLLCGYPWILNATVRDNILFG--SPYEEARYNEIVEVCSLDADLKILPAGDRTEIGERG 684

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAI--NYTFGQLMKSGSMTIVS 622
             LSGGQ+ RI +ARA+ K  +I + D+  SA+D      I  +   G L   G   I++
Sbjct: 685 ITLSGGQKARINLARAVYKNKDIFLFDDVLSAVDSRVGKHIMDDCLLGIL--KGKTRILA 742

Query: 623 IAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSD 674
             H+LS I+R++ +IV+G +GS  + G   EL    N  L  LL   S   D
Sbjct: 743 -THQLSVIERADRIIVVGPNGS-FDFGTLDEL-KGRNQTLVSLLQYSSQTKD 791

>AGR047W Chr7 (802679..807157) [4479 bp, 1492 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YDR135C (YCF1)
          Length = 1492

 Score =  140 bits (352), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 132/484 (27%), Positives = 220/484 (45%), Gaps = 41/484 (8%)

Query: 184  LRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGM 243
            L   ++   L     F++T  +G +++R  +D Y V   + +  S  F         I +
Sbjct: 1003 LHESMLAAVLRAPMSFFETTPIGRILNRFSNDIYKVDELLARTFSQFFANTTRVSFTIIV 1062

Query: 244  MVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQE----ATGQLTRVAEEQLSGVK 299
            +   + + +    FF  P+      + +    TS++L+         +    +E L+GV 
Sbjct: 1063 ICVTTWQFT----FFVIPLAMLYIYYQQYYLKTSRELRRLDSVTKSPVYAHFQETLNGVS 1118

Query: 300  TVQSFVAEQRELH----RYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVLL 352
            +++ +    R +H    R N      Y   NV R  A+   EF  S  +    +  V   
Sbjct: 1119 SIRGYGQLDRFIHINQARINNNTSAYYPSMNVNRWLAY-RLEFIGSCIIFFAATLSV--- 1174

Query: 353  YGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTD----- 407
               + +  GSLT G +   + Y      S+  +     E+   + +  R+ +  +     
Sbjct: 1175 ---FRLASGSLTSGMVGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYAELEPEA 1231

Query: 408  --HISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPE-NQIFKDINIKVPPGSNVCIVGPS 464
               I++  P+      P  G+I+F+N S  Y  RP  + I + IN+ + P   V IVG +
Sbjct: 1232 PQFIANSVPSGDW---PKDGEIKFENYSTRY--RPGLDLILRGINLHIKPHERVGIVGRT 1286

Query: 465  GRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNIT 524
            G GKS++AL L R      G I +DG  I  +    LR+ + ++ Q+  +  GT+RDNI 
Sbjct: 1287 GAGKSSLALSLFRIIEAAEGHISIDGVPIDTIGLTDLRKKLSIIPQDSQVFEGTVRDNI- 1345

Query: 525  YGLAEPATKEEIRSVAKQCFCHNFITKF-PDGYDTMIGAQGALLSGGQRQRIAIARALIK 583
                +  T E+I    +     + +     DG DT +   G  LS GQRQ + +ARAL+ 
Sbjct: 1346 -DPTKQYTDEQIWKALELSHLADHVKGMGSDGLDTPLTEGGKNLSVGQRQLMCLARALLI 1404

Query: 584  KPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDG 643
               ILVLDEAT+A+DVE++  I  T          TI++IAHR++TI  S+ ++VL K G
Sbjct: 1405 PFRILVLDEATAAIDVETDKVIQDTIRS--SFNDRTILTIAHRINTIMDSDKIVVLDK-G 1461

Query: 644  SVIE 647
            +V E
Sbjct: 1462 TVAE 1465

 Score =  119 bits (299), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 121/517 (23%), Positives = 237/517 (45%), Gaps = 56/517 (10%)

Query: 184 LRSGVMN----KTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQK----VSDGFKALI 235
           LRSG+ +    K LH  +E   T   GD+++ +  DA  + R +TQ      S  F+  +
Sbjct: 358 LRSGITSLIYKKALHLSNEASGTSATGDIVNLMSVDAQRL-RDLTQWGNVIWSGPFQLCL 416

Query: 236 CGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQL 295
           C    +  ++     +  VLL F  P+    S   + ++   K+  +   + TR+  E L
Sbjct: 417 CL-YSLHRLLGPCIWVGVVLLLFTLPL---NSYISRVLKRLQKEQMKNKDERTRLISEIL 472

Query: 296 SGVKTVQSFV-----AEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVV 350
           + +K+++ +       E+ +  R    ++ +  +G   AF N ++     ++   +F V 
Sbjct: 473 NNIKSLKLYAWEIPYKEKLDYVRNQKELKTLRKMGLTTAFANFQYNIIPFLVSCSTFAVF 532

Query: 351 LLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLT---- 406
           +L      L   L    LT F L +         +T+F    ++   A  RL +      
Sbjct: 533 VLTQKGRPLTTDLVFPALTLFNLLSFPLAVLPIAITSF----IEASVAIGRLTNFLTAEE 588

Query: 407 ---DHISSISPTKGQKYIPGKGDIEF-KNVSFSYPTRPENQI-FKDINIKVPPGSNVCIV 461
              D I+     K     PG   +    N +F +  +PE ++  K+IN +       CI+
Sbjct: 589 LQRDAITREPAVKA----PGGVAVALADNATFLWQRKPEYKVALKNINFRAKKSELTCII 644

Query: 462 GPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRD 521
           G  G GKS +   +L      NG  +V G             ++  V Q   +M+GT+RD
Sbjct: 645 GKVGSGKSALIQAMLGDLFRVNGSAVVRG-------------NVAYVSQVAWIMNGTVRD 691

Query: 522 NITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARAL 581
           NI +G    A  +  +   K C     ++  PDG +T +G +G  LSGGQ+ R+++ARA+
Sbjct: 692 NILFGHKYDA--KFYQQTIKACALTVDLSILPDGDNTFVGEKGISLSGGQKARLSLARAV 749

Query: 582 IKKPNILVLDEATSALDVE-SEGAINYTFGQ--LMKSGSMTIVSIAHRLSTIKRSENVIV 638
             + +  +LD+  +A+D   ++  +   FG   L+KS +  + +  ++++ ++ ++++++
Sbjct: 750 YARADTYLLDDPLAAVDEHVAKHLLQNVFGPNGLLKSKARVLTT--NKITALEIADHIVL 807

Query: 639 LGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDG 675
           L ++G +++ G F E+ ++ +S + KL+     + +G
Sbjct: 808 L-ENGEIVQQGTFSEVISDEDSAISKLVLHHGKKQNG 843

>CAGL0C03289g Chr3 (328799..333745) [4947 bp, 1648 aa] {ON} similar to
            uniprot|P32386 Saccharomyces cerevisiae YLL048c YBT1
            yeast bile transporter
          Length = 1648

 Score =  140 bits (352), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 137/528 (25%), Positives = 240/528 (45%), Gaps = 83/528 (15%)

Query: 187  GVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVS 246
             ++++ LH    F+D+  +G +++R   D   + + +   +   F + I     + ++  
Sbjct: 1128 SLLDRVLHARVRFFDSTPIGRIMNRFSKDIESIDQEIPPNIQSVFYSAIEVFATLLLISY 1187

Query: 247  ISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQE----ATGQLTRVAEEQLSGVKTVQ 302
            I+P    V    A  I+   S+ G     TS++L+     +   + +   E L GV T++
Sbjct: 1188 ITPAFFPV----AIIIVLGYSIVGFFYLTTSRELKRLDSISKSPIFQHFSETLVGVTTIR 1243

Query: 303  SFVAEQRELHRYNGAIRG-------IYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGS 355
            +F  EQR +      I         ++ V R  +F          ++G +   V+   G 
Sbjct: 1244 AFGDEQRFIKENLSMIDQNSMPFFYLWVVNRWLSF-------RIDLIGAL---VIFSSGV 1293

Query: 356  YLVLQ-----GSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFD------ 404
            +++L        L    LT  + +TE    +   L   YSEL   + +  R+ +      
Sbjct: 1294 FILLNINNIDAGLAGISLTYAISFTE----AALWLVRQYSELEMNMNSVERVLEYMNIEQ 1349

Query: 405  ---LTDHISSISPTKGQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCI 460
               + D  ++++P       P  G +E  N+S  Y P  P   + KD+   + P   V I
Sbjct: 1350 EPLIADPANAVTPPPQW---PDSGKVEVNNLSLKYAPHLP--YVIKDVTFTIEPLEKVGI 1404

Query: 461  VGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIR 520
            VG +G GKSTI   L R+     G I +DG +I+ ++ K LRR I ++ Q+P L +G+IR
Sbjct: 1405 VGRTGAGKSTIITALFRFLEADTGSIKLDGVNIANIDLKRLRRSITIIPQDPTLFAGSIR 1464

Query: 521  DNITYGLAEPATKEEIRSVAK-----------------QCFCHNFITKFPDGYDTMIGAQ 563
             N+     +  + EEI +  K                 Q      + KF +  ++ I   
Sbjct: 1465 SNL--DPYDEYSDEEIFTALKRVNLVSTEEMEASTSEIQSNSSKNVNKFLN-LESEIAEG 1521

Query: 564  GALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSI 623
            G+  S GQRQ + +AR+L++ P +++LDEAT+++D  S+  I  T  Q   +   T+++I
Sbjct: 1522 GSNFSQGQRQLMCLARSLLRMPKVILLDEATASIDYNSDAKIQETIRQEFNNS--TVLTI 1579

Query: 624  AHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
            AHRL +I   + ++V+       +AG+ KE F +P S    LL EK S
Sbjct: 1580 AHRLRSIVDYDKILVM-------DAGEVKE-FDHPYS----LLLEKKS 1615

 Score = 89.7 bits (221), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 83/312 (26%), Positives = 141/312 (45%), Gaps = 29/312 (9%)

Query: 427  IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI 486
            + F+NV+  + +  ++ + ++++I+   G    IVG +G GK++I + LL     + G+I
Sbjct: 706  LAFENVTLRWDSDKDSFVLRNLDIEFMTGKLNVIVGATGSGKTSILMGLLGEMQLSEGKI 765

Query: 487  LVDG---QDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQC 543
            +V     +   +     +   I    Q   L++ T+R+NI +    P  +    +V + C
Sbjct: 766  IVPSLSPRHEYQSQAGVINDSIAYCSQAAWLLNDTVRNNILFN--APFDQARYDAVVEAC 823

Query: 544  FCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEG 603
                       G  T IG +G  LSGGQ+QR+++ARAL      L+LD+  SA+D  +  
Sbjct: 824  SLKRDFQILKAGDSTEIGEKGITLSGGQKQRVSLARALYSSAGHLLLDDCLSAVDSHTAL 883

Query: 604  AI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFAN---- 657
             I      G LM+    T + + H ++   ++ + +V+ +DG V E G   EL A     
Sbjct: 884  WIYDKCISGPLME--GRTCILVTHNIALTMKNADFVVMIEDGKVKEKGTPIELLAKGLLG 941

Query: 658  PNSELCK----------LLTEKSSRSDGNDSLPPPPPNATQDKVVEQIAEKILERFPEAG 707
             +  + K           L  KS RS G     P P    QD        K++E   E G
Sbjct: 942  EDENMKKSIISRSASSASLKGKSERSLGT---TPAPVEIVQDSTPVNDDGKLIE---EEG 995

Query: 708  QSPDATVKEIFK 719
            ++     KEI+K
Sbjct: 996  KAMGFVGKEIYK 1007

>KLTH0C09240g Chr3 complement(766620..771260) [4641 bp, 1546 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1546

 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 135/532 (25%), Positives = 236/532 (44%), Gaps = 49/532 (9%)

Query: 166  NFAR-IVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDA-------- 216
            N AR IV+L + S R   +L   +    L     F++T  VG +I+R  SD         
Sbjct: 1031 NSARSIVLLLVCSIRASRKLHDSMAVAVLRSPMSFFETTPVGRIINRFSSDMNSVDDNVQ 1090

Query: 217  YVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHT 276
            YV+S  +   + D    ++  G  + + + ++  L G+ L++         VF   +   
Sbjct: 1091 YVISFFLIS-ILDYVVVVVIIGYQVPLFLLVNAALLGIYLYY--------QVFYVTLSRE 1141

Query: 277  SKDLQEAT-GQLTRVAEEQLSGVKTVQSFVAEQR------ELHRYNGAIRGIYNVGRKAA 329
             K L   +   +  +  E L+G   + +F    R      E  ++N  I  ++N      
Sbjct: 1142 LKRLMSTSFSPIMSMLSETLAGHMVINAFNHFSRFDYLNIEAVQFN--INCVFNFRSTNR 1199

Query: 330  FINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFY 389
            +++    +   +   M     LL  +      +L+ G +   M Y     + +  +    
Sbjct: 1200 WLSIRLESIGAL---MILTTALLSLATTTGDKALSTGMVGLLMSYALQVTNKLMWIVRMS 1256

Query: 390  SELMQGVGAASRLFDLTDHISSISPT----KGQKYIPGKGDIEFKNVSFSYPTRPENQIF 445
             +L   V +  R+ +  D      P     + +K  P +G + FK+ S  Y    +  + 
Sbjct: 1257 VQLETNVVSVERIVEYCDLPPEAPPVIEDCRPEKNWPAQGHVVFKDYSARYRENLD-PVL 1315

Query: 446  KDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHI 505
            K +N+++ P   + IVG +G GKST++L L R   P  G I++DG DI+K+    LR H+
Sbjct: 1316 KKLNVEINPQEKIGIVGRTGAGKSTLSLALFRILEPCGGTIVIDGVDITKIGLADLRSHL 1375

Query: 506  GLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDG---------Y 556
             ++ Q+     G++R N+     E  + +EI    +       I K  +           
Sbjct: 1376 SIIPQDAQAFEGSVRSNL--DPFEQYSDDEIWRALELSHLKPHILKMANEEGPEKTKNLL 1433

Query: 557  DTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG 616
            +T I   G+ LS GQRQ + ++RAL+ +  ILVLDEAT+A+D E++  I  T     K  
Sbjct: 1434 ETKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSETDRLIQETIRAEFK-- 1491

Query: 617  SMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTE 668
              TI++IAHR+ T+  S+ ++VL + G V E      L A+ N+    L ++
Sbjct: 1492 DRTILTIAHRIDTVMDSDKIMVLDQ-GEVKEFDSPSNLLADKNTIFYNLCSQ 1542

 Score = 83.2 bits (204), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 70/261 (26%), Positives = 129/261 (49%), Gaps = 23/261 (8%)

Query: 455 GSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRR--HIGLVQQEP 512
           G  VC+VG  G GKST    LL       GQ+        +   K   R   + L  Q+ 
Sbjct: 663 GQLVCVVGRVGAGKSTFLHALL-------GQLPCISSSHDQATPKMHFRCDSVALCSQQA 715

Query: 513 ILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQR 572
            +++ +++ N+ +G      +   ++  + C     +    DG +T++G +G  LSGGQ+
Sbjct: 716 WILNASVKYNVLFG--HKYDEASYKATIEACQLLPDLGILADGDETLVGEKGISLSGGQK 773

Query: 573 QRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSM---TIVSIAHRLS 628
            RI++ARA+  + ++ +LD+  SA+D E  +  I++   +  K+G +   T++   + +S
Sbjct: 774 ARISLARAVYSRSDVYLLDDILSAVDAEVCKRIIDHVLSR--KTGLLKNKTVILTTNSIS 831

Query: 629 TIKRSENVIVLGKDGSVIEAGKFKELFA-NPNSELCKLLTEKSSRSDG-NDSLPPP---P 683
            +K S+++  L ++G ++E G F E+ + +  S+L  L+ E  S S    D  P P   P
Sbjct: 832 VLKHSQSIYAL-ENGEIVERGSFDEIMSKDAESKLKTLIAEFGSDSSAVKDDEPIPEQKP 890

Query: 684 PNATQDKVVEQIAEKILERFP 704
           P   Q+   + + E+I    P
Sbjct: 891 PVDLQEVEDDALEEEINPEVP 911

>KAFR0I01300 Chr9 complement(262852..267462) [4611 bp, 1536 aa] {ON}
            Anc_4.52 YLL015W
          Length = 1536

 Score =  139 bits (351), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 134/528 (25%), Positives = 244/528 (46%), Gaps = 49/528 (9%)

Query: 167  FARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQK 226
            F  I+ML   S R    L   +    +    +F++T  +G +I+R  SD   V  ++   
Sbjct: 1021 FRTIIMLLYCSIRGSKTLHDSMAKAIIRSPVQFFETTPIGRVINRFSSDIDSVDVNLQNV 1080

Query: 227  VSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPIL---WSASVFGKKIRHTSKDLQEA 283
             S  F++++     I  ++ +S  +   LLF A  ++   +   ++  + R   +    A
Sbjct: 1081 FSIFFRSILDY---ILTVILVSVAMPWFLLFNALIMIIYFYYEKLYIVQSRELKRLTSIA 1137

Query: 284  TGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLG 343
               +  +  E L G   + ++     ++ ++    R  YN+     F +   + S  +  
Sbjct: 1138 YSPIISLMSETLGGQMVISAY--NHSKMFKFMNIERVQYNLNVLFTFRSTNRWLSIRLQS 1195

Query: 344  DMSFIVV---LLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAAS 400
              +FI++   LL  + L     +  G +   M Y     S++  +     ++   + +  
Sbjct: 1196 IGAFIILCTGLLALTTLRTSSPIGSGLIGLLMSYVLQVTSALTWIVRSTVQIETNIVSVE 1255

Query: 401  RLFDLTDHI-----SSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPG 455
            R+ +   H+       I   + ++  P +G IEFKN + +Y     + + K+I++ + P 
Sbjct: 1256 RILEYC-HLPPEAEDIIDSNRVERDWPQRGSIEFKNYTTTYRANL-SPVLKNISVTINPS 1313

Query: 456  SNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILM 515
              V IVG +G GKST++L L R      G I +DG DIS++    LR ++ ++ Q+    
Sbjct: 1314 EKVGIVGRTGAGKSTLSLALFRILEAAEGTIFIDGVDISRIGLTDLRGNMAIIPQDAQAF 1373

Query: 516  SGTIRDNITYGLAEPATKE---EIRSVAKQCFCHNFITKFPD---------GYDTMIGAQ 563
             GT+R N+     +P  K    E+ +V +       + +  +         G D  I   
Sbjct: 1374 EGTVRSNL-----DPFQKHTDVELWNVIELSHLKPHVLRMAEDDNLSGNLSGLDAKINEN 1428

Query: 564  GALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSI 623
            G+ LS GQRQ + +ARAL+ +  +LVLDEAT+A+DVE++  I  T     K    TI++I
Sbjct: 1429 GSNLSVGQRQLLCLARALLNQSKVLVLDEATAAVDVETDKIIQETIRTQFK--DRTILTI 1486

Query: 624  AHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
            AHRL TI  ++ ++VL       +AG  KE F +P +    LL+++S+
Sbjct: 1487 AHRLDTIMDNDKILVL-------DAGGVKE-FDSPKN----LLSDEST 1522

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 69/269 (25%), Positives = 127/269 (47%), Gaps = 40/269 (14%)

Query: 417 GQKYIPGKGDIEFKNVSFSYPTRPE---------------NQI-FKDIN-IKVPPGSNVC 459
             +YIP    +E +N +F + ++ +                Q+  K+I+     P S  C
Sbjct: 600 ANEYIPA---VEIENATFLWKSQAQLINSENDDSEANIETTQVALKNIDHFTASPKSLTC 656

Query: 460 IVGPSGRGKSTIALLLLRYYNPTNGQI-LVDGQDISKVNCKTLR-RHIGLVQQEPILMSG 517
           ++G  G GK+T+   +L       GQ+  + G   S     ++R   I    QE  +M+ 
Sbjct: 657 VIGKVGSGKTTLLKAIL-------GQLPCISGSKESISPKLSIRGESIAYCPQEAWIMND 709

Query: 518 TIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAI 577
           TI++NI +G     T   +   A +      I   PDG  T++G +G  LSGGQ+ R+++
Sbjct: 710 TIKENILFGHKFDETYYTLTVAACELLADFDI--LPDGDQTLVGEKGISLSGGQKARVSL 767

Query: 578 ARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGS-----MTIVSIAHRLSTIKR 632
           ARA+  + +I +LD+  SA+D    G        ++ S S      T++   + +S +K 
Sbjct: 768 ARAVYSRADIYLLDDILSAVDA---GVSKKIVENVLDSNSGLLRNKTVILSTNTVSVLKH 824

Query: 633 SENVIVLGKDGSVIEAGKFKELFANPNSE 661
           S+ +  L ++G ++E G + ++  + NS+
Sbjct: 825 SQLIYAL-ENGIIVERGNYNDIIESANSD 852

>KAFR0C06510 Chr3 (1306097..1310470) [4374 bp, 1457 aa] {ON} Anc_5.10
            YGR281W
          Length = 1457

 Score =  139 bits (351), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 134/531 (25%), Positives = 256/531 (48%), Gaps = 63/531 (11%)

Query: 184  LRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGM 243
            L    +++ LH    + DT  +G +++R   D    + S+  ++++  + ++     +G 
Sbjct: 947  LNLNAVHRVLHAPMSYLDTTPLGRILNRFTKD----TDSLDNELTESVRLML---FQVGN 999

Query: 244  MVSISPELSGVLLFFA---PPILWSASVFGKKIRHTSKDLQEATG-QLTRVAE---EQLS 296
            +V++       L +FA   P + +   +     + TS++++     Q + V     E L 
Sbjct: 1000 IVAVIVMCIVYLPWFAIAVPFLFFMFVLIADHYQSTSREIKRLDAIQRSFVYNNLNEVLG 1059

Query: 297  GVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSY 356
            G+ T++S+  ++R    +      + N   +A ++        ++  DM  I+  L  + 
Sbjct: 1060 GMDTIKSYKGQKR----FQAKSDYLINKMNEAGYLLVSVQRWVSIFLDMVAIIFALIIAL 1115

Query: 357  LVLQGSLT-----IGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHIS- 410
            L + G  +     +G L  ++L      +SV    T   +    + +A RL +    +  
Sbjct: 1116 LSVTGVFSLSASSVGVLLTYVLQLPGLLNSVLRALT---QTENDMNSAERLVNYATKLPL 1172

Query: 411  -------SISPTKGQKYIPGKGDIEFKNVSFSYPT-RPENQIFKDINIKVPPGSNVCIVG 462
                    +SP +     P KG+I F +V F+Y +  P   + K +N+ +  G  + I G
Sbjct: 1173 EAAYKKPELSPPESW---PSKGEIRFLDVDFAYRSGLP--VVLKGLNLDIKSGEKIGICG 1227

Query: 463  PSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDN 522
             +G GKSTI   L R    T+G+IL+D  DIS +    LRR + ++ Q+P+L  GTIR N
Sbjct: 1228 RTGAGKSTIMSALYRLNELTSGKILIDDVDISTLGLYDLRRKLSIIPQDPVLFKGTIRKN 1287

Query: 523  ----------------ITYGLAEPATKEEIRS-VAKQCFCHNFITKFPDGYDTMIGAQGA 565
                            I  G  E  + E+++S +  +   H  + KF    D ++  +G+
Sbjct: 1288 LDPFSNYDDSLLWDALIRSGAIEKESVEKVKSEMVNEEGTHTDMHKF--HLDQLVEEEGS 1345

Query: 566  LLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625
              S G+RQ +A+ RAL+++  IL+LDEATS++D E++G I     +  +  + TI+ IAH
Sbjct: 1346 NFSLGERQVLALTRALVRQSKILILDEATSSVDYETDGKIQKRIVE--EFDNCTILCIAH 1403

Query: 626  RLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGN 676
            RL TI + + ++VL K G + E  +  +LF++ +S + + + E+S+ ++ +
Sbjct: 1404 RLKTILQYDRILVLEK-GVIAEFDQPFKLFSDKDS-IFRSMCERSNITESD 1452

 Score = 99.8 bits (247), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 77/255 (30%), Positives = 123/255 (48%), Gaps = 19/255 (7%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           F +++ ++  G  + I GP G GKS++      + N T G+I V+G D+           
Sbjct: 588 FSNLDFEIRKGEFIMITGPIGTGKSSLLNAFAGFMNKTEGRIQVNG-DL----------- 635

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
             L    P + + T++DNI +G   P  KE+  +V + C     +   P G  T IG +G
Sbjct: 636 --LFCGYPWIQNATVKDNILFG--SPFIKEKYENVLRVCSLDADLKVLPAGDKTEIGERG 691

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIA 624
             LSGGQ+ RI +ARA+ K  +I + D+  SA+D      I       +  G   I++  
Sbjct: 692 INLSGGQKARINLARAVYKTKDIFLFDDVLSAVDSRVGKHIMDECLLDLLEGKTRILA-T 750

Query: 625 HRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPPP 684
           H+LS I++++ VIVLG DGS  + G   EL    N  L  LL   ++  +  +    P  
Sbjct: 751 HQLSLIEKADRVIVLGTDGS-FDIGTVDEL-KQRNQTLTNLLDYSTTERENENRDESPVA 808

Query: 685 NATQDKVVEQIAEKI 699
           +   D+++ Q   KI
Sbjct: 809 DEENDELLIQEELKI 823

>TDEL0G01850 Chr7 (369839..374767) [4929 bp, 1642 aa] {ON} Anc_4.6
            YHL035C
          Length = 1642

 Score =  139 bits (349), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 133/513 (25%), Positives = 233/513 (45%), Gaps = 79/513 (15%)

Query: 188  VMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSI 247
            +++K +H    F+D+  +G +++R   D     + +T  +   F +L+     + ++  I
Sbjct: 1128 LLSKVMHAKLRFFDSTPIGRIMNRFSKDMEAADQELTPFIEGAFYSLVQCVSTVVLITFI 1187

Query: 248  SPE------LSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTV 301
            +P+      L  VL +F      + S   K++   S+        + +   E L GV T+
Sbjct: 1188 TPQFLFVAILVAVLYYFVGYFYLTGSRELKRLESISR------SPIYQHFSETLVGVTTI 1241

Query: 302  QSFVAEQR-------ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYG 354
            ++F  E R       ++   N     ++   R  +F          M+G +   V+   G
Sbjct: 1242 RAFGDESRFMRENLQKIDENNRPFFYLWVANRWLSF-------RIDMIGAL---VIFGAG 1291

Query: 355  SYLVLQ------GSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTD- 407
             +++L       G   I  LT  + +TE        L   YS +   + +  RL +  D 
Sbjct: 1292 IFVLLNIDHIDSGKAGIS-LTYAITFTE----GALWLVRLYSNVEMNMNSVERLKEYMDV 1346

Query: 408  -----HISSISPTKGQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIV 461
                   S ++P       P +G IE  ++S  Y P  P  ++ K+++  V P S V IV
Sbjct: 1347 EQEPYDQSILTPPVEW---PQQGRIEVNDLSLRYAPNLP--KVIKNVSFTVDPRSKVGIV 1401

Query: 462  GPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRD 521
            G +G GKSTI   L R+ +P  G I +D  DI+ ++ + LRR I ++ Q+P L +GTI+ 
Sbjct: 1402 GRTGAGKSTIITALFRFLDPETGNIKIDNVDITSIDLQRLRRSITIIPQDPTLFTGTIKS 1461

Query: 522  NI-------------TYGLAEPATKEEIR---SVAKQCFCHNFITKFPDGYDTMIGAQGA 565
            N+                     T+EE+    +          I KF D   + I   G 
Sbjct: 1462 NLDPYDEYTDQQIFEALKRVNLVTQEELDRRPTSESSSVSSENINKFLD-LSSEISEGGG 1520

Query: 566  LLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625
             +S GQRQ + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + G  TI++IAH
Sbjct: 1521 NISQGQRQLVCLARSLLRSPKIILLDEATASIDYASDAKIQETIRK--EFGGNTILTIAH 1578

Query: 626  RLSTIKRSENVIVLGKDGSVIEAGKFKELFANP 658
            RL ++   + ++V+       +AG+ KE F +P
Sbjct: 1579 RLRSVIDYDKILVM-------DAGEVKE-FDHP 1603

 Score = 87.0 bits (214), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 117/233 (50%), Gaps = 11/233 (4%)

Query: 424 KGDIEFKNVSFSYPT-RPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPT 482
           K  I F+N + ++   RP+ ++ K++NI    G    I+GP+G GK+++ + LL   +  
Sbjct: 693 KKKIGFENATITWDAERPDFKL-KNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMHLV 751

Query: 483 NGQILVDGQDISK---VNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSV 539
           +G+I+V   D  +   +    +   +    Q   L++ T+++NI +    P  +    +V
Sbjct: 752 SGKIIVPSLDPRQELPIEADGMTNSMAYCSQAAWLLNDTVKNNILFN--SPYNEGRYEAV 809

Query: 540 AKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDV 599
            + C      +    G  T IG +G  LSGGQ+QRI++AR+L      ++LD+  SA+D 
Sbjct: 810 VEACGLKRDFSILSAGDLTEIGERGITLSGGQKQRISLARSLYSNARHVLLDDCLSAVDS 869

Query: 600 ESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGK 650
            +   I  N   G LM+  +  +VS  H  +   R+  ++V  ++G V   G+
Sbjct: 870 HTASWIYDNCITGPLMEGRTCILVS--HNTALTLRNAELVVTMENGQVKNQGE 920

>Kpol_311.3 s311 (5480..10453) [4974 bp, 1657 aa] {ON} (5480..10453)
            [4974 nt, 1658 aa]
          Length = 1657

 Score =  139 bits (349), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 139/517 (26%), Positives = 233/517 (45%), Gaps = 70/517 (13%)

Query: 183  RLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIG 242
            ++ S ++NK LH +  F+D+  +G +++R   D   V + +   +      +I     I 
Sbjct: 1139 KIFSLLLNKALHANLRFFDSTPIGRIMNRFSKDMEAVDQELVPYLEAALYCIIDISSTIL 1198

Query: 243  MMVSISPE--LSGVL---LFFAPPILWSASVFGKKIRHTSKDLQE----ATGQLTRVAEE 293
            ++  I+PE  +  +L   L++A  +L+ A          S++L+         + +   E
Sbjct: 1199 LITYITPEFLIIAILVAGLYYAIGVLYLAG---------SRELKRFDSITKSPIYQHFSE 1249

Query: 294  QLSGVKTVQSFVAEQRELHRY-------NGAIRGIYNVGRKAAFINAEFFTSTTMLGDMS 346
             L GV TV+++  E R +          N     ++   R  AF   +   +  + G   
Sbjct: 1250 TLVGVTTVRAYGDEARFMRENLKMIDENNKPFFYLWVSNRWLAF-RIDVVGALVIFGSGV 1308

Query: 347  FIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLT 406
            F+++ +      +   L    L+  + +TE    S   L   YS L   + +  RL +  
Sbjct: 1309 FVLLNIDK----IDSGLAGISLSFAISFTE----SALWLVRHYSNLEMNMNSVERLMEYM 1360

Query: 407  DHISSISPTKGQKY-----IPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCI 460
            +      P K          P +G IE  +VS  Y P  P  ++ K+    V P   V I
Sbjct: 1361 E--VEQEPYKSSSLDVPSSWPEEGKIEVNDVSLRYAPNLP--RVIKNATFTVDPKMKVGI 1416

Query: 461  VGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIR 520
            VG +G GKSTI   L R+ +P  G I +D  DIS +  K LRR I ++ Q+P L SGTI+
Sbjct: 1417 VGRTGAGKSTIITALFRFLDPETGSIKIDNVDISTIELKKLRRSITIIPQDPTLFSGTIK 1476

Query: 521  DNIT-YG-LAEPATKEEIRSVA-------------KQCFCHNFITKFPDGYDTMIGAQGA 565
             N+  Y   +E    E ++ V              +Q        KF +  +  I   G+
Sbjct: 1477 SNLDPYDEYSEKQIFEALKRVNLVTEKELASGNSDQQSIASGNANKFLN-VNNEISEGGS 1535

Query: 566  LLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625
             LS GQRQ + +AR+L++ P +++LDEAT+++D  S+  I  T          TI++IAH
Sbjct: 1536 NLSQGQRQLVCLARSLLRCPKVILLDEATASIDYASDAKIQETIRNEFDDS--TILTIAH 1593

Query: 626  RLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSEL 662
            RL T+   + ++V+       +AG+ KE F +P S L
Sbjct: 1594 RLRTVIDYDKILVM-------DAGEVKE-FDHPYSLL 1622

 Score = 97.8 bits (242), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 118/473 (24%), Positives = 210/473 (44%), Gaps = 62/473 (13%)

Query: 201 DTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKAL-ICGGVGIGMMVSISPELSGVLLFFA 259
           DT KV D+ + L      V  ++   +   FK L +   VG  +++++ P      L F 
Sbjct: 494 DTFKVADICAYLHHFVEAVVMTIVALIL-LFKLLGVAAIVGASLIIALLP------LNFK 546

Query: 260 PPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSF---------VAEQRE 310
                 AS+ GK   +  K L E T +  +   E    ++ ++ F         + E RE
Sbjct: 547 L-----ASLLGK---YQKKSL-EVTDKRIQKLNEAFQAIRIIKFFSWEDNFEKDILEVRE 597

Query: 311 LHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGS-LTIGDLT 369
                  IR I  V   ++F+   +F + T++   SF        Y+ +QG  LTI    
Sbjct: 598 RELRMILIRSI--VWAISSFV---WFVTPTIVTGASFTY------YVYVQGEVLTIP--- 643

Query: 370 AFMLYTEYTGSSVFGLTTF----YSELMQGVGAASRLFDLTDHISSISPTKGQKYIP--- 422
                  +T  S+F L       +S+++  V  +    D          TK  + +    
Sbjct: 644 -----VAFTALSLFALLKIPLDTFSDMLSFVIQSKVSLDRIQEFLEEEDTKKYEQLTVDK 698

Query: 423 GKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPT 482
            +  I FKN + ++    ++   ++I+I    G    I+GP+G GK+++ + LL   +  
Sbjct: 699 YQNKIAFKNATTTWNKEKQDFKLRNIDIDFKIGKLNVIIGPTGSGKTSLLMALLGEMDLI 758

Query: 483 NGQILV---DGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSV 539
           +G+I+V   D ++  K++   L   I    Q   L++ T+R+NI +    P  +E   +V
Sbjct: 759 DGEIIVPCLDPREDLKLDANGLTNSIAYCSQAAWLLNDTVRNNILFN--SPYCEERYNAV 816

Query: 540 AKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDV 599
            +             G  T IG +G  LSGGQ+QR+++ARAL      L+LD+  SA+D 
Sbjct: 817 VEASGLKRDFEILNAGDMTEIGERGITLSGGQKQRVSLARALYSNSKHLLLDDCLSAVDS 876

Query: 600 ESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGK 650
            +   I  N   G LM++ +  +VS  H ++   R+ + +V  ++G ++E G+
Sbjct: 877 HTATWIYDNCISGPLMENRTCILVS--HNIALTLRNADYVVKLENGKIVEHGE 927

>KLTH0H16038g Chr8 (1376941..1381890) [4950 bp, 1649 aa] {ON} similar
            to uniprot|P32386 Saccharomyces cerevisiae YLL048C
          Length = 1649

 Score =  138 bits (348), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 128/506 (25%), Positives = 221/506 (43%), Gaps = 52/506 (10%)

Query: 188  VMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSI 247
            ++ K L+    F+D+  +G +++R   D   V + +T  V   F +L+     + ++  I
Sbjct: 1133 ILKKVLYAKLRFFDSTPIGRIMNRFSRDIEAVDQELTPFVEGAFVSLVQCLSTVILIAYI 1192

Query: 248  SPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAE 307
            +P+   V +F           +    R   +    +   + +   E L G+ T+++F  E
Sbjct: 1193 TPDFFFVAIFIGIFYYLVGYFYMAGSRELKRYESISRSPIHQHFSETLVGITTIRAFGDE 1252

Query: 308  QR-------ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQ 360
            +R       ++   N     ++   R  AF          M+G     V+   G +++L 
Sbjct: 1253 RRFMQENLTKIDENNKPFFYLWVANRWLAF-------RIDMIGA---CVIFAAGIFVLLN 1302

Query: 361  -GSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTD-----HISSISP 414
              SL  G     + Y          L   YS +   + +  RL +  +     H  S   
Sbjct: 1303 IKSLDSGLAGISLTYAISFTEGALWLVRLYSNVEMTMNSVERLKEYMEVEQEPHYQSTHN 1362

Query: 415  TKGQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIAL 473
               +   P +G IE  ++S  Y P+ P  ++ K++   V P   V IVG +G GKSTI  
Sbjct: 1363 PPPE--WPSQGKIEVNDLSLRYAPSLP--KVIKNVTFTVDPNCKVGIVGRTGAGKSTIIT 1418

Query: 474  LLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNI---------- 523
             L R+ +P +G I +D  DI+ V  K LR+ I ++ Q+P L +GT++ N+          
Sbjct: 1419 ALFRFLDPESGYIKIDNVDITSVELKRLRQSITIIPQDPTLFTGTVKSNLDPYDEYSDKQ 1478

Query: 524  ---TYGLAEPATKEEIRSVAK------QCFCHNFITKFPDGYDTMIGAQGALLSGGQRQR 574
                       T+EE+   A            N + KF    +  I   G+ LS GQRQ 
Sbjct: 1479 IFEALKRVNLVTQEELDHAANPSPDNASAVSEN-VNKFL-FLENEISEGGSNLSQGQRQL 1536

Query: 575  IAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSE 634
            + +AR+L++ P +++LDEAT+++D +S+  I  T     +    TI++IAHRL +I   +
Sbjct: 1537 VCLARSLLRSPKVMLLDEATASIDYQSDARIQQTIRS--EFSDSTILTIAHRLRSIIDYD 1594

Query: 635  NVIVLGKDGSVIEAGKFKELFANPNS 660
             ++V+   G V E      L  N NS
Sbjct: 1595 KILVMDA-GEVKEYDHPYSLLLNKNS 1619

 Score = 88.2 bits (217), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 63/237 (26%), Positives = 118/237 (49%), Gaps = 9/237 (3%)

Query: 424 KGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTN 483
           +  I F+N +FS+  +  +   K++NI    G    ++GP+G GK+++ + LL   +   
Sbjct: 686 RNKIGFENATFSWDRKNPDFKLKNMNIDFKLGKLNVVIGPTGSGKTSLLMGLLGEMDLLE 745

Query: 484 GQIL---VDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVA 540
           G++    +D ++   +    +   I    Q   L++ T+++NI +  + P  +    +V 
Sbjct: 746 GKVYAPCLDPREDMVIENDGMTNSIAYCSQAAWLLNDTVKNNILF--SSPFNEGRYNAVI 803

Query: 541 KQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE 600
           + C           G  T IG +G  LSGGQ+QR+++ARAL      L+LD+  SA+D  
Sbjct: 804 EACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARALYSSSRHLLLDDCLSAVDSH 863

Query: 601 SEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELF 655
           +   I  N   G LM+  +  +VS  H ++   ++   +V  ++G V + G+  EL+
Sbjct: 864 TALWIYENCISGPLMEGRTCILVS--HNVALTLKNAEWVVFMENGRVKDQGEPLELY 918

>NDAI0H00190 Chr8 complement(20586..25634) [5049 bp, 1682 aa] {ON}
            Anc_4.6
          Length = 1682

 Score =  138 bits (348), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 133/511 (26%), Positives = 225/511 (44%), Gaps = 50/511 (9%)

Query: 183  RLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIG 242
            ++   +++  LH    F+D   +G +++R   D   V + +T  +   F  L+     + 
Sbjct: 1159 KIFKSLLHTVLHSKLRFFDATPIGRIMNRFSKDIEAVDQELTPYLEAAFYCLVECVSTML 1218

Query: 243  MMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQ-LTRVAEEQLSGVKTV 301
            ++  I+P+   +L  F   + +    F        K  +  T   + +   E L G+ T+
Sbjct: 1219 LIAFITPQFL-ILAIFIGFLYYLVGYFYMAASRELKRFESVTKSPIYQHFSETLVGIVTI 1277

Query: 302  QSFVAEQR----ELHRY---NGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYG 354
            +++  E+R     LH+    N     ++   R  +F   +   S  + G   FI++ +  
Sbjct: 1278 RAYGDEKRFMLENLHKIDENNKPFFYLWAFNRWLSF-RIDMIGSLVVFGAGVFIILNIDN 1336

Query: 355  SYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTD------- 407
                L   L    LT  + +TE    +   L  FY+++   + +  RL +  +       
Sbjct: 1337 ----LDSGLAGISLTYAISFTE----AALWLVRFYADVEMNMNSVERLKEYMEIDQEPYE 1388

Query: 408  -HISSISPTKGQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSG 465
             H+   S        P  G IE  N+S  Y P  P  ++ K++   V P   V +VG +G
Sbjct: 1389 EHLER-SEVLAVDNWPRNGKIEVNNLSLRYAPNLP--KVIKNVTFVVEPNCKVGVVGRTG 1445

Query: 466  RGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNIT- 524
             GKSTI   L R+ +   G I +D  DI+ VN   LRR I ++ Q+P L SGTIR N+  
Sbjct: 1446 AGKSTIITALFRFLDAETGYIKIDDIDITTVNLTKLRRSITIIPQDPTLFSGTIRSNLDP 1505

Query: 525  YG-LAEPATKEEIRSV--------------AKQCFCHNFITKFPDGYDTMIGAQGALLSG 569
            Y   ++ A  + +R V                       + KF +     I   G  LS 
Sbjct: 1506 YNEFSDDAIFKALRRVNLINENESTGPASSETSPSSTENVNKFLN-LKNEITEGGNNLSH 1564

Query: 570  GQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLST 629
            GQRQ + +AR+L++ P I++LDEAT+++D  S+  I  T  +  K    TI++IAHRL +
Sbjct: 1565 GQRQLVCLARSLLRCPKIILLDEATASIDNASDAKIQETIRKEFKES--TILTIAHRLRS 1622

Query: 630  IKRSENVIVLGKDGSVIEAGKFKELFANPNS 660
            +   + ++V+   G V E      L  N NS
Sbjct: 1623 VCDYDKILVMDA-GEVKEYDHPYSLLLNKNS 1652

 Score =  103 bits (256), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 114/473 (24%), Positives = 216/473 (45%), Gaps = 56/473 (11%)

Query: 204 KVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSI---SPELSGVLLF-FA 259
            +G +I+ +  DA+ VS  +   +    +AL+   V + ++  +   +  + G L+  F 
Sbjct: 511 NLGAIINLMAVDAFKVSE-ICGYLHFFVEALLMVVVALALLYHLLGYAALVGGALVVAFL 569

Query: 260 PPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAE-----------Q 308
           P  L  A++ G+   +  K L     ++ ++  E    ++ ++ F  E           +
Sbjct: 570 PLNLKLATLLGE---YQKKSLAVTDKRIQKL-NETFQAIRIIKYFSWEDNFTRDIETVRE 625

Query: 309 RELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDL 368
           +ELH        ++      AF +  +F + +++   SF        Y+ +QG  T+   
Sbjct: 626 KELHL-------LFKRSLIWAFSSFIWFITPSIVTSCSF------AFYIYVQGE-TLTTP 671

Query: 369 TAFMLYTEYT--GSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKY----IP 422
            AF   + +T   + +  L+   S ++Q   +  R+ DL      +   + +KY    I 
Sbjct: 672 VAFTALSLFTLLKTPLDQLSNMISFVIQSKVSLDRIQDL------LQEKETEKYSQLTID 725

Query: 423 GKGD-IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNP 481
             G+ I F+N + ++  +      +D+NI   PG    ++GP+G GKS++ L LL   + 
Sbjct: 726 KNGNRIAFQNATVAWDKKNSEFKLRDLNIDFKPGKLNVVIGPTGSGKSSLLLALLGEMHL 785

Query: 482 TNGQILV---DGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRS 538
            NG I+V   D +D   ++   +   I    Q   L++ T+R+NI +    P  +    +
Sbjct: 786 ENGNIIVPSLDPRDELVIDHDGMTNSIAYCSQGAWLLNDTVRNNILFN--SPYNEARYNA 843

Query: 539 VAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALD 598
           V + C           G  T IG +G  LSGGQ+QR+++ARAL      ++LD+  SA+D
Sbjct: 844 VVEACCLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARALYSNSRHVLLDDCLSAVD 903

Query: 599 VESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAG 649
             +   I  N   G LM++ +  +VS  H ++   R+  ++V+ +DG V + G
Sbjct: 904 SHTALWIYDNCITGPLMENRTCILVS--HNIALTLRNAELVVILEDGRVKDQG 954

>Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  136 bits (343), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 131/509 (25%), Positives = 227/509 (44%), Gaps = 59/509 (11%)

Query: 188  VMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSI 247
            ++NK LH    F+D    G +++R   D   + + +T  +   F +LI     + ++  I
Sbjct: 1141 ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFI 1200

Query: 248  SPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAE 307
            +P+   V +  +    +    +    R   +    +   + +   E L GV T+++F  E
Sbjct: 1201 TPQFLSVAIVVSILYYFVGYFYMAGSRELKRFESISRSPIYQHFSETLVGVTTIRAFGDE 1260

Query: 308  QR-------ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQ 360
             R       ++   N     ++   R  AF   +   S  + G   FI+  +      L 
Sbjct: 1261 GRFMQENLQKIDENNKPFFYLWVANRWLAF-RIDMIGSLVIFGAGLFILFNINH----LD 1315

Query: 361  GSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKY 420
              +    LT  + +TE        L   Y+E+   + +  R+ +  +      P    K 
Sbjct: 1316 SGMAGISLTYAISFTE----GALWLVRLYAEVEMNMNSVERVKEYME--IEQEPYNQHKE 1369

Query: 421  IP-----GKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALL 474
            +P       G IE  ++S  Y P  P  ++ K+++  V   S + IVG +G GKSTI   
Sbjct: 1370 VPPPQWPQDGKIEVNDLSLRYAPNLP--RVIKNVSFSVDAQSKIGIVGRTGAGKSTIITA 1427

Query: 475  LLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDN------------ 522
            L R+  P  G I +D  DIS V+ + LRR I ++ Q+P L SGTI+ N            
Sbjct: 1428 LFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPYDEFSDRKI 1487

Query: 523  ---------ITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQ 573
                     I+   ++  T  E  +        N + KF D   + +   G+ LS GQRQ
Sbjct: 1488 FEALKRVNLISEEQSQQGTTREADNDNSSTNSEN-VNKFLD-LSSEVSEGGSNLSQGQRQ 1545

Query: 574  RIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRS 633
             + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + GS TI++IAHRL ++   
Sbjct: 1546 LMCLARSLLRSPKIILLDEATASIDYGSDAKIQETIRKEFQ-GS-TILTIAHRLRSVIDY 1603

Query: 634  ENVIVLGKDGSVIEAGKFKELFANPNSEL 662
            + ++V+       +AG+ KE + +P S L
Sbjct: 1604 DKILVM-------DAGEVKE-YDHPYSLL 1624

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 64/233 (27%), Positives = 115/233 (49%), Gaps = 9/233 (3%)

Query: 422 PGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNP 481
           P      F+N + S+    ++   KD+NI+   G    ++GP+G GK+++ + LL     
Sbjct: 689 PNGKRFAFENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 482 TNGQILVDGQDISK---VNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRS 538
            +G+++V   +  +   V+       I    Q   L++ T+++NI +    P  +   ++
Sbjct: 749 LSGKVVVPALEPRQELVVDANGTTNAIAYCSQGAWLLNDTVKNNILFN--SPFNEARYKA 806

Query: 539 VAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALD 598
           V + C           G  T IG +G  LSGGQ+QR+++ARAL      ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGITLSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 599 VESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAG 649
             +   I  N   G LM+  +  +VS  H ++   R+  ++VL +DG V + G
Sbjct: 867 SHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRVKDQG 917

>NCAS0E04160 Chr5 (818254..822774) [4521 bp, 1506 aa] {ON} Anc_5.10
          Length = 1506

 Score =  135 bits (341), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 91/257 (35%), Positives = 140/257 (54%), Gaps = 25/257 (9%)

Query: 422  PGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYN 480
            P KG+I F+NV FSY P  P   + K++++ +  G  + I G +G GKSTI   L R   
Sbjct: 1240 PTKGEIHFENVDFSYRPGLP--TVLKNLSLDIKSGEKIGICGRTGAGKSTIMSALYRLNE 1297

Query: 481  PTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDN----------------IT 524
             ++G++++D  DIS +    LRR + ++ Q+P+L  GTIR N                + 
Sbjct: 1298 ISSGKMIIDDVDISTIGLYDLRRKLAIIPQDPVLFRGTIRKNLDPFNEHQDEHLWNALVR 1357

Query: 525  YGLAEPATKEEIRSVA-KQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIK 583
             G  E     EI++    +   H+ + KF    D ++  +GA  S G+RQ +A+ RAL++
Sbjct: 1358 GGAIEQKELNEIKAQKPDEKGNHSEMYKF--HLDQLVEEEGANFSLGERQLLALTRALVR 1415

Query: 584  KPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDG 643
            +  IL+LDEATS++D E++G I     +  + G  TI+ IAHRL TI   + ++VL K G
Sbjct: 1416 QARILILDEATSSVDYETDGKIQARIVE--EFGHCTILCIAHRLKTILTYDRILVLEK-G 1472

Query: 644  SVIEAGKFKELFANPNS 660
             V E    K LFA  +S
Sbjct: 1473 EVAEFDTPKTLFAQEDS 1489

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 112/211 (53%), Gaps = 20/211 (9%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           F D+N ++  G  + +VGP G GK+++      + N  +G+I ++G D+           
Sbjct: 649 FHDLNFEIKKGEFIIMVGPIGTGKTSLLNAFAGFMNKVSGRIQING-DL----------- 696

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
             L+   P + + +++DNI +G   P  K +   V + C   + +   P G  T IG +G
Sbjct: 697 --LLCGYPWIQNASVKDNIIFG--SPYNKAKYDEVIRVCSLKSDLDILPAGDLTEIGERG 752

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSMTIVSI 623
             LSGGQ+ RI +AR++ K+ +I + D+  SA+D    +  ++  F  L+K  +  + + 
Sbjct: 753 ITLSGGQKARINLARSVYKQKDIYLFDDVLSAVDSRVGKHIMDECFLGLLKDKTRILAT- 811

Query: 624 AHRLSTIKRSENVIVLGKDGSVIEAGKFKEL 654
            H+LS ++R+  VIVLG DGS  + G  +EL
Sbjct: 812 -HQLSLLERASRVIVLGNDGS-FDIGTVEEL 840

>NCAS0J00160 Chr10 complement(12361..17325) [4965 bp, 1654 aa] {ON} 
          Length = 1654

 Score =  135 bits (341), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 126/505 (24%), Positives = 229/505 (45%), Gaps = 58/505 (11%)

Query: 188  VMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSI 247
            ++ K +H    F+D+  +G +++R   D   + + +   V   F +L+     I ++  I
Sbjct: 1145 LLKKVMHSKLRFFDSTPIGRIMNRFSKDIEAIDQELAPVVQGAFYSLVSCVTTILLITFI 1204

Query: 248  SPELSGV------LLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTV 301
            +P+   V      L +       +AS   K+    +K        + +   E L GV T+
Sbjct: 1205 TPQFLSVAILVTGLYYLIGYFYLAASREFKRFDSITK------SPIYQHFSETLVGVTTI 1258

Query: 302  QSFVAEQR-------ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYG 354
            ++F  E R       ++   N     ++   R  +F   +   +  + G  SFI+  +  
Sbjct: 1259 RAFGDEGRFMQENLSKIDENNRPFFYLWVANRWLSF-RIDMVGALVVFGSGSFIIWNIKN 1317

Query: 355  SYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLT----DHIS 410
                +   +    LT  + +TE        L   YS +   + +  RL +      +   
Sbjct: 1318 ----IDAGMAGISLTYAISFTE----GALWLVRLYSNVEMNMNSVERLKEYMKIEQEPYE 1369

Query: 411  SISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKST 470
              + T   ++ P +G IE  ++S  Y      ++ K++   V P + + IVG +G GKST
Sbjct: 1370 DATCTPPPEW-PQEGKIEVCDLSLRY-AEGLPRVIKNVTFTVAPKAKIGIVGRTGAGKST 1427

Query: 471  IALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNIT-YGLAE 529
            I   L R+ +P  G I +D  DI+ +N   LRR I ++ Q+P L +GTI+ N+  YG   
Sbjct: 1428 IITALFRFLDPETGYIKIDNIDITSINLNKLRRSINIIPQDPTLFTGTIKSNLDPYGEYS 1487

Query: 530  PA-----------TKEEIRS-VAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAI 577
                           E++ S +  +      + KF +  +  I   G+ LS GQRQ + +
Sbjct: 1488 DEDMFTALRRVNLVPEDVSSNIETESISSQNVNKFLN-LNNEISEGGSNLSQGQRQLVCL 1546

Query: 578  ARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVI 637
            AR+L++ P I++LDEAT+++D  S+  I  T  +  +  S TI++IAHRL ++   + ++
Sbjct: 1547 ARSLLRSPKIMLLDEATASIDYNSDAKIQETIRK--EFNSSTILTIAHRLRSVIDYDKIL 1604

Query: 638  VLGKDGSVIEAGKFKELFANPNSEL 662
            V+       +AG+ KE + +P S L
Sbjct: 1605 VM-------DAGEVKE-YDHPYSLL 1621

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 104/420 (24%), Positives = 193/420 (45%), Gaps = 41/420 (9%)

Query: 254 VLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLT--RVAE--EQLSGVKTVQSFVAEQR 309
           V+L  AP   + A++ GK        +Q+AT  +T  R+ +  E L  ++ ++ F  E  
Sbjct: 542 VILIAAPANYYFATLLGK--------IQKATLLVTDKRIQKLNESLQAIRIIKFFSWEDN 593

Query: 310 ELHRYNGAIRGIYN------VGRKAAFINAEF--FTSTTMLGDMSFIVVLLYGSYLVLQG 361
               +  +I  +        + R  A++ + F  F + +++   +F    +Y    VL  
Sbjct: 594 ----FEKSINDVREQELQLLLKRSMAWVCSSFVWFVTPSLVTAAAF-AFYIYVQKEVLTT 648

Query: 362 SLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYI 421
            +    L+ F L      + +  L+   S ++Q   +  R+ D    + + +    Q  +
Sbjct: 649 PIAFTALSLFTLLR----NPLDQLSDMLSFVIQSKVSLDRIRDFL--LETDTAKYDQLTV 702

Query: 422 PGKGD-IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYN 480
             +GD +EFKN + S+ +  ++   KD+NI    G    ++GP+G GK+++ + LL    
Sbjct: 703 APQGDQLEFKNTTVSWDSSAQDFKLKDLNIDFKIGKLNVVIGPTGSGKTSLLMALLGEMK 762

Query: 481 PTNGQILV---DGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIR 537
              G+I+V   D ++   V+       I    Q   L++ T+R+NI +    P  +    
Sbjct: 763 IMEGEIIVPSLDPREDLVVDENGTTNSIAYCSQAAWLLNDTVRNNILFN--SPYNEARYT 820

Query: 538 SVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSAL 597
           SV + C           G  T IG +G  LSGGQ+QR+++ARA+      ++LD+  SA+
Sbjct: 821 SVIEACGLKRDFEILKAGDMTEIGEKGITLSGGQKQRVSLARAMYSNSRHILLDDCLSAV 880

Query: 598 DVESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELF 655
           D  +   I  N   G LM   +  +VS  H ++   ++ +++V+ +DG V + G   EL 
Sbjct: 881 DSHTALWIYDNCITGPLMDGRTCILVS--HNIALTLKNADLVVILEDGKVKDQGDPMELL 938

>TBLA0A03800 Chr1 complement(947158..951798) [4641 bp, 1546 aa] {ON}
            Anc_8.303 YDR135C
          Length = 1546

 Score =  134 bits (338), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 138/551 (25%), Positives = 238/551 (43%), Gaps = 95/551 (17%)

Query: 184  LRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGM 243
            L S ++   L     F++T  +G +++R  +D Y V   + +  S  F       V +  
Sbjct: 1009 LHSQMLASVLRAPMSFFETTPIGRILNRFSNDMYKVDELLGRTFSQFFS----NAVKVTF 1064

Query: 244  MVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVA-----EEQLSGV 298
             + +    +   +FF  P+ +    + +    TS++L+     +TR       +E L G+
Sbjct: 1065 TLVVICVSTWQFIFFIVPMSFLYIYYQQYYMRTSRELRRL-DSVTRSPTISHFQETLGGI 1123

Query: 299  KTVQSFVAEQRELH----RYNGAIRGIY---NVGRKAAFINAEFFTSTTMLGDMSFIVVL 351
             T++ +  E R +H    R +  +   Y   N  R  AF   EF  S  +LG  +     
Sbjct: 1124 STIRGYSQENRFIHINQQRVDNNMSAYYPSINCNRWLAF-RLEFLGSVIILGASTL---- 1178

Query: 352  LYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISS 411
              G Y + QG++T G +   + Y      S+  +     E+   + +  R+ + ++ ++S
Sbjct: 1179 --GIYRLSQGNMTPGMIGLSLSYALQITQSLNWIVRMTVEVETNIVSVERIKEYSE-LAS 1235

Query: 412  ISPT-----KGQKYIPGKGDIEFKNVSFSYPTRPE---NQIFKDINIKVPPGSNVCIVGP 463
             +P+     +     P  G ++F +    Y TR     + + KDI + + P   + IVG 
Sbjct: 1236 EAPSIVEDKRPDVNWPQDGAVKFNH----YYTRYRADLDYVLKDITLDIKPREKIGIVGR 1291

Query: 464  SGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNI 523
            +G GKS++ L L R    + G I VDG +  ++    LR  + ++ Q+  +  GT+RDNI
Sbjct: 1292 TGAGKSSLTLALFRIIEASEGNINVDGINTDEIGLYDLRHKLSIIPQDSQVFEGTVRDNI 1351

Query: 524  TYGLAEPA---TKEEIRSVAKQCFCHNFITKF---------------------------- 552
                 +P    T EEI    +     + I                               
Sbjct: 1352 -----DPTGQYTDEEIWKALELSHLKSHIINMSKHSSSDSSSNESLSPASNNSSGNNDNS 1406

Query: 553  ----------------PDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSA 596
                             +  +T +   G+ LS GQRQ + +ARAL+   NILVLDEAT+A
Sbjct: 1407 NSSSDGLTSSGLEDISHNALNTKLSEGGSNLSVGQRQLMCLARALLVPSNILVLDEATAA 1466

Query: 597  LDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFA 656
            +DVE++  I  T     K  + TI++IAHRL+TI  S+ ++VL K G + E    + L  
Sbjct: 1467 VDVETDQLIQETIRSAFK--NRTILTIAHRLNTIMDSDRILVLDK-GEIKEFDSPQTLLG 1523

Query: 657  NPNS---ELCK 664
            + +S    LC+
Sbjct: 1524 DKDSLFYSLCE 1534

 Score =  110 bits (276), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 121/509 (23%), Positives = 229/509 (44%), Gaps = 47/509 (9%)

Query: 184 LRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYV---VSRSMTQKVSDGFKALICGGVG 240
           + S +  K+L   +E   T   GD+++ +  D      V++      S  F+  +C  V 
Sbjct: 365 MSSVIYQKSLVLSNEASGTSSTGDVVNLMSVDVQRLQDVAQWCNIIWSGPFQITLCL-VS 423

Query: 241 IGMMVSISPELSGVLLFFAPPI---LWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSG 297
           +  ++  S  +   +L F  PI   L       +KI+  +KD      + TR+  E L+ 
Sbjct: 424 LYKLLGNSMWIGVFILIFMMPINSYLMRIQKKLQKIQMKNKD------ERTRLISEILNN 477

Query: 298 VKTVQSFV-----AEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLL 352
           +K+++ +       E+ E  R    ++ +  +G   AF + +F      L   S   V +
Sbjct: 478 IKSLKLYAWEAPYKEKLEYVRNEKELKNLTKMGCYVAFTHFQF-NIVPFLVSCSTFAVFV 536

Query: 353 YGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFD-LTDHISS 411
           +     L   L    LT F L +    +    +T+F    ++   + +RLF  LT+    
Sbjct: 537 WTQDRPLTTDLVFPALTLFNLLSFPMAAIPIMITSF----IEASISINRLFSFLTNEELQ 592

Query: 412 ISPTKGQKYIPGKGDIEFK---NVSFSYPTRPENQI-FKDINIKVPPGSNVCIVGPSGRG 467
               +    +   GD+  K   + +F +  +PE ++  K+IN +   G   CIVG  G G
Sbjct: 593 KDAVQRLPNVKNTGDVSIKLGDDATFLWKRKPEYKVALKNINFQARKGELTCIVGKVGSG 652

Query: 468 KSTIALLLLRYYNPTNGQILVDGQDISKVN-CKTLRRHIGLVQQEPILMSGTIRDNITYG 526
           KS +   +L               D+ +V    T+   +  V Q P +M+GT+++NI +G
Sbjct: 653 KSALIQSIL--------------GDLFRVKGFATVHGDVAYVSQVPWIMNGTVKENILFG 698

Query: 527 LAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPN 586
                 K+      K C     ++  PDG  T++G +G  LSGGQ+ R+++ARA+  + +
Sbjct: 699 --HKFDKKFYEKTIKACALTIDLSILPDGDSTLVGEKGISLSGGQKARLSLARAVYARAD 756

Query: 587 ILVLDEATSALDVE-SEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSV 645
             + D+  +A+D    +  I +  G      S T V   ++++ +  ++ + +L  +G +
Sbjct: 757 TYLFDDPLAAVDEHVGKHLIEHVLGPNGLLHSKTKVLATNKITVLNIADYITLL-DNGEI 815

Query: 646 IEAGKFKELFANPNSELCKLLTEKSSRSD 674
           I+ GK++E+ ++P S LCKL+ E   + +
Sbjct: 816 IQRGKYEEVTSDPGSPLCKLINEYGKKHE 844

>KAFR0L00190 Chr12 complement(21836..26797) [4962 bp, 1653 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1653

 Score =  134 bits (338), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 135/516 (26%), Positives = 230/516 (44%), Gaps = 69/516 (13%)

Query: 188  VMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSI 247
            +++K LH    F+D+  +G +++R   D   + + +       F + I     I ++  I
Sbjct: 1134 LLDKVLHAKLRFFDSTPIGRIMNRFSKDMEGIDQDLAPYFQGAFYSFIECITTIILITFI 1193

Query: 248  SPE------LSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTV 301
            +P+      + G+L +       + S   K++   +K        + +   E L GV T+
Sbjct: 1194 TPQFLSVAIIVGMLYYMIGYFYLTGSRELKRLDSITK------SPIYQHFSETLVGVTTI 1247

Query: 302  QSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIV-----VLLYGSY 356
            ++F  E R L         +  +       N  FF        +SF +     ++++GS 
Sbjct: 1248 RAFGDESRFLRE------NLLKIDEN----NRPFFYLWVANRWLSFRIDVIGALVVFGSG 1297

Query: 357  LVLQGSLTIGD-------LTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLT--- 406
            + +  ++   D       LT  + +TE        L  FYSE+   + +  R+ +     
Sbjct: 1298 IFILTNINTIDSGMAGISLTYAISFTE----GALWLVRFYSEVEMNMNSVERVHEYMTIE 1353

Query: 407  ----DHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVG 462
                D +  +S +K     P +G IE  ++S  Y      ++ K++   V P + V +VG
Sbjct: 1354 QEPYDEVQ-VSDSKVPADWPEEGRIEVSDLSLRYAAHLP-KVIKNVTFNVDPRAKVGVVG 1411

Query: 463  PSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDN 522
             +G GKSTI   L R+     G I +DG DI+ VN   LRR I ++ Q+P L SGTI+ N
Sbjct: 1412 RTGAGKSTIITALFRFLEAETGYIKIDGLDITSVNLTRLRRSITIIPQDPTLFSGTIKSN 1471

Query: 523  I----TYGLAEP---------ATKEEIRSVAKQ-----CFCHNFITKFPDGYDTMIGAQG 564
            +     Y   E           T+EE+ S  +            I +F D  ++ I   G
Sbjct: 1472 LDPYDEYKDEEVFEALRRVNLVTEEELSSRTENNNDEASVSSKNINRFLD-LESEIAEGG 1530

Query: 565  ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIA 624
               S GQRQ I +AR+L++ P IL+LDEAT+++D +S+  +  T     +    TI++IA
Sbjct: 1531 TNFSQGQRQLICLARSLLRSPKILLLDEATASIDYDSDAKVQETIRT--EFSESTILTIA 1588

Query: 625  HRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS 660
            HRL ++   + ++V+G  G V E      L  N NS
Sbjct: 1589 HRLRSVIDYDKILVMGA-GEVKEYDHPYSLLLNKNS 1623

 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 113/232 (48%), Gaps = 9/232 (3%)

Query: 423 GKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPT 482
            K  I FKN + ++    ++   +++NI    G    I+GP+G GK+++ + LL   N  
Sbjct: 697 NKNQIAFKNTTVAWDNSRDSFKLRNLNIDFKVGKLNVIIGPTGSGKTSLLMALLGEMNLL 756

Query: 483 NGQILVDGQDISK---VNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSV 539
            GQI+V   +      V        I    Q   L++ T+R+NI +    P  +    +V
Sbjct: 757 EGQIVVPALNARHDLIVESDGTTNSIAYCSQAAWLLNDTVRNNILFN--SPYNETRYHNV 814

Query: 540 AKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDV 599
            + C           G  T IG +G  LSGGQ+QRI++ARAL      ++LD+  SA+D 
Sbjct: 815 VEACGLRRDFEILKAGDMTEIGEKGIALSGGQKQRISLARALYSNSRHVLLDDCLSAVDA 874

Query: 600 ESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAG 649
            +   +  N   G LM+  +  +VS  H ++   R+ +++V+ +DG V + G
Sbjct: 875 HTALWVYDNCITGPLMEGRTCILVS--HNIALTLRNADLVVMLEDGQVKDQG 924

>Skud_8.9 Chr8 complement(16026..20789) [4764 bp, 1587 aa] {ON}
            YHL035C (REAL)
          Length = 1587

 Score =  134 bits (338), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 137/525 (26%), Positives = 240/525 (45%), Gaps = 71/525 (13%)

Query: 183  RLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIG 242
            ++ + +++  LH +  F+D   VG +++R   D   V + +   +      LI     I 
Sbjct: 1074 KIFNNMLDLVLHANIRFFDVTPVGRIMNRFAKDIEGVDQELIPYLEVTIFCLIQCLSIIF 1133

Query: 243  MMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQ 302
            ++  I+P    V +       +    +    R   +        + +   E L+GV T++
Sbjct: 1134 LITIITPRFLVVAVVVLVLYYFVGKCYLSAGRELKRIDSITKSPIFQYFSETLAGVCTIR 1193

Query: 303  SFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVL-QG 361
            +F  E+R +      +  +  + +     N  FF  +  +   +F V ++ G+++VL  G
Sbjct: 1194 AFGDEKRFI------LENMDKIDQN----NRAFFYLSVAVKWFAFRVDII-GAFIVLGSG 1242

Query: 362  S---LTIGDLTAFMLYTEYTGSSVF-----GLTTFYSELMQGVGAASRLFDLT------- 406
            S   L IGD+ + +     T S +F      L   YS     + +  RL + +       
Sbjct: 1243 SFILLNIGDIDSSLAGISLTYSILFTDGALWLVRLYSTFEMNMNSVERLKEYSGIEQENY 1302

Query: 407  --DHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPS 464
              +HI ++  +      P  G IE  N+S  Y +     + K+++  V P + + IVG +
Sbjct: 1303 NENHIQALQNSLW----PEHGKIEVDNLSLRYASNLP-PVIKNVSFTVDPQTKIGIVGRT 1357

Query: 465  GRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNIT 524
            G GKSTI   L R   P  G I +DG DISK++  TLRR I ++ Q+PIL +GTI+ N+ 
Sbjct: 1358 GAGKSTIITALFRLLKPVTGCIKIDGYDISKIDLVTLRRAITIIPQDPILFTGTIKSNL- 1416

Query: 525  YGLAEPATKEEIRSVAKQCFCHNFIT------------KFPDGYDTMIG-----AQGAL- 566
                +P  + + R + K     N I+             F   ++  +       +G L 
Sbjct: 1417 ----DPYDEYDERRIFKVLSQVNLISSRELEETLNREENFSGVHNRFLNLRTEIVEGGLN 1472

Query: 567  LSGGQRQRIAIARALIKKPNILVLDEATSALDVES----EGAINYTFGQLMKSGSMTIVS 622
            LS G++Q + IAR+L+++P I++LDEATS++D +S    +G I   F +       TI++
Sbjct: 1473 LSQGEKQLLFIARSLLREPKIILLDEATSSIDYDSDHLIQGIIRNEFSR------STILT 1526

Query: 623  IAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS---ELCK 664
            IAHRL ++   + V+V+   G V E     EL  N  S    +C+
Sbjct: 1527 IAHRLRSVIDYDKVLVMDA-GEVKEYDHPYELLKNERSIFYSMCR 1570

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 116/246 (47%), Gaps = 22/246 (8%)

Query: 422 PGKGDIEFKNVSFSYPTRPENQIFK----DINIKVPPGSNVCIVGPSGRGKSTIALLLLR 477
           P K  I+FK  +  +    +N I K    D+NI    G    I+G +G GKS + + LL 
Sbjct: 657 PDKNKIKFKKATLVW-NENDNDINKFRLCDLNINFRIGKLNLILGSTGSGKSALLMGLLG 715

Query: 478 YYNPTNGQILVDGQD-----ISKVNCKTLRRHIGLVQQEPILMSGTIRDNITY-GLAEPA 531
                +G I+V G +     I  +N   L        Q   L++GT+R+NI + G+ +  
Sbjct: 716 ELYLLSGSIIVPGLEPRHDMIPDLN--GLTNSFAYCSQSAWLLNGTVRNNIIFNGVYD-- 771

Query: 532 TKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLD 591
            +   ++V   C     +   P G  T IG +G  LSGGQ+QRI++ARA+      ++LD
Sbjct: 772 -ENRYKNVIDACGLKRDLEILPAGDSTEIGEKGITLSGGQKQRISLARAIYSNAKHVLLD 830

Query: 592 EATSALDVESEGAINYTF---GQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEA 648
           +  SA+D  +   I Y     G LMK  + T + + H +S   R     V+ ++G V   
Sbjct: 831 DCLSAVDSHTAIWI-YEICITGLLMK--NRTCILVTHNISLAIRKAYFAVILENGKVKSQ 887

Query: 649 GKFKEL 654
           G   EL
Sbjct: 888 GTITEL 893

>Skud_12.22 Chr12 complement(31933..36918) [4986 bp, 1661 aa] {ON}
            YLL048C (REAL)
          Length = 1661

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 134/516 (25%), Positives = 230/516 (44%), Gaps = 73/516 (14%)

Query: 188  VMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSI 247
            ++NK LH    F+D    G +++R   D   + + +T  +   F +LI     + ++  I
Sbjct: 1141 ILNKVLHSKIRFFDATPTGRIMNRFSKDIEAIDQELTPYIQGAFYSLIECLSTVILITFI 1200

Query: 248  SPEL------SGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTV 301
            +P+         +L +F      + S   K+    S+        + +   E L GV T+
Sbjct: 1201 TPQFLSIAIVVSILYYFVGYFYMAGSRELKRFESISR------SPIYQHFSETLVGVTTI 1254

Query: 302  QSFVAEQR-------ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYG 354
            ++F  E R       ++   N     ++   R  AF   +   S  + G   FI   L+ 
Sbjct: 1255 RAFGDEGRFMQENLQKIDENNKPFFYLWVANRWLAF-RIDMIGSLVIFGAGLFI---LFN 1310

Query: 355  SYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLT-------D 407
               +  G   I  LT  + +TE        L   YSE+   + +  R+ +         +
Sbjct: 1311 IDHIDSGMAGIS-LTYAISFTE----GALWLVRLYSEVEMNMNSVERVKEYMKIEQEPYN 1365

Query: 408  HISSISPTKGQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGR 466
                + P++     P  G IE  ++S  Y P  P  ++  +++  V   S + IVG +G 
Sbjct: 1366 QHKEVPPSQW----PQDGKIEVNDLSLRYAPNLP--RVINNVSFSVDAQSKIGIVGRTGA 1419

Query: 467  GKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDN---- 522
            GKSTI   L R+  P  G I +D  DIS V+ + LRR I ++ Q+P L SGTI+ N    
Sbjct: 1420 GKSTIITALFRFLEPETGHIKIDNIDISGVDLQRLRRSITIIPQDPTLFSGTIKTNLDPY 1479

Query: 523  --------------ITYGLAEPATKEEIRSVAKQCFCHNF--ITKFPDGYDTMIGAQGAL 566
                          +     E + +  +R        ++   I KF D   + +   G+ 
Sbjct: 1480 DEFSDKKIFEALKRVNLISEEQSHQGAVREADNDTSSNSSENINKFLD-LSSEVSEGGSN 1538

Query: 567  LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHR 626
            LS GQRQ + +AR+L++ P I++LDEAT+++D  S+  I  T  +  + GS TI++IAHR
Sbjct: 1539 LSQGQRQLMCLARSLLRSPKIILLDEATASIDYSSDAKIQETIRKEFQ-GS-TILTIAHR 1596

Query: 627  LSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSEL 662
            L ++   + ++V+       +AG+ KE + +P S L
Sbjct: 1597 LRSVIDYDKILVM-------DAGEVKE-YDHPYSLL 1624

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 113/233 (48%), Gaps = 9/233 (3%)

Query: 422 PGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNP 481
           P       +N + S+    ++   KD+NI+   G    ++GP+G GK+++ + LL     
Sbjct: 689 PNGKRFALENSTISWDKDNQDFKLKDLNIEFKTGKLNVVIGPTGSGKTSLLMALLGEMYL 748

Query: 482 TNGQILVDGQDISK---VNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRS 538
            NG+I+V   +  +   V+       I    Q   L++ TI+ NI +    P  +   ++
Sbjct: 749 LNGKIVVPALEPRQELVVDANGTTNSIAYCSQGAWLLNDTIKHNILFN--SPFNEARYKA 806

Query: 539 VAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALD 598
           V + C           G  T IG +G  LSGGQ+QR+++ARAL      ++LD+  SA+D
Sbjct: 807 VVEACGLKRDFEILKAGDLTEIGEKGIALSGGQKQRVSLARALYSNARHVLLDDCLSAVD 866

Query: 599 VESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAG 649
             +   I  N   G LM+  +  +VS  H ++   R+  ++VL +DG + + G
Sbjct: 867 SHTASWIYDNCITGPLMEDRTCILVS--HNIALTLRNAELVVLLEDGRIKDQG 917

>YLL015W Chr12 (116432..121111) [4680 bp, 1559 aa] {ON}  BPT1ABC type
            transmembrane transporter of MRP/CFTR family, found in
            vacuolar membrane, involved in the transport of
            unconjugated bilirubin and in heavy metal detoxification
            via glutathione conjugates, along with Ycf1p
          Length = 1559

 Score =  134 bits (337), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 144/534 (26%), Positives = 251/534 (47%), Gaps = 51/534 (9%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQ 225
            N   I+ML   S R   +L   +    +     F++T  VG +I+R  SD   V  ++  
Sbjct: 1036 NLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVGRIINRFSSDMDAVDSNLQY 1095

Query: 226  KVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATG 285
              S  FK+++   V + ++    P      +F     ++  + +    R   + +  +  
Sbjct: 1096 IFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLVVIYIYYQTFYIVLSRELKRLISISYS 1155

Query: 286  QLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTST---TML 342
             +  +  E L+G   + ++   +R ++     I+  YNV     F +   + S    T+ 
Sbjct: 1156 PIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQ--YNVDFVFNFRSTNRWLSVRLQTIG 1213

Query: 343  GDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYT-EYTGSSVFGLTTFYSELMQGVGAASR 401
              +     +L  + +  +  L+ G +   M Y+ E TGS  + + T  + +   + +  R
Sbjct: 1214 ATIVLATAILALATMNTKRQLSSGMVGLLMSYSLEVTGSLTWIVRTTVT-IETNIVSVER 1272

Query: 402  LFDLTD---HISSISPTKG-QKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSN 457
            + +  +      SI+P K   +  P KG IEFKN S  Y    +  +  +IN+K+ P   
Sbjct: 1273 IVEYCELPPEAQSINPEKRPDENWPSKGGIEFKNYSTKYRENLD-PVLNNINVKIEPCEK 1331

Query: 458  VCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSG 517
            V IVG +G GKST++L L R   PT G+I++DG DIS +    LR H+ ++ Q+     G
Sbjct: 1332 VGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIGLFDLRSHLAIIPQDAQAFEG 1391

Query: 518  TIRDNITYGLAEP---ATKEEIRSVAKQCFCHNFITKF-----------------PDGYD 557
            T++ N+     +P    +++E++   +Q      + K                   D  D
Sbjct: 1392 TVKTNL-----DPFNRYSEDELKRAVEQAHLKPHLEKMLHSKPRGDDSNEEDGNVNDILD 1446

Query: 558  TMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGS 617
              I   G+ LS GQRQ + +ARAL+ +  ILVLDEAT+++D+E++  I  T  +  K   
Sbjct: 1447 VKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTIRREFKDR- 1505

Query: 618  MTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
             TI++IAHR+ T+  S+ +IVL + GSV E       F +P+    KLL++K+S
Sbjct: 1506 -TILTIAHRIDTVLDSDKIIVLDQ-GSVRE-------FDSPS----KLLSDKTS 1546

 Score = 99.4 bits (246), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 119/525 (22%), Positives = 230/525 (43%), Gaps = 81/525 (15%)

Query: 232 KALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVA 291
           KA+I G V + +M+ I+  LS                  +K++  SK   +      +  
Sbjct: 434 KAVIGGLVTMAIMMPINAFLS------------------RKVKKLSKTQMKYKDMRIKTI 475

Query: 292 EEQLSGVKTVQSFVAEQRELHRYNGA-----IRGIYNVGRKAAFINAEFFTSTTMLGDMS 346
            E L+ +K+++ +  E+  + R N       ++    +G  +  I   +     M+   +
Sbjct: 476 TELLNAIKSIKLYAWEEPMMARLNHVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVTCST 535

Query: 347 FIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL--FD 404
           F +  L+     L  ++    L+ F +      S+++ + +  + +++   +  RL  F 
Sbjct: 536 FGLFSLFSDS-PLSPAIVFPSLSLFNI----LNSAIYSVPSMINTIIETSVSMERLKSFL 590

Query: 405 LTDHISS-----ISPTKGQKYIPGKGDIEFKNVSFSYPTRP------------------- 440
           L+D I       I P+  ++ +P    IE  N++F + ++                    
Sbjct: 591 LSDEIDDSFIERIDPSADERALPA---IEMNNITFLWKSKEVLTSSQSGDNLRTDEESII 647

Query: 441 -ENQI-FKDIN-IKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVN 497
             +QI  K+I+  +   G  VC+VG  G GKST    +L       GQ+         + 
Sbjct: 648 GSSQIALKNIDHFEAKRGDLVCVVGRVGAGKSTFLKAIL-------GQLPCMSGSRDSIP 700

Query: 498 CKTLRRH--IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDG 555
            K + R   +    QE  +M+ ++R+NI +G      ++      K C     +   PDG
Sbjct: 701 PKLIIRSSSVAYCSQESWIMNASVRENILFG--HKFDQDYYDLTIKACQLLPDLKILPDG 758

Query: 556 YDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTF-GQLM 613
            +T++G +G  LSGGQ+ R+++ARA+  + +I +LD+  SA+D E S+  I Y   G+  
Sbjct: 759 DETLVGEKGISLSGGQKARLSLARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTA 818

Query: 614 KSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELF--ANPNSELCKLLTEKSS 671
              + TI+   + +S +K S+ +  L ++G ++E G ++++    N  S+L KLL E  S
Sbjct: 819 LLKNKTIILTTNTVSILKHSQMIYAL-ENGEIVEQGNYEDVMNRKNNTSKLKKLLEEFDS 877

Query: 672 RSDGNDSLPPPPPNATQDKVVEQIAEKILERFPEAGQSPDATVKE 716
             D  +       + ++ +V E +  K+ E      ++ D  V E
Sbjct: 878 PIDNGNESDVQTEHRSESEVDEPLQLKVTE-----SETEDEVVTE 917

>CAGL0G00242g Chr7 complement(20428..24861) [4434 bp, 1477 aa] {ON}
            highly similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281w YOR1 ATP-binding cassette transporter protein
          Length = 1477

 Score =  133 bits (335), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 146/545 (26%), Positives = 236/545 (43%), Gaps = 91/545 (16%)

Query: 167  FARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQK 226
            F  + M+ I++ +    L    + + LH    + DT  +G +++R   D   +   +T+ 
Sbjct: 954  FTMLCMMGIMASK---WLNLKAVKRILHAPMSYLDTTPLGRILNRFTKDTDSLDNELTE- 1009

Query: 227  VSDGFKALICGGVGIGMMVSISPELSGV-------LLFFAPPILWSASVFGKKIRHTSKD 279
                          I +M+S    + GV       L +FA  I +   VF     H    
Sbjct: 1010 -------------NIRLMMSQFANIIGVCVLCIVYLPWFAIAIPFLLLVFVLIADH---- 1052

Query: 280  LQEATGQLTRVAE-----------EQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKA 328
             Q A  ++ R+             E L G+ T++++ ++ R + + +  I  +  V    
Sbjct: 1053 YQSAGREIKRLEAIQRSFVYNNLIEVLGGMDTIKAYKSQDRYMTKMDFLINKMNEVSYMV 1112

Query: 329  AFINAEFFTSTTMLG-DMSFIVVLLYGSYLVLQGSLTIGDLTAFMLY------------- 374
              +         M+    + I+ LL  +         +G L  ++L              
Sbjct: 1113 VSVQRWVAIFLDMIAVAFALIISLLCVTRQFHISPSAVGVLLTYVLQLPGLLNTVLRALT 1172

Query: 375  -TEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVS 433
             TE   +S   L T+ +EL Q   AA R        S  SP       P  G++ F++VS
Sbjct: 1173 QTENDMNSAERLVTYATELPQE--AAYRK-------SDYSPPDNW---PTNGEVIFEDVS 1220

Query: 434  FSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQD 492
            F+Y P  P   + K++N+ +  G  + I G +G GKSTI   L R    T+G+I +DG D
Sbjct: 1221 FAYRPGLP--TVLKNVNLSIAGGEKIGICGRTGAGKSTIMTALYRLNELTSGRIFIDGID 1278

Query: 493  ISKVNCKTLRRHIGLVQQEPILMSGTIRDN----------------ITYGLAEPATKEEI 536
              K+    LRR + ++ Q+P+L  GTIR N                I  G  E    E+I
Sbjct: 1279 TFKLGLYDLRRKLSIIPQDPVLFRGTIRKNLDPFNEFSDDSLWNSLIRGGAIEKDDLEDI 1338

Query: 537  RSVA-KQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATS 595
            +     +   +N + KF    D ++   GA  S G+RQ +A+ RAL+++  IL+LDEATS
Sbjct: 1339 KHQKPDKNGSYNNMHKF--HLDQIVEEDGANFSLGERQVLALTRALVRQSKILILDEATS 1396

Query: 596  ALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELF 655
            ++D E++G I        +    TI+ IAHRL TI   + ++VL K G V E  K + LF
Sbjct: 1397 SVDYETDGKIQTRIATEFQ--DCTILCIAHRLKTILNYDRILVLEK-GEVAEFDKPEILF 1453

Query: 656  ANPNS 660
             N  S
Sbjct: 1454 NNEKS 1458

 Score = 97.1 bits (240), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 69/223 (30%), Positives = 117/223 (52%), Gaps = 21/223 (9%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           F ++N ++  G  + I GP G GKS++   +  +   T G++ ++G             H
Sbjct: 617 FSNLNFEIKKGEFIMITGPIGTGKSSLLNAMAGFMPQTTGELDING-------------H 663

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
           + L+   P + + T+RDNI +G   P  +E+ + V + C     I   P G  T IG +G
Sbjct: 664 M-LLCGYPWIQNATVRDNIIFG--SPYDREKYKEVIRVCSLQADIDILPAGDMTEIGERG 720

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSMTIVSI 623
             LSGGQ+ RI +AR++ K  +I + D+  SA+D    +  ++  F Q ++S +  + + 
Sbjct: 721 ITLSGGQKARINLARSVYKNKDIYLFDDVLSAVDSRVGKHIMDECFLQTLQSKTRILAT- 779

Query: 624 AHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLL 666
            H+LS I++++ VIVL  +GSV + G  +EL    N  L  LL
Sbjct: 780 -HQLSLIEKADRVIVLSTNGSV-DIGTVEEL-KTRNQTLINLL 819

>Suva_7.577 Chr7 (1007741..1012177) [4437 bp, 1478 aa] {ON} YGR281W
            (REAL)
          Length = 1478

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 92/262 (35%), Positives = 141/262 (53%), Gaps = 35/262 (13%)

Query: 422  PGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYN 480
            P KG+I FKNV FSY P  P   + K++N+ +  G  + I G +G GKSTI   L R   
Sbjct: 1209 PSKGEIAFKNVDFSYRPGLP--VVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNE 1266

Query: 481  PTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEP---ATKEEIR 537
             + G+IL+D  +IS++    LRR + ++ Q+P+L  GTIR N+     +P    T++E+ 
Sbjct: 1267 LSGGEILIDDVNISQIGLFDLRRKLAIIPQDPVLFRGTIRKNL-----DPFNERTEDELW 1321

Query: 538  -------SVAKQCF------------CHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIA 578
                   ++AK                H  + KF    D  +  +G+  S G+RQ +A+ 
Sbjct: 1322 DALVRGGAIAKNDLPEVKLQKPEENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALT 1379

Query: 579  RALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIV 638
            RAL+++  IL+LDEATS++D E++G I     +  + G  TI+ IAHRL TI   + ++V
Sbjct: 1380 RALVRQSKILILDEATSSVDYETDGKIQVRIVE--EFGDCTILCIAHRLKTIVNYDRILV 1437

Query: 639  LGKDGSVIEAGKFKELFANPNS 660
            L K G V E      LF+  +S
Sbjct: 1438 LEK-GEVAEFDTPWALFSQEDS 1458

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 73/230 (31%), Positives = 117/230 (50%), Gaps = 21/230 (9%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           FKD++ ++  G  + I GP G GKS++   +      T+G+I V+G D+           
Sbjct: 604 FKDLDFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG-DL----------- 651

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
             L+   P + + T++DNI +G   P  KE+   V   C     +   P G  T IG +G
Sbjct: 652 --LMCGYPWIQNATVKDNIIFG--SPFNKEKYDEVIHVCSLKADLDILPAGDMTEIGERG 707

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSMTIVSI 623
             LSGGQ+ RI +AR++ K+ +I + D+  SA+D    +  ++     L+++ +  + + 
Sbjct: 708 ITLSGGQKARINLARSVYKRKDIYLFDDVLSAVDSRVGKHIMDECLTGLLENKTRVLAT- 766

Query: 624 AHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRS 673
            H+LS I+++  VIVLG DG V + G   EL A  N  L  LL   S  S
Sbjct: 767 -HQLSLIEKASRVIVLGTDGDV-DIGTVDELKAR-NQTLINLLQFSSQTS 813

>TPHA0F00410 Chr6 (98503..103215) [4713 bp, 1570 aa] {ON} Anc_4.52
            YLL015W
          Length = 1570

 Score =  133 bits (335), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 131/542 (24%), Positives = 235/542 (43%), Gaps = 61/542 (11%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQ 225
            N   ++ML   S R   +L  G+    +     F++T  +G +++R  SD   +   +  
Sbjct: 1039 NIRTVIMLLYCSIRGSKKLHDGMALSVMRSPMSFFETTPIGRIVNRFSSDLEAIDSGLQY 1098

Query: 226  KVSDGFKA-------LICGGVGIGMMVSISPELSGVLLFF-APPILWSASVFGKKIRHTS 277
              S  F++       LI  G  +   ++++  L  +  ++ A  I+ S        R   
Sbjct: 1099 IFSFFFRSVLIYVVSLILVGYNLPWFIALNAVLIMIYFYYQAYYIMLS--------RELK 1150

Query: 278  KDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFT 337
            +    +   +  +  E L G   + +F    R  + +N      YN+     F +   + 
Sbjct: 1151 RLTTISYSPIMSLISETLGGFSVINAFDHTSR-FNFFNFETVQ-YNIDCVFQFRSTNRWL 1208

Query: 338  STTM--LGDMSFIVV-LLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQ 394
            S  +  +G++  +   LL  + L  +  L+ G +   M Y+    SS+  +     ++  
Sbjct: 1209 SVRLQTIGNLIILATGLLSFATLGTKKQLSSGMVGLLMSYSLQVTSSLMWIVRMTVQIET 1268

Query: 395  GVGAASRLFDLTDH-------ISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKD 447
             + +  R  +  +        I +  P +G    P +G IEF N +  Y    +  + KD
Sbjct: 1269 RIVSVERTLEYCELKPEALEIIENSRPPEGW---PREGAIEFNNYTTKYRENLD-PVLKD 1324

Query: 448  INIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGL 507
            IN+ + P   + IVG +G GKST+ L L R    T G I +DG DISK+  + LR ++ +
Sbjct: 1325 INVSIKPKEKIGIVGRTGAGKSTLTLALFRLIEATGGSISIDGIDISKIGLEDLRSNLAI 1384

Query: 508  VQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKF--------------- 552
            + Q+     GTIR N+     +  + EE+    +       I +                
Sbjct: 1385 IPQDAQAFEGTIRSNL--DPFDQHSDEELWRAVELSHLKQHILRMNEEANDRESDSSRTD 1442

Query: 553  ---PDGYD------TMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEG 603
               PD ++      T I   G+ +S GQRQ + ++RAL+    +L+LDEAT+A+D+E++ 
Sbjct: 1443 ITTPDSHNIKELLATPISKNGSNVSVGQRQLLCLSRALLNPSKVLILDEATAAIDMETDK 1502

Query: 604  AINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELC 663
             +  T     K    TI++IAHR+ T+   + ++VL K G V E      L ++ N+   
Sbjct: 1503 IVQDTIKNEFKER--TILTIAHRIDTVMNYDKILVLDK-GEVAEFDTVSNLLSDKNTMFY 1559

Query: 664  KL 665
            KL
Sbjct: 1560 KL 1561

 Score = 82.8 bits (203), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/237 (27%), Positives = 120/237 (50%), Gaps = 19/237 (8%)

Query: 449 NIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI-LVDGQDISKVNCKTLR-RHIG 506
           N  V  GS  CIVG  G GKSTI   +L       GQ+  +   D ++    T+R   I 
Sbjct: 650 NFTVKKGSLTCIVGKVGSGKSTILHAIL-------GQLPCISALDQTRAPKVTIRATSIA 702

Query: 507 LVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGAL 566
              QE  +M+ ++++NI +G         +  V + C   + ++  PDG +T++G +G  
Sbjct: 703 YCPQEAWIMNSSVKENIVFGHKHDENYYNL--VIQACQLASDLSILPDGDETIVGEKGIS 760

Query: 567 LSGG-QRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSM---TIV 621
           L GG Q+ RI++ARA+  + ++ +LD+  SA+D   S+  I Y   +  ++G +   TI+
Sbjct: 761 LVGGVQKARISLARAVYARADVYLLDDILSAVDAHVSKNIIKYVLSK--ETGLLRNKTII 818

Query: 622 SIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDS 678
              + ++ +K S+ +  + K G ++E   ++ +  + ++   K L E+   S  N +
Sbjct: 819 LSTNNVNVLKNSQKIYAIEK-GEIVEESDYENVMNSSDASRIKKLIEEFGTSTSNSN 874

>Skud_7.614 Chr7 (1027230..1031663) [4434 bp, 1477 aa] {ON} YGR281W
            (REAL)
          Length = 1477

 Score =  132 bits (333), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 133/501 (26%), Positives = 224/501 (44%), Gaps = 48/501 (9%)

Query: 191  KTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSIS-P 249
            + LH    + DT  +G +++R   D   +   +T+ +     +     VG+ +M  +  P
Sbjct: 974  RILHTPMSYIDTTPLGRILNRFTKDTDSLDNELTESLR-LLTSQFANIVGVCVMCIVYLP 1032

Query: 250  ELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQR 309
              +  + F     +  A  +    R   +        +     E L G+ T++++ +++R
Sbjct: 1033 WFAIAIPFLLVIFVLIADHYQSSGREIKRLEAVQRSFVYNNLNEVLGGMDTIKAYRSQER 1092

Query: 310  ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLT 369
             L + +  I    N   +A ++         +  DM  IV  L  + L +  +  I   +
Sbjct: 1093 FLAKSDFLI----NKMNEAGYLVVVLQRWVGVFLDMVAIVFALIVTLLCVTRAFPISAAS 1148

Query: 370  AFMLYTEYTGSSVFGLTTFYSELMQ---GVGAASRLFDLTDHIS--------SISPTKGQ 418
              +L T Y       L T    + Q    + +A RL      +          ++P +  
Sbjct: 1149 VGVLLT-YVLQLPGLLNTILRAMTQTENDMNSAERLVSYATELPLEADYRKPEMTPPESW 1207

Query: 419  KYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLR 477
               P KG+I  +NV FSY P  P   + K++N+ +  G  + I G +G GKSTI   L R
Sbjct: 1208 ---PSKGEIVLENVCFSYRPGLP--VVLKNLNLNIESGEKIGICGRTGAGKSTIMSALYR 1262

Query: 478  YYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIR 537
                + G+IL+D  DISK+    LRR + ++ Q+P+L  GTIR N+     +  T +E+ 
Sbjct: 1263 LNELSAGKILIDDVDISKLGLFDLRRKLAIIPQDPVLFRGTIRKNL--DPFDERTDDELW 1320

Query: 538  -------SVAKQCFCHNFITKFPD-----------GYDTMIGAQGALLSGGQRQRIAIAR 579
                   ++AK       + K PD             D  +  +G+  S G+RQ +A+ R
Sbjct: 1321 DALVRGGAIAKNDLSEAKLQK-PDKNGTHGRMHKFHLDQAVEEEGSNFSLGERQLLALTR 1379

Query: 580  ALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVL 639
            AL+++  IL+LDEATS++D E++G I     +  + G  TI+ IAHRL TI   + ++VL
Sbjct: 1380 ALVRQSKILILDEATSSVDYETDGKIQARIVE--EFGDCTILCIAHRLQTIVNYDRILVL 1437

Query: 640  GKDGSVIEAGKFKELFANPNS 660
             K G V E      LF   NS
Sbjct: 1438 EK-GEVAEFDTPWTLFTQENS 1457

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 116/236 (49%), Gaps = 19/236 (8%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           FKD+N ++  G  + I GP G GKS++   +      T+G+I V+G D+           
Sbjct: 604 FKDLNFEIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKIEVNG-DL----------- 651

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
             L+   P + +  +RDNI +G   P  KE+   V + C     +   P G  T IG +G
Sbjct: 652 --LMCGYPWIQNAPVRDNIIFG--SPFIKEKYNEVIRVCSLKADLDILPAGDMTEIGERG 707

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIA 624
             LSGGQ+ RI +AR++ K+  I + D+  SA+D      I       M +    I++  
Sbjct: 708 ITLSGGQKARINLARSVYKRKEIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILA-T 766

Query: 625 HRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLP 680
           H+LS I+R+  VIVLG DG V + G   EL A  N  L KLL   S  S   + +P
Sbjct: 767 HQLSLIERASRVIVLGTDGQV-DIGTVDELKAR-NQTLIKLLQFSSQNSKEEEDVP 820

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
            (BPT1) - ABC-type transmembrane transporter; highly
            homologous to human MRP1 and to C. elegans mrp-1 [contig
            184] FULL
          Length = 1538

 Score =  132 bits (331), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 144/530 (27%), Positives = 232/530 (43%), Gaps = 52/530 (9%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQ 225
            N   IV+L + S +   +L   +    +     F++T  VG +I+R  SD   +  S+ Q
Sbjct: 1023 NARTIVLLLVCSIKASRKLHDTMALAVIRSPMSFFETTPVGRIINRFSSDMNSLDDSV-Q 1081

Query: 226  KVSDGFKALICGG----VGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQ 281
             V   F   I       + IG  V +   ++ VLL     I +   V+   +    K L 
Sbjct: 1082 YVMSFFLVSILDYLVVVIIIGYQVPLFLIVNAVLLV----IYFYYQVYYVTLSRELKRLM 1137

Query: 282  EAT-GQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEF-FTST 339
              +   +  +  E L+G   + +F    R   R++       NV      IN  F F ST
Sbjct: 1138 STSFSPIMSMLSETLAGHMIIDAF----RHSDRFD-----YLNVENVQFNINCLFNFRST 1188

Query: 340  TMLGDMSF----IVVLLYGSYLVLQ-----GSLTIGDLTAFMLYTEYTGSSVFGLTTFYS 390
                 +       +++L  + L L       +L+ G +   M Y     + +  +     
Sbjct: 1189 NRWLSIRLESIGALMILTTALLSLATKNGGHALSTGMVGLLMSYALQVTNKLMWIVRMSV 1248

Query: 391  ELMQGVGAASRLFDLTDHISSISP----TKGQKYIPGKGDIEFKNVSFSYPTRPENQIFK 446
            +L   + +  R+ +  D      P    ++  K  P +G I FKN S  Y    +  + +
Sbjct: 1249 QLETNIVSVERIVEYCDLPPEAPPVIEDSRPPKNWPSQGLIRFKNYSTRYRANLD-PVLR 1307

Query: 447  DINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIG 506
             +++++ P   + IVG +G GKST++L L R   P+ G I +DG DISK+  K LR ++ 
Sbjct: 1308 HLDLEIKPQEKIGIVGRTGAGKSTLSLALFRILEPSEGTIDIDGVDISKIGLKDLRSNLS 1367

Query: 507  LVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFP----------DGY 556
            ++ Q+     GT+R N+     E  + EEI    +       I K            D  
Sbjct: 1368 IIPQDAQAFEGTVRTNL--DPFEQYSDEEIWKALELSHLKPHILKMAKDDADPEKKEDLL 1425

Query: 557  DTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG 616
             T I   G+ LS GQRQ + ++RAL+ +  ILVLDEAT+A+D E++  I  T     K  
Sbjct: 1426 QTKISENGSNLSVGQRQLLCLSRALLNRSRILVLDEATAAVDSETDRLIQETIRAEFKDR 1485

Query: 617  SMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS---ELC 663
              TI++IAHR+ T+  S+ ++VL K G V E      L A  +S    LC
Sbjct: 1486 --TILTIAHRIDTVMDSDKIMVLDK-GEVKEFDSPSNLLAQKDSIFYNLC 1532

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 65/238 (27%), Positives = 124/238 (52%), Gaps = 22/238 (9%)

Query: 445 FKDIN-IKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRR 503
            K+I+  +V  G  VC+VG  G GKST    LL       GQ+       S  +     R
Sbjct: 643 LKNIDGFQVFKGQLVCVVGRVGAGKSTFLQALL-------GQLPCISNSPSHASPTVHFR 695

Query: 504 --HIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIG 561
              + L  Q+  +M+ +++DN+ +G      +   ++  + C     +    DG +T++G
Sbjct: 696 ANSVALCSQQSWIMNASVKDNVLFG--HRFDEATYKATLEACQLVPDLEILADGDETLVG 753

Query: 562 AQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVES-----EGAINYTFGQLMKSG 616
            +G  LSGGQ+ R+++ARA+  + ++ +LD+  SA+D E      E  ++   G L+K+ 
Sbjct: 754 EKGISLSGGQKARLSLARAVYSRSDVYLLDDILSAVDAEVCKRIIEQVLSKKTG-LLKNK 812

Query: 617 SMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELF-ANPNSELCKLLTEKSSRS 673
             T++   + +S +K S+++  L +DG ++E+G F ++   + +S+L +L+ E  S +
Sbjct: 813 --TVILTTNSISVLKHSQSIYAL-EDGEIVESGSFNDIMRRDDSSKLKRLIVECESEN 867

>KLLA0D04059g Chr4 complement(338422..343128) [4707 bp, 1568 aa] {ON}
            similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1568

 Score =  132 bits (331), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 133/521 (25%), Positives = 226/521 (43%), Gaps = 50/521 (9%)

Query: 170  IVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSD 229
            I+M+   S R      + + +  +     F++T  VG +++R  SD   +       +S 
Sbjct: 1053 IIMMLFCSIRASKLFHNQMAHSVVMAPMSFFETTPVGRIVNRFSSDVNSIDEDFQHIISF 1112

Query: 230  GFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHT-SKDLQEATG--- 285
             F++++   + I   V I+  +   LLF    IL     + + +    S++L+  T    
Sbjct: 1113 FFRSMLDYLITI---VIITVSMPWFLLF--NTILLGIYYYYQTLYVVLSRELKRLTSISY 1167

Query: 286  -QLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEF-FTSTTMLG 343
              +  +  E L G   + ++          +  I   YN       IN  F F ST    
Sbjct: 1168 SPVMSLLSETLGGHVVINAY---------KHANIFNYYNFENIQTNINFIFNFRSTNRWL 1218

Query: 344  DMSF----IVVLLYGSYLVL-----QGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQ 394
             M       V++L  S + L        ++ G +   M Y     SS+  +      +  
Sbjct: 1219 SMRLQTIGAVIVLITSLMALASLGTSNPISAGLIGLLMSYALQVSSSLMWIIRMAVNIET 1278

Query: 395  GVGAASRLFDLTD----HISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINI 450
             + +  R+ +  D     I  I  ++  K  P +G+I F++ +  Y    +  + KDI++
Sbjct: 1279 TIVSVERIIEYRDLKPEGIRVIEDSRPPKNWPKRGEITFEHYTTKYRENLD-PVLKDIDL 1337

Query: 451  KVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQ 510
            ++     + +VG +G GKST+ L L R   P  G+I +DG DIS +    LRR + ++ Q
Sbjct: 1338 RIKHQEKIGVVGRTGAGKSTLTLALFRILEPFEGKITIDGIDISTLGLYDLRRSLSIIPQ 1397

Query: 511  EPILMSGTIRDNIT----YGLAEPATKEEIRSVAKQCFCHNFITKFPDG-------YDTM 559
            +     GT+R N+     +  AE     E+  +         +++ PD         DT 
Sbjct: 1398 DAQAFEGTVRSNLDPFNRHTDAEIWKALELSHLKPH--IERIVSELPDDENKPTDLLDTQ 1455

Query: 560  IGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMT 619
            I   G  LS GQRQ + ++RAL+    IL+LDEAT+A+D E++  I  T     K    T
Sbjct: 1456 ISDNGNNLSMGQRQLLCLSRALLNPSKILILDEATAAVDRETDKIIQETIRTAFKDR--T 1513

Query: 620  IVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS 660
            I++IAHR+ T+  S+ ++VL K G V E      L  N  S
Sbjct: 1514 ILTIAHRIDTVLDSDKIMVLDK-GEVKEFDTPDNLLKNKES 1553

 Score = 81.3 bits (199), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 110/457 (24%), Positives = 204/457 (44%), Gaps = 71/457 (15%)

Query: 233 ALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAE 292
           A I G V I +MV I+  ++ +             +F  ++++  K ++  T        
Sbjct: 431 ATIGGLVSIVIMVPINSYMTRLY----------KKLFKTQMQYKDKRIKTVT-------- 472

Query: 293 EQLSGVKTVQSFVAEQRELHRYNGAIRG---IYNVGRKAAFINAEFFTSTT--MLGDMSF 347
           E L+ +K+++ +  E+  L R N  +R    ++N+ + A   N  FF      +L   S 
Sbjct: 473 EILNSMKSIKLYAWEKPMLDRLNH-VRNDLELHNMKKIAIVSNFMFFCWNIVPLLVTCST 531

Query: 348 IVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL--FDL 405
            V+  Y +  VL   +    LT F +  +    ++F + T  S +++   +  RL  + L
Sbjct: 532 FVLFSYLTDQVLSPQIIFPSLTLFSMLND----ALFTVPTMISNIIEIGVSLKRLKGYLL 587

Query: 406 TDHISSISPTKGQKYIPGKGDIEFKNVSF----------SYPTRPENQI------FKDI- 448
            + + + S  +  +       +E  N  F          S  T  E +I       K I 
Sbjct: 588 AEELDT-SFIEHARATASDPTVEISNAVFLWKSPKSAASSEDTDEEAEISSPGVALKSIE 646

Query: 449 NIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI-LVDGQDISKVNCKTLRR--HI 505
           N         CIVG  G GKST    +L       GQ+  V     S V  K + R  ++
Sbjct: 647 NFSAKKAQLTCIVGRVGSGKSTFLQAIL-------GQLPCVSSDSASGVKPKVVIRADNL 699

Query: 506 GLVQQEPILMSGTIRDNITYGLA--EPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQ 563
               Q+P +M+ +++DNI +G    E   K+ I    K C     +   PDG  T++G +
Sbjct: 700 AYCPQQPWIMNASLKDNILFGYKYDEAMYKKTI----KACQLLPDLEILPDGDQTLVGEK 755

Query: 564 GALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQ---LMKSGSMT 619
           G  LSGGQ+ R+++ARA+  + ++ +LD+  SA+D    +  I+    +   L+K+   T
Sbjct: 756 GISLSGGQKARLSLARAVYSRADLYLLDDVLSAVDSHVCKSIIDDVLDRQKGLLKNK--T 813

Query: 620 IVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFA 656
           ++   + ++ +  S+ +I L K+G ++E+  ++E+ +
Sbjct: 814 VILTTNAVNVLVHSD-MIYLLKNGKIVESNSYEEVMS 849

>TPHA0F00180 Chr6 complement(23050..27990) [4941 bp, 1646 aa] {ON}
            Anc_4.6 YHL035C
          Length = 1646

 Score =  129 bits (325), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 129/505 (25%), Positives = 229/505 (45%), Gaps = 56/505 (11%)

Query: 188  VMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSI 247
            +++K LH    F+D+  +G +++R   D   + + +T  V    ++++   V +   V +
Sbjct: 1136 LLSKVLHSKLRFFDSTPIGRIMNRFSKDIEAIDQELTPYV----ESVVYNSVQLIATVLL 1191

Query: 248  SPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQ--EATGQ--LTRVAEEQLSGVKTVQS 303
               ++   +  A  ++      G      S++L+  E+T +  + +   E L GV T+++
Sbjct: 1192 ITYITNGFIVVALLVILLYYFVGVYYLSGSRELKRFESTTKSPIYQHFSETLVGVTTIRA 1251

Query: 304  FVAEQR-------ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSY 356
            +  E R       ++   N     ++   R   F   +   S  + G      VL+  + 
Sbjct: 1252 YGDEIRFMKENLTKIDENNKPFFYLWVANRWLCF-RIDIIGSLVIFGAG----VLVLMNI 1306

Query: 357  LVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSEL---MQGVGAASRLFDLTDHISSIS 413
              +   L    LT  + +TE    S   L   YS +   M  V       D+     S  
Sbjct: 1307 NKIDSGLAGISLTYAITFTE----SALWLVRSYSNVEINMNSVERVKEYMDIEQEPYSAG 1362

Query: 414  PTKGQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIA 472
                 K  P +G IE  ++S  Y P+ P  ++ K+++  V P   V +VG +G GKSTI 
Sbjct: 1363 IVNVDKSWPSEGKIEVNDLSLRYAPSLP--KVIKNVSFTVEPKMKVGVVGRTGAGKSTII 1420

Query: 473  LLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNI----TYG-- 526
              L R+ +P  G I +D  DI+ ++ K LR+ I ++ Q+P L +GTI+ N+     Y   
Sbjct: 1421 TALFRFLDPETGYIKIDNIDITTIDLKKLRKSITIIPQDPTLFTGTIKSNLDPYNEYNDD 1480

Query: 527  -----------LAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRI 575
                       + +     ++ SV+ +      + KF +   + I   G+ LS GQRQ +
Sbjct: 1481 QIFKALRRVNLIVDGNLNSDVTSVSSEN-----VNKFLN-LQSEISEGGSNLSQGQRQLM 1534

Query: 576  AIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSEN 635
             +AR+L++ PNI++LDEAT+++D  S+  I  T     K    TI++IAHRL ++   + 
Sbjct: 1535 CLARSLLRAPNIMLLDEATASIDYASDAKIQGTIRNEFKDS--TILTIAHRLRSVIDYDK 1592

Query: 636  VIVLGKDGSVIEAGKFKELFANPNS 660
            ++V+   G V E      L  N NS
Sbjct: 1593 ILVMDA-GEVKEYDHPYSLLLNKNS 1616

 Score = 85.1 bits (209), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 66/231 (28%), Positives = 115/231 (49%), Gaps = 10/231 (4%)

Query: 415 TKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALL 474
           TK  + +     I  +NV+ S+  + ++   +++NI    G    ++GP+G GK+++ + 
Sbjct: 686 TKKYEQLSLGNKISLENVTVSWNKQKQDFKLRNLNIDFKVGKLNVVIGPTGSGKTSLLMA 745

Query: 475 LLRYYNPTNGQILVDGQD---ISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPA 531
           LL   +   G+I V   D       +   L   +    Q   L++ T+++NI +  AE  
Sbjct: 746 LLGEMHLLEGKITVPSLDPRCEMTFDSDGLSNSMAYCSQAAWLLNDTVKNNILFN-AE-Y 803

Query: 532 TKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLD 591
            +E   +V   C           G  T IG +G  LSGGQ+QRI++ARAL      ++LD
Sbjct: 804 NEERYLAVISACALKRDFEILAAGDLTEIGERGITLSGGQKQRISLARALYSSSKHILLD 863

Query: 592 EATSALDVESEGAI--NYTFGQLMKSGSMTIVSIAHRLS-TIKRSENVIVL 639
           +  SA+D  +   I  N   G LM++ +  +VS  H ++ T+K +E VI++
Sbjct: 864 DCLSAVDSHTAAWIYDNCIIGPLMENRTCILVS--HNVALTLKNAEQVIMI 912

>Smik_16.27 Chr16 complement(40287..44720) [4434 bp, 1477 aa] {ON}
            YGR281W (REAL)
          Length = 1477

 Score =  129 bits (325), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 90/259 (34%), Positives = 136/259 (52%), Gaps = 29/259 (11%)

Query: 422  PGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYN 480
            P KG I F+NV F+Y P  P   + K+ N+ +  G  + I G +G GKSTI   L R   
Sbjct: 1208 PSKGKIVFENVDFAYRPGLP--IVLKNFNLDIKSGEKIGICGRTGAGKSTIMSALYRLNE 1265

Query: 481  PTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIR--- 537
             T GQI +D  DIS++    LR+ + ++ Q+P+L  GTIR N+     +  T +E+    
Sbjct: 1266 LTAGQIFIDDVDISQLGLFDLRKKLAIIPQDPVLFRGTIRKNL--DPFDERTDDELWDAL 1323

Query: 538  ----SVAKQCF------------CHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARAL 581
                ++AK                H  + KF    D  +  +G+  S G+RQ +A+ RAL
Sbjct: 1324 VRGGAIAKNDLPEVRLQKPDENGTHGRMHKF--HLDQAVEEEGSNFSLGERQLLALTRAL 1381

Query: 582  IKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGK 641
            +++  IL+LDEATS++D E++G I     +  + G  TI+ IAHRL TI   + ++VL K
Sbjct: 1382 VRQSKILILDEATSSVDYETDGKIQTRIVE--EFGDCTILCIAHRLKTIVNYDRILVLEK 1439

Query: 642  DGSVIEAGKFKELFANPNS 660
             G V E      LF+  +S
Sbjct: 1440 -GEVAEYDTPWALFSQEDS 1457

 Score = 99.8 bits (247), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 112/229 (48%), Gaps = 19/229 (8%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           FKD+N  +  G  + I GP G GKS++   +       +G+I V+G D+           
Sbjct: 604 FKDLNFDIQKGEFIMITGPIGTGKSSLLNAMAGSMRKVDGKIEVNG-DL----------- 651

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
             L+   P + + T+RDNI +G   P  KE+   V   C     +   P G  T IG +G
Sbjct: 652 --LMCGYPWIQNATVRDNIIFG--SPFNKEKYDEVIHVCSLKADLDILPAGDMTEIGERG 707

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIA 624
             LSGGQ+ RI +AR++ KK +I + D+  SA+D      I       M S    I++  
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLSNKTRILA-T 766

Query: 625 HRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRS 673
           H+LS I+R+  VIVLG DG V + G  +EL A  N  L  LL   S  S
Sbjct: 767 HQLSLIERASRVIVLGTDGKV-DIGTVEELKAR-NKTLINLLQFSSQNS 813

>KLLA0E00529g Chr5 complement(39173..44125) [4953 bp, 1650 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1650

 Score =  129 bits (323), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 131/518 (25%), Positives = 242/518 (46%), Gaps = 63/518 (12%)

Query: 179  RVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGG 238
            R   ++ + ++   L+    F+D+  +G +++R   D   + + +T  +   F +LI   
Sbjct: 1127 RASRKIFNLLLKNVLYAKLRFFDSTPIGRIMNRFSKDIESIDQELTPYMEGAFGSLIQCV 1186

Query: 239  VGIGMMVSISPELSGV------LLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAE 292
              I ++  I+P+   V      L +F      S +   K++   S+        + +   
Sbjct: 1187 STIIVIAYITPQFLIVAAIVMLLFYFVAYFYMSGARELKRLESMSR------SPIHQHFS 1240

Query: 293  EQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFI---NAEFFTSTTMLGDMSFIV 349
            E L G+ T+++F  E+R L      ++ I +  R   ++   N        ++G +   +
Sbjct: 1241 ETLVGITTIRAFSDERRFLV---DNMKKIDDNNRPFFYLWVCNRWLSYRIELIGAL---I 1294

Query: 350  VLLYGSYLVLQGSLTIGDLTAFML--YTEYTGSSVFGLTTFYSELMQGVGAASRLFDLT- 406
            VL  GS+++L        L    L    ++T  +++ +   YS +   + +  RL + T 
Sbjct: 1295 VLAAGSFILLNIKSIDSGLAGISLGFAIQFTDGALW-VVRLYSNVEMNMNSVERLKEYTT 1353

Query: 407  -----DHISSISPTKGQKYIPGKGDIEFKNVSFSYPT-RPENQIFKDINIKVPPGSNVCI 460
                  ++ ++ P       P  G IE K++S  Y    P  ++ K++   V     V I
Sbjct: 1354 IEQEPSNVGALVPPCEW---PQNGKIEVKDLSLRYAAGLP--KVIKNVTFTVDSKCKVGI 1408

Query: 461  VGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIR 520
            VG +G GKSTI   L R+ +P  G I +D  DI+ +  K LR+ I ++ Q+P L +GT++
Sbjct: 1409 VGRTGAGKSTIITALFRFLDPETGYIKIDDVDITTIGLKRLRQSITIIPQDPTLFTGTLK 1468

Query: 521  DNI----TYGLAE---------PATKEEI--RSVAKQCFCHNF-ITKFPDGYDTMIGAQG 564
             N+     Y  AE           + EE+   S +     H+  + KF D  +  +   G
Sbjct: 1469 TNLDPYNEYSEAEIFEALKRVNLVSSEELGNPSTSDSTSVHSANMNKFLD-LENEVSEGG 1527

Query: 565  ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIA 624
            + LS GQRQ I +AR+L++ P +++LDEAT+++D  S+  I  T  +   +   TI++IA
Sbjct: 1528 SNLSQGQRQLICLARSLLRCPKVILLDEATASIDYNSDSKIQATIREEFSNS--TILTIA 1585

Query: 625  HRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSEL 662
            HRL +I   + ++V+       +AG+ KE + +P S L
Sbjct: 1586 HRLRSIIDYDKILVM-------DAGEVKE-YDHPYSLL 1615

 Score = 88.6 bits (218), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 64/245 (26%), Positives = 117/245 (47%), Gaps = 9/245 (3%)

Query: 416 KGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLL 475
           K ++    +  +  +N +F++    ++   K++ I    G    IVGP+G GK+++ + L
Sbjct: 688 KYEQLTVSRNKLGLQNATFTWDKNNQDFKLKNLTIDFKIGKLNVIVGPTGSGKTSLLMGL 747

Query: 476 LRYYNPTNGQILVDGQDISK---VNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPAT 532
           L      NG++ V   +  +   V    +   I    Q   L++ T+R+NI +    P  
Sbjct: 748 LGEMELLNGKVFVPSLNPREELVVEADGMTNSIAYCSQAAWLLNDTVRNNILFN--APYN 805

Query: 533 KEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDE 592
           +    +V   C           G  T IG +G  LSGGQ+QR+++AR+L      L+LD+
Sbjct: 806 ENRYNAVISACGLKRDFEILSAGDQTEIGEKGITLSGGQKQRVSLARSLYSSSRHLLLDD 865

Query: 593 ATSALDVESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGK 650
             SA+D  +   I  N   G LM+  +  +VS  H ++   ++ + +++ ++G V E G+
Sbjct: 866 CLSAVDSHTALWIYENCITGPLMEGRTCVLVS--HNVALTLKNADWVIIMENGRVKEQGE 923

Query: 651 FKELF 655
             EL 
Sbjct: 924 PVELL 928

>YGR281W Chr7 (1052824..1057257) [4434 bp, 1477 aa] {ON}  YOR1Plasma
            membrane ATP-binding cassette (ABC) transporter,
            multidrug transporter mediates export of many different
            organic anions including oligomycin; similar to human
            cystic fibrosis transmembrane receptor (CFTR)
          Length = 1477

 Score =  129 bits (323), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 91/262 (34%), Positives = 139/262 (53%), Gaps = 35/262 (13%)

Query: 422  PGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYN 480
            P  G+I F+NV F+Y P  P   + K++N+ +  G  + I G +G GKSTI   L R   
Sbjct: 1208 PSMGEIIFENVDFAYRPGLP--IVLKNLNLNIKSGEKIGICGRTGAGKSTIMSALYRLNE 1265

Query: 481  PTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEP---ATKEEIR 537
             T G+IL+D  DIS++    LRR + ++ Q+P+L  GTIR N+     +P    T +E+ 
Sbjct: 1266 LTAGKILIDNVDISQLGLFDLRRKLAIIPQDPVLFRGTIRKNL-----DPFNERTDDELW 1320

Query: 538  -------SVAKQCF------------CHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIA 578
                   ++AK                H  + KF    D  +  +G+  S G+RQ +A+ 
Sbjct: 1321 DALVRGGAIAKDDLPEVKLQKPDENGTHGKMHKF--HLDQAVEEEGSNFSLGERQLLALT 1378

Query: 579  RALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIV 638
            RAL+++  IL+LDEATS++D E++G I     +  + G  TI+ IAHRL TI   + ++V
Sbjct: 1379 RALVRQSKILILDEATSSVDYETDGKIQTRIVE--EFGDCTILCIAHRLKTIVNYDRILV 1436

Query: 639  LGKDGSVIEAGKFKELFANPNS 660
            L K G V E      LF+  +S
Sbjct: 1437 LEK-GEVAEFDTPWTLFSQEDS 1457

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/233 (33%), Positives = 115/233 (49%), Gaps = 19/233 (8%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           FKD+N  +  G  + I GP G GKS++   +      T+G++ V+G D+           
Sbjct: 604 FKDLNFDIKKGEFIMITGPIGTGKSSLLNAMAGSMRKTDGKVEVNG-DL----------- 651

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
             L+   P + + ++RDNI +G   P  KE+   V + C     +   P G  T IG +G
Sbjct: 652 --LMCGYPWIQNASVRDNIIFG--SPFNKEKYDEVVRVCSLKADLDILPAGDMTEIGERG 707

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIA 624
             LSGGQ+ RI +AR++ KK +I + D+  SA+D      I       M +    I++  
Sbjct: 708 ITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDSRVGKHIMDECLTGMLANKTRILA-T 766

Query: 625 HRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGND 677
           H+LS I+R+  VIVLG DG V + G   EL A  N  L  LL   S  S+  D
Sbjct: 767 HQLSLIERASRVIVLGTDGQV-DIGTVDELKAR-NQTLINLLQFSSQNSEKED 817

>TPHA0K02310 Chr11 (497267..502216) [4950 bp, 1649 aa] {ON} Anc_4.6
            YHL035C
          Length = 1649

 Score =  129 bits (323), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 123/498 (24%), Positives = 235/498 (47%), Gaps = 67/498 (13%)

Query: 180  VVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGV 239
            +  +L   V+N  L     F+D   +G +++R   D  V+   +   +   F   I    
Sbjct: 1135 IFKKLLYRVVNSKL----TFFDNTPIGRIMNRFSKDIQVLDSELAPFLDGVFSCFIQAVT 1190

Query: 240  GIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQ--EATGQ--LTRVAEEQL 295
             + ++V I+P+   + +F    I+ S+   G      S++L+  E++ +  + +   E L
Sbjct: 1191 ALMLIVFITPKFLIIAIF----IICSSITIGYLYLCCSRELKRFESSSKSPVYQHFTETL 1246

Query: 296  SGVKTVQSFVAEQRELHRY-------NGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFI 348
            SG+ T+++F  E + L          N     +++V    +F   +   + T+ G  +FI
Sbjct: 1247 SGLVTIRAFGNEIKFLKENLDFIDENNKFFFYMWSVNSWLSF-RIDLLGAITVFGSGAFI 1305

Query: 349  VVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTD- 407
            ++    +   +   L    LT  + +TE+       +  FYS +   + +  RL +  + 
Sbjct: 1306 LL----NADKIDAGLAGISLTYAVTFTEF----CLWMVKFYSTVEMSMNSVERLKEYMEI 1357

Query: 408  ------HISSISPTKGQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCI 460
                     +I+P++     P +G I F N S  Y P  P+  + K +N+K+  GS + +
Sbjct: 1358 EEEALADPGAITPSENW---PVQGAITFANYSLRYAPKLPD--VLKQLNLKIDGGSKIGV 1412

Query: 461  VGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIR 520
            VG +G GKSTI   L R+ + ++G+IL+D  DIS++N + LR  + ++ Q+P L  GTIR
Sbjct: 1413 VGRTGAGKSTIISALFRFLDCSSGKILIDDLDISEINLRRLRSCLTIIPQDPSLFVGTIR 1472

Query: 521  DNITYGLAEPATKEEIRSVAKQCFCHNFITK---------------FPD----GYDTMIG 561
             N+     +P  + E + +       + +T+               + +      D+ I 
Sbjct: 1473 SNL-----DPNEEYENKDIYDALVKVHLLTEDYLANLNYDANADVAYDENIFLNLDSPIS 1527

Query: 562  AQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIV 621
              G  LS GQRQ I +AR+++    I++LDEAT+++D +S+  +  T     +    TI+
Sbjct: 1528 EGGINLSQGQRQLICLARSILHCSKIVLLDEATASIDYKSDFKVQETIRN--EFSQKTIL 1585

Query: 622  SIAHRLSTIKRSENVIVL 639
            +IAHR+ ++   + ++VL
Sbjct: 1586 TIAHRIKSVIDYDKILVL 1603

 Score = 91.3 bits (225), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 119/476 (25%), Positives = 213/476 (44%), Gaps = 64/476 (13%)

Query: 206 GDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPEL----SGVLLFFAPP 261
           G +I+ + +DA  V   +   +    +ALI   V + ++  I        + V++FF P 
Sbjct: 496 GGIINLMATDAIKVGE-LCNYLHSSIEALIMAVVAVILLYRILGTAAFIGTAVIIFFIP- 553

Query: 262 ILWSASVF-GKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRG 320
                +VF  K I    ++    T Q  +   E    ++ ++SF  E   + +  G    
Sbjct: 554 ----FNVFLTKLIARFQRETLTFTDQRIQNLNETFQSIRIIKSFGWENNIIQKILGLRNK 609

Query: 321 IYNVGRKAAF---INA-EFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTE 376
             +V ++ +    INA  ++ S T++  +SF       SY +L     +    AF     
Sbjct: 610 EISVLKRNSITWSINALVWYLSPTIITTLSF-------SYYILVDKQDLTTPVAF----- 657

Query: 377 YTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVS--- 433
            T  ++F L      L   +   S   +     S +S  + +K++  K   +F+N+S   
Sbjct: 658 -TALALFNL------LKAPLDQLSNTINFLTQ-SKVSLDRIEKFLSVKETTKFENLSVDS 709

Query: 434 ------FSYPT-----RPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPT 482
                 FS  T       ++   ++IN +   G    ++GP+G GK+++ + LL   +  
Sbjct: 710 SQNRLAFSGATLGWCGNKKSFQLRNINAEFEMGKLNLVIGPTGSGKTSLLMALLGELHLF 769

Query: 483 NGQILVDGQDISKVNC----KTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRS 538
           +G++ V   + SK N       L   I    Q P + + TIR+NI + +     K+   +
Sbjct: 770 SGKVFVPNLE-SKFNLIPESDNLLNSIAYCSQLPWIFNDTIRNNIIFDMGYD--KDRYEN 826

Query: 539 VAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALD 598
           V   C           G  T++G +G+ LSGGQ+QRI++ARAL  K   L+LD+  SA+D
Sbjct: 827 VVIACGLERDFQILNLGDKTIVGDKGSCLSGGQKQRISLARALYSKSRHLILDDCLSAVD 886

Query: 599 VESEGAINYTF---GQLMKSGSMTIVSIAHRLS-TIKRSENVIVLGKDGSVIEAGK 650
             S   I Y     G LM+  +  +VS  H +S TIK++  V ++ ++G ++ +G+
Sbjct: 887 SHSAKWI-YNVCITGPLMQGRTCILVS--HNVSLTIKKASKVFMI-ENGYIVASGR 938

>KLTH0B00396g Chr2 complement(38234..42757) [4524 bp, 1507 aa] {ON}
            similar to uniprot|P32386 Saccharomyces cerevisiae
            YLL048C
          Length = 1507

 Score =  128 bits (322), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 83/249 (33%), Positives = 136/249 (54%), Gaps = 16/249 (6%)

Query: 423  GKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNP 481
            G  +I F +V   Y P  P+  + K+++  + P S V IVG +G GKST+ + L R    
Sbjct: 1234 GGAEISFDHVYVRYAPHLPD--VLKNVSFTLLPNSKVAIVGRTGSGKSTVMMSLFRLIEL 1291

Query: 482  TNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNIT-YGLAEPATKEEIRSVA 540
            TNG I + G DI+ +N +TLRR + ++ Q+P L SGTI+ NI  +G     + +E+   A
Sbjct: 1292 TNGTIRIGGIDIASLNLQTLRRELTVIPQDPSLFSGTIKSNIDPFG---RYSDQELTHFA 1348

Query: 541  KQ--CFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALD 598
            ++   F      +  +   +++   G  +S GQRQ + +ARAL++K  IL+LDEAT+++D
Sbjct: 1349 RRIGLFSGTDDVRTFNSLGSLVSEGGENMSQGQRQLLCLARALLQKSKILILDEATASID 1408

Query: 599  VESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANP 658
             E++  I          G   ++++AHR+STI   + VIVL  D  +++      L    
Sbjct: 1409 HETDATIQQVVRDFSSGG--IVITVAHRMSTIIDYDQVIVL--DSGIVKENNHPYLLLKQ 1464

Query: 659  N---SELCK 664
            N    ++CK
Sbjct: 1465 NGAFHQMCK 1473

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/242 (27%), Positives = 116/242 (47%), Gaps = 19/242 (7%)

Query: 426 DIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQ 485
           ++ F+N S ++       + K++ I         I+GPSG GKS++ L LL   +   G 
Sbjct: 634 EMGFRNASLTWNRFDTGFMLKNLTIDFELHKLNVIIGPSGSGKSSVLLALLGELDLIEGS 693

Query: 486 ILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFC 545
           I V    +    C           Q P + + T+++NI +  +     +  + V   C  
Sbjct: 694 IRVPRGYMHDDRCS-----FAFCSQTPWITNATVKENIVF--SSQFNTKRYQEVLHACGL 746

Query: 546 HNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAI 605
              I +  +G +T++G +G  LSGGQRQR+A+ARA+      L+LD+  SA+D    G  
Sbjct: 747 EEDILEMQEGDETVVGDKGMTLSGGQRQRLALARAVYSGAEHLLLDDCLSAVD---PGMA 803

Query: 606 NYTF-----GQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS 660
            + F     G LMK    T +   H ++ +++  ++I+L  +G V + GK ++   N +S
Sbjct: 804 VWIFQKCIMGPLMKGK--TCILATHNIALVQKHADMIILLDNGRVSKIGKARDF--NFDS 859

Query: 661 EL 662
           E 
Sbjct: 860 EF 861

>SAKL0H00704g Chr8 (85322..89641) [4320 bp, 1439 aa] {ON} similar to
            uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1439

 Score =  128 bits (321), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 136/529 (25%), Positives = 228/529 (43%), Gaps = 91/529 (17%)

Query: 189  MNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSIS 248
            + + LH    F DT  +G +++R   D   +   +T+ V               + V  +
Sbjct: 933  VKRLLHTPMSFMDTTPLGRVLNRFTKDTDTLDNELTESVR--------------LFVYQT 978

Query: 249  PELSGVLLFFAPPILWSASV--FGKKIRHTSKDLQEATGQLTRVAE------------EQ 294
              ++GV++     + W A    F   I     D  +++G+  +  E            E 
Sbjct: 979  ANIAGVIIMCIIYLPWFAIAVPFLGLIFIIVADHYQSSGREIKRLEAVQRSFVYNNFNEV 1038

Query: 295  LSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLG-DMSFIVVLLY 353
            LSG+ T++++ +E R L + +  I  +   G     +      S  M+    + I+ LL 
Sbjct: 1039 LSGMDTIKAYKSENRFLMKSDFLINRMSEAGYLVVAVQRWVSISLDMIAVAFALIITLLC 1098

Query: 354  GSYLVLQGSLTIGDLTAFMLY--------------TEYTGSSVFGLTTFYSELMQGVGAA 399
             +      + ++G L  ++L                E   +SV  +  + +EL Q   AA
Sbjct: 1099 VTRQFDISAASVGVLLTYVLQLPGLLNGLLRAMTQAENDMNSVERIVNYATELPQE--AA 1156

Query: 400  SRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNV 458
             R  ++T           Q+  P  G++ F NVS SY P  P   + K +++ +  G  +
Sbjct: 1157 YRKPEMTP----------QEPWPSNGEVVFDNVSLSYRPGLP--LVLKGVSLNIKGGEKI 1204

Query: 459  CIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGT 518
             I G +G GKSTI   L R      G++L+DG D SK+    LRR + ++ Q+P+L  G+
Sbjct: 1205 GICGRTGAGKSTIMSALYRLCELNEGRVLIDGVDTSKLGLYDLRRKLSIIPQDPVLFKGS 1264

Query: 519  IRDNIT-YGLAEPA------------TKEEIRSVAKQ--------CFCHNFITKFPDGYD 557
            IR N+  +G  E                EE+  V  Q           H F        D
Sbjct: 1265 IRKNLDPFGEREDEELWSALVRSGTIEAEEVEKVKNQHRDESGSSTGLHKF------HLD 1318

Query: 558  TMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGS 617
              +   G   S G+RQ +A+ RAL+++  IL+LDEATS++D E++  I     Q  +   
Sbjct: 1319 QEVEDDGTNFSLGERQLLALTRALVRQSKILILDEATSSVDHETDAKIQSLIAQ--EFNR 1376

Query: 618  MTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS---ELC 663
             TI+ IAHRL TI   + ++VL  +G+V E    + LF   ++   E+C
Sbjct: 1377 CTILCIAHRLKTILNYDRLVVL-DNGTVKEFDTPRSLFRIKDTIFREMC 1424

 Score = 86.3 bits (212), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/289 (29%), Positives = 135/289 (46%), Gaps = 40/289 (13%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           FK++N ++  G  V I G  G GKS++   L  +   T G I  +G   S + C      
Sbjct: 571 FKNLNFQIQKGELVIITGSIGTGKSSLLNALAGFMKKTEGDIFKNG---SLLLCGY---- 623

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIR--SVAKQCFCHNFITKFPDGYDTMIGA 562
                  P + + T+RDNI +G    ++ +++R   V + C     +   P G  T IG 
Sbjct: 624 -------PWIQNTTVRDNILFG----SSFDDVRYKEVIRVCALQADLDILPAGDFTEIGE 672

Query: 563 QGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVS 622
           +G  LSGGQ+ RI +AR++ K  +I + D+  SA+D      I       M  G   I++
Sbjct: 673 RGITLSGGQKARINLARSVYKSMDIYLFDDVLSAVDARVGKHIMDECLMGMLDGKTRILA 732

Query: 623 IAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPP 682
             H+LS I+R+  VI LG  GS  + G  +EL    NS   KL+ E S+++         
Sbjct: 733 -THQLSLIERASRVIFLGAGGS-FDIGTVEEL-KERNSGFVKLM-EFSTQT--------- 779

Query: 683 PPNATQDKVVEQIAEKILERFPEAGQSPDATVKEIFKDVSSEGKPIKIT 731
             +A Q + V+  AE+ L      GQ+    + ++ K +S +    K T
Sbjct: 780 -KSANQREEVDDHAEENL------GQNCQQEIAKLEKQISKKSNSEKTT 821

>Kpol_YGOB_1041.45 s1041 complement(118923..123629) [4707 bp, 1568 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 1568

 Score =  126 bits (317), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 133/533 (24%), Positives = 237/533 (44%), Gaps = 47/533 (8%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQ 225
            N   IVML   S R   +L   +    ++    F++T  +G +I+R   D   V   +  
Sbjct: 1032 NLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIGRIINRFSGDLDSVDSGLQF 1091

Query: 226  KVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRH--TSKDLQEA 283
              S  F++L+      G +V++      +  FF   I      F  +  +  TS++L+  
Sbjct: 1092 IFSHFFRSLL------GYIVTVILVGYNMPWFFVFNIFLIVIYFYYQAYYIVTSRELKRL 1145

Query: 284  TG----QLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTST 339
            T      +  +  E L+G   + ++   +R  +    +++  +N+     F +   + S 
Sbjct: 1146 TSITYSPIMSLISETLAGYLVINAYNHAKRFSYFNFESVQ--FNIDCLFNFRSTNRWLSV 1203

Query: 340  TMLGDMSFIVV---LLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGV 396
             +    + IV+   LL  S +     LT G +   M Y+    +S+  +     ++   +
Sbjct: 1204 RLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQVTNSLMWIVRMSVQIETNI 1263

Query: 397  GAASRLFDLTDHISSISP----TKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKV 452
             +  R+ +  +           TK +K  P  G I+F + S  Y  +  + +   IN+++
Sbjct: 1264 VSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYSTKY-RKNLDPVLNKINLEI 1322

Query: 453  PPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEP 512
             P   + IVG +G GKST+ L L R    T+G+I++DG DIS +    LR ++ ++ Q+ 
Sbjct: 1323 EPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVDISTLGLSDLRSNLAIIPQDA 1382

Query: 513  ILMSGTIRDNITYGLAEPATKEEIRSV-AKQCFCH-----------------NFITKFPD 554
                GTIR N+     + + +E  +++ A     H                 N   K  +
Sbjct: 1383 QAFEGTIRTNLD-PFDQHSDEELWKAIEASHLKPHLERIISNRDDNSESEETNVSAKDNN 1441

Query: 555  GYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMK 614
              +  I   G+ LS GQRQ + ++RAL+    ILVLDEAT+++D+E++  I  T     +
Sbjct: 1442 LLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATASVDMETDKIIQETIRN--E 1499

Query: 615  SGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS---ELCK 664
                TI++IAHR+ T+   + ++VL K G V E      L  N NS    LC+
Sbjct: 1500 FSDRTILTIAHRIDTVLGYDKILVLDK-GEVREFDSPDTLLENKNSIFYNLCE 1551

 Score = 84.0 bits (206), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 123/240 (51%), Gaps = 20/240 (8%)

Query: 445 FKDIN-IKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRR 503
           FK++N  +V  GS  CIVG  G GK+T+   +L       GQ+         +  K + R
Sbjct: 644 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVL-------GQLPCISGAQESIPPKLIIR 696

Query: 504 --HIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIG 561
              I    Q+  +M+ ++++NI +G      +       + C     +   PDG +T++G
Sbjct: 697 GNSIAYCPQQAWIMNSSVKENILFG--HKYDEHYYNLTIEACQLTEDLKMLPDGDETIVG 754

Query: 562 AQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQ---LMKSGS 617
            +G  LSGGQ+ R+++ARA+  + +I +LD+  SA+D E S+  I     +   L+KS  
Sbjct: 755 EKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK- 813

Query: 618 MTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELF-ANPNSELCKLLTEKSSRSDGN 676
            TI+   + +S +K S+ +  L ++  +IE G + ++  ++ +S+L  L+ E  +  D N
Sbjct: 814 -TIILTTNAISVLKHSQKIYAL-ENCEIIEEGAYDDVMNSSEDSKLKALINEFDNDRDNN 871

>Kpol_1041.45 s1041 complement(118923..123713) [4791 bp, 1596 aa]
            {OFF} complement(118923..123713) [4791 nt, 1597 aa]
          Length = 1596

 Score =  126 bits (317), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 133/533 (24%), Positives = 237/533 (44%), Gaps = 47/533 (8%)

Query: 166  NFARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQ 225
            N   IVML   S R   +L   +    ++    F++T  +G +I+R   D   V   +  
Sbjct: 1060 NLRSIVMLIFCSIRGSKKLHDNMALSVVYSPMSFFETTPIGRIINRFSGDLDSVDSGLQF 1119

Query: 226  KVSDGFKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRH--TSKDLQEA 283
              S  F++L+      G +V++      +  FF   I      F  +  +  TS++L+  
Sbjct: 1120 IFSHFFRSLL------GYIVTVILVGYNMPWFFVFNIFLIVIYFYYQAYYIVTSRELKRL 1173

Query: 284  TG----QLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTST 339
            T      +  +  E L+G   + ++   +R  +    +++  +N+     F +   + S 
Sbjct: 1174 TSITYSPIMSLISETLAGYLVINAYNHAKRFSYFNFESVQ--FNIDCLFNFRSTNRWLSV 1231

Query: 340  TMLGDMSFIVV---LLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGV 396
             +    + IV+   LL  S +     LT G +   M Y+    +S+  +     ++   +
Sbjct: 1232 RLQAIGALIVLATGLLSLSTIGTSKQLTAGMVGLLMSYSLQVTNSLMWIVRMSVQIETNI 1291

Query: 397  GAASRLFDLTDHISSISP----TKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKV 452
             +  R+ +  +           TK +K  P  G I+F + S  Y  +  + +   IN+++
Sbjct: 1292 VSVERILEYCELPPEPPHEIEETKPEKSWPAHGSIKFIDYSTKY-RKNLDPVLNKINLEI 1350

Query: 453  PPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEP 512
             P   + IVG +G GKST+ L L R    T+G+I++DG DIS +    LR ++ ++ Q+ 
Sbjct: 1351 EPREKIGIVGRTGAGKSTLTLALFRILEATDGKIVIDGVDISTLGLSDLRSNLAIIPQDA 1410

Query: 513  ILMSGTIRDNITYGLAEPATKEEIRSV-AKQCFCH-----------------NFITKFPD 554
                GTIR N+     + + +E  +++ A     H                 N   K  +
Sbjct: 1411 QAFEGTIRTNLD-PFDQHSDEELWKAIEASHLKPHLERIISNRDDNSESEETNVSAKDNN 1469

Query: 555  GYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMK 614
              +  I   G+ LS GQRQ + ++RAL+    ILVLDEAT+++D+E++  I  T     +
Sbjct: 1470 LLEIKINENGSNLSVGQRQLLCLSRALLNHSKILVLDEATASVDMETDKIIQETIRN--E 1527

Query: 615  SGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS---ELCK 664
                TI++IAHR+ T+   + ++VL K G V E      L  N NS    LC+
Sbjct: 1528 FSDRTILTIAHRIDTVLGYDKILVLDK-GEVREFDSPDTLLENKNSIFYNLCE 1579

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 123/240 (51%), Gaps = 20/240 (8%)

Query: 445 FKDIN-IKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRR 503
           FK++N  +V  GS  CIVG  G GK+T+   +L       GQ+         +  K + R
Sbjct: 672 FKNVNHFEVKEGSLTCIVGRVGSGKTTLLRAVL-------GQLPCISGAQESIPPKLIIR 724

Query: 504 --HIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIG 561
              I    Q+  +M+ ++++NI +G      +       + C     +   PDG +T++G
Sbjct: 725 GNSIAYCPQQAWIMNSSVKENILFG--HKYDEHYYNLTIEACQLTEDLKMLPDGDETIVG 782

Query: 562 AQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQ---LMKSGS 617
            +G  LSGGQ+ R+++ARA+  + +I +LD+  SA+D E S+  I     +   L+KS  
Sbjct: 783 EKGISLSGGQKARLSLARAVYSRSDIYLLDDILSAVDAEVSKNIIEKVLDEQTGLLKSK- 841

Query: 618 MTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELF-ANPNSELCKLLTEKSSRSDGN 676
            TI+   + +S +K S+ +  L ++  +IE G + ++  ++ +S+L  L+ E  +  D N
Sbjct: 842 -TIILTTNAISVLKHSQKIYAL-ENCEIIEEGAYDDVMNSSEDSKLKALINEFDNDRDNN 899

>YKR104W Chr11 (656836..657756) [921 bp, 306 aa] {ON} Putative
           transporter of the multidrug resistance-associated
           protein (MRP) subfamily; contains a stop codon in S288C;
           adjacent ORFs YKR103W and YKR104W are merged in
           different strain backgrounds
          Length = 306

 Score =  119 bits (297), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 136/264 (51%), Gaps = 35/264 (13%)

Query: 414 PTKGQKYI------PGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRG 467
           P++   YI      P  GD+E KN+S  Y     ++   +++ KV  G+ V IVG +G G
Sbjct: 14  PSESNGYISPPANWPQTGDVELKNLSLRYSPH-SSKALDNVSFKVKAGTKVGIVGRTGAG 72

Query: 468 KSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNIT--- 524
           KS+I   + R  +  NG I +D +DI  +  + LR  I  + Q+P L  GT+R N+    
Sbjct: 73  KSSIIAAIYRLSDWENGTITIDNKDIKHIPLERLRNSISCIPQDPTLFDGTVRSNLDPFD 132

Query: 525 -------YG-LAEPATKEEIRSVA-------KQCFCHNFITKFPDGYDTMIGAQGALLSG 569
                  YG L++    EE   +             H    +F D  +T++ + G+ LS 
Sbjct: 133 RYSDVQIYGVLSKVGLIEECDELCLIFEQEQPNFSSHKLRNRFID-LNTVVKSGGSNLSQ 191

Query: 570 GQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLST 629
           GQRQ + +AR+++   NI+++DEAT+++D  S+  I  T  + MK  + TI++IAHRL +
Sbjct: 192 GQRQLLCLARSMLGARNIMLIDEATASIDYISDAKIQKTIRETMK--NTTILTIAHRLRS 249

Query: 630 IKRSENVIVLGKDGSVIEAGKFKE 653
           +   + ++V+       E G+ KE
Sbjct: 250 VIDYDKILVM-------EMGRVKE 266

>Smik_11.367 Chr11 (644116..648903) [4788 bp, 1595 aa] {ON} YKR103W
            (REAL)
          Length = 1595

 Score =  125 bits (313), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 130/529 (24%), Positives = 237/529 (44%), Gaps = 68/529 (12%)

Query: 177  SERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALIC 236
            ++++ A+L S +    L     F+D   VG +++R   D  ++ + +       F +++ 
Sbjct: 1071 TKKIFAKLLSSIFLAKLR----FHDITPVGRIMNRFSKDMDIIDQQLIPNFEGLFYSVVV 1126

Query: 237  GGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEA----TGQLTRVAE 292
                I ++  I+P      L FA P+     + G      S++L+         + ++  
Sbjct: 1127 CLWVIFLIGYITPRF----LLFAIPLCALYYIVGSLYLRASRELKRIDNINVSPIHQLFT 1182

Query: 293  EQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLL 352
            E + GV T+++   E+R + +   AI             NA FF        +++ V ++
Sbjct: 1183 EAIKGVATIRALADERRFITQTLVAIDKS----------NAPFFYLNLATEWITYRVDII 1232

Query: 353  YGSYLVLQGSLTIGDLTAFMLYTEYTG---SSVFGLTTFYSELMQGVGAASRLFDLTDHI 409
             G+ ++   SL I  L A  L     G   S+ F  T     +++       L    + I
Sbjct: 1233 -GALILFSSSLMIV-LKAPYLDAGLAGILLSNAFSFTETAQWIIKVFSGVELLMSSVERI 1290

Query: 410  SS-----ISPTKGQKY------IPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNV 458
                   +  ++   Y       P  GDIEF+N++  Y     ++    ++ KV  G+ V
Sbjct: 1291 KEYVDVPLESSESNNYATPLANWPQTGDIEFENLTLRYSPH-SSKALDGVSFKVKAGTKV 1349

Query: 459  CIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGT 518
             IVG +G GKS+I   + R  +  +G I++D +DI  V  + LR  I  + Q P L  GT
Sbjct: 1350 GIVGRTGAGKSSIIAAIYRLSDWEDGTIIIDNKDIKYVPLECLRNSISCIPQNPTLFEGT 1409

Query: 519  IRDNI----------------TYGLAEPATKEEIRSVAKQCFC----HNFITKFPDGYDT 558
            IR N+                  GL E +  E + S+  Q       H    +F D  +T
Sbjct: 1410 IRSNLDPWDQYSDVQVFEALEKVGLIEQS--EGLCSLPGQKLSYPSNHKLRNRFID-LNT 1466

Query: 559  MIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSM 618
            ++ + G+ +S GQRQ + +AR+++   NI+++DEAT+++D  S+  I  T  + M+  + 
Sbjct: 1467 VVKSGGSNISQGQRQLLCLARSMLGARNIMLIDEATASIDYVSDAKIQKTIRETMR--NT 1524

Query: 619  TIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS---ELCK 664
            T+++IAHRL ++   + ++V+   G V E      L ++ N+    LCK
Sbjct: 1525 TVLTIAHRLRSVIDYDKILVMDM-GRVEEYDHPYNLISDKNTIFHRLCK 1572

 Score = 87.4 bits (215), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 121/480 (25%), Positives = 211/480 (43%), Gaps = 35/480 (7%)

Query: 212 LGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSI--SPELSGVLLFFA--PPILWSAS 267
           +  DA+ VS +M+       +A+      + ++ S+      +G+ +  A  P   W A 
Sbjct: 455 MSVDAFKVSEAMS-TFYQACEAIFMTVTALIILYSLLGWSAFAGIFVLIAMIPLNFWCAI 513

Query: 268 VFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRK 327
            +GK       D    T + T    E L+ ++ ++    E+    R      G  ++ +K
Sbjct: 514 FYGK----YQADQLILTDRRTSGISEALNSIRVIKLLAWEKLFYRRIMVTRNGEISLLKK 569

Query: 328 AA---FINAE-FFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVF 383
            A   F+N   +F   T++  ++F V + +     L  S+    L+ F +      + + 
Sbjct: 570 KATIFFLNHLIWFFGPTLVSVVTFAVFVKFQKQ-TLTPSIAFTALSLFAILR----TPMD 624

Query: 384 GLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQ 443
            + +  + LMQ   +  R+    D+++     K +     K  + F+N +  +     + 
Sbjct: 625 QIASTINLLMQSFISLERI---QDYLNEPETRKYEILTQSKTKLGFENANMEWEAAETSF 681

Query: 444 IFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI---LVDGQDISKVNCKT 500
             K+I+I     +   I+GP+G GKS++ L LL   N  +G+I    V  +D  ++    
Sbjct: 682 KLKNISIDFKQNTLNAIIGPTGSGKSSLLLGLLGELNLRSGKINVPTVHSRDDLEIGIDG 741

Query: 501 LRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMI 560
           +   +    Q P L+SGTI+DNI +G  E   +++   V K C     I     G  T +
Sbjct: 742 MANSMAYCSQSPWLISGTIKDNIVFG--EFFNQQKFDDVIKCCCLEKDIKAMTAGLKTDV 799

Query: 561 GAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAI--NYTFGQLMKSGSM 618
           G  G  LSGGQ+QRIA+ARA+      L+ D+  SA+D E+   I      G +MK G  
Sbjct: 800 GEGGFSLSGGQQQRIALARAIYSSSRYLLFDDCLSAVDPETALHIYEECLCGPMMK-GRT 858

Query: 619 TIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDS 678
            IV+ +H +S I +    +V+  +G V   GK  +L      E  K L E  +   G+ S
Sbjct: 859 CIVT-SHNISLIIKQAQWLVILDNGEVKAQGKPSDLI-----ESSKFLKESINNDPGDKS 912

>ACL072C Chr3 complement(224562..229445) [4884 bp, 1627 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLL048C
            (YBT1) and YHL035C
          Length = 1627

 Score =  124 bits (310), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 130/528 (24%), Positives = 231/528 (43%), Gaps = 71/528 (13%)

Query: 171  VMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDG 230
            VM  + + R +  L   V+ K LH    F+D    G +++RL  D   V + +       
Sbjct: 1100 VMAGLYASRKIFNL---VLWKILHAKMRFFDATPTGRIMNRLSKDLEAVDQELIPYFEGS 1156

Query: 231  FKALICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQE----ATGQ 286
            F A++     + ++  ++P+     L  A  I +  ++ G     TS++L+         
Sbjct: 1157 FAAVVQCISTLVLIAYVTPQ----FLIMAIFIGFLYALIGYFYVTTSRELKRFESITRSP 1212

Query: 287  LTRVAEEQLSGVKTVQSFVAEQR----ELHRYNGAIRGIYNV---GRKAAFINAEFFTST 339
            + +   E L G+ +++++  E+R     L R +   R  + +    R  AF         
Sbjct: 1213 IYQHFSETLVGITSIRAYGDERRFMLENLSRIDDNNRPFFYLWIANRWLAF-------RV 1265

Query: 340  TMLGDMSFIVVLLYGSYLVLQ-GSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGA 398
             +LG +   V    G ++ L  G L  G     + Y  +           YS +   + +
Sbjct: 1266 DLLGAL---VTFFSGLFIYLNIGKLDAGLAGISLTYAIFFTEGALWFVRHYSNVEMTMNS 1322

Query: 399  ASRLFDLTDHISSISPTKGQ---KYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPP 454
              RL +  +          Q      P  G I+  ++S  Y P  P  ++ K++N  V P
Sbjct: 1323 FERLKEYMEIEQEPYNENAQLPPDNWPQHGRIDVSDLSLRYAPNLP--KVIKNVNFSVEP 1380

Query: 455  GSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPIL 514
               V IVG +G GKSTI   + R+ +P  G + +D  DI+ +    LR+ I ++ Q+P L
Sbjct: 1381 KLKVGIVGRTGAGKSTIITAMFRFLDPETGFVKIDNIDITTIPLHRLRQSITIIPQDPTL 1440

Query: 515  MSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNF--------------------ITKFPD 554
             +GT++      + +P ++   + + +     N                     I KF D
Sbjct: 1441 FTGTLK-----SILDPYSQYSDKQIYEALQRVNLLSDTDINSLSSPSTQSSGENINKFLD 1495

Query: 555  GYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMK 614
              +  +   GA LS GQRQ + +AR+L++ P I++LDEAT+++D  S+  I  T  +  +
Sbjct: 1496 -LNNEVTEGGANLSQGQRQLVCLARSLLRSPKIIMLDEATASIDYTSDEKIQQTIREEFR 1554

Query: 615  SGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSEL 662
                TI++IAHRL +I   + V+V+       +AG+ KE + +P S L
Sbjct: 1555 DS--TILTIAHRLKSIIDYDKVLVM-------DAGEVKE-YDHPYSLL 1592

 Score = 82.0 bits (201), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 88/321 (27%), Positives = 142/321 (44%), Gaps = 17/321 (5%)

Query: 415 TKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALL 474
           TK ++       + F+N + ++   P +   ++I+I+   G      GP+G GKS++ L 
Sbjct: 660 TKYEQLTISGNRLAFENATIAWNDDPSSFRLRNIDIEFMIGKLNVAFGPTGTGKSSLLLG 719

Query: 475 LLRYYNPTNGQILVDGQDISK---VNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPA 531
           LL       G+I V   D  +   +    L   I    Q   L++ T R NI +    P 
Sbjct: 720 LLGEMTLQEGKIYVPSLDPREDLVIQADGLTNSIAYCSQSAWLLNDTARSNILFN--SPY 777

Query: 532 TKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLD 591
            ++    V + C           G  T IG +G  LSGGQ+QRI++ARAL      L+LD
Sbjct: 778 NEQRYNDVLEACGLKKDFEILSGGDLTQIGEKGMTLSGGQKQRISLARALYSSARHLLLD 837

Query: 592 EATSALDVESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAG 649
           +  SA+D  +   I  N   G LM+  +  +VS  H ++   R+ + +V+ ++G V   G
Sbjct: 838 DCLSAVDSHTALLIYENCIIGPLMEGRTCVLVS--HNVALTMRNADWVVILENGRVKAQG 895

Query: 650 KFKELFANPNSELC---KLLTEK-SSRSDGNDSLPPPPPNATQDKVVEQIAEKILERFPE 705
              E  A  N  L    KL+    +SR++ + SL  P       ++  +I     E    
Sbjct: 896 ---EPLALANEGLLGEDKLIKSSIASRTNSSLSLKTPQSALNLKELDNKIRTATAENLA- 951

Query: 706 AGQSPDATVKEIFKDVSSEGK 726
              S D   K++ K V+ E K
Sbjct: 952 GNASNDDERKKVGKLVAQETK 972

>SAKL0H23958g Chr8 complement(2062067..2066743) [4677 bp, 1558 aa]
            {ON} similar to uniprot|P14772 Saccharomyces cerevisiae
            YLL015W BPT1 ABC type transmembrane transporter of
            MRP/CFTR family found in vacuolar membrane involved in
            the transport of unconjugated bilirubin and in heavy
            metal detoxification via glutathione conjugates along
            with Ycf1p
          Length = 1558

 Score =  123 bits (309), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 91/276 (32%), Positives = 139/276 (50%), Gaps = 31/276 (11%)

Query: 412  ISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTI 471
            I  ++  K  P +G I F+N S  Y    +  + KDI +++ P   + IVG +G GKST+
Sbjct: 1282 IEESRPPKEWPSRGAITFQNYSTKYRENLD-PVLKDITVEIKPQEKIGIVGRTGAGKSTL 1340

Query: 472  ALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDN--------- 522
            +L L R   P+ G I++DG DI+K+    LR ++ ++ Q+     GTI+ N         
Sbjct: 1341 SLALFRLLEPSGGSIVIDGIDIAKLGLSDLRGNLAIIPQDAQAFEGTIKSNLDPFGQYSD 1400

Query: 523  --ITYGLAEPATKEEIRSVAKQCFCHNF-----ITKFPDGYDTMIGAQGALLSGGQRQRI 575
              I   L     K  I  +A +    N       T+  +     I   G  LS GQRQ +
Sbjct: 1401 EEIWRALELSHLKPHILKMASEENTENSETTTEATRSHELLSARITENGGNLSIGQRQLL 1460

Query: 576  AIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSEN 635
             ++RAL+    ILVLDEAT+A+D+E++  I  T     K    TI++IAHR+ T+  S+ 
Sbjct: 1461 CLSRALLNHSKILVLDEATAAVDMETDKIIQETIKTAFK--DRTILTIAHRIDTVMDSDK 1518

Query: 636  VIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSS 671
            ++VL K       G+ KE F  P +    LL +KS+
Sbjct: 1519 IMVLDK-------GEVKE-FDTPTN----LLADKST 1542

 Score = 90.1 bits (222), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 72/241 (29%), Positives = 120/241 (49%), Gaps = 31/241 (12%)

Query: 455 GSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI-LVDGQDISKVNCKTLRR--HIGLVQQE 511
           G   CIVG  G GKST    +L       GQ+  + G D   V  K + R   I    Q+
Sbjct: 656 GDLTCIVGRVGSGKSTFLQAIL-------GQLPCISGLD-EHVPPKLIIRAKSIAYCPQQ 707

Query: 512 PILMSGTIRDNITYG--LAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSG 569
           P +M+ +++DN+ +G  L E   K  IR    +C     +   PDG  T++G +G  LSG
Sbjct: 708 PWIMNASLKDNVIFGHRLNEDYYKATIR----KCQLLPDLDILPDGDQTLVGEKGISLSG 763

Query: 570 GQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGS-----MTIVSIA 624
           GQ+ R+++ARA+  + ++ +LD+  SA+D E    I     Q++  G+      T++   
Sbjct: 764 GQKARLSLARAVYARADVYLLDDILSAVDAEVSKNI---VEQVLNRGTGILKNKTVILTT 820

Query: 625 HRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLL-----TEKSSRSDGNDSL 679
           + +S +K S+N+  L  DG ++E   + +  +  +S + K L     + ++SR D  D  
Sbjct: 821 NAVSVLKHSQNIYAL-LDGEIVENKSYADAMSCDDSSILKTLIQEFDSNENSREDTKDGQ 879

Query: 680 P 680
           P
Sbjct: 880 P 880

>TPHA0A05620 Chr1 (1273220..1277653) [4434 bp, 1477 aa] {ON} Anc_5.10
            YGR281W
          Length = 1477

 Score =  122 bits (306), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 133/524 (25%), Positives = 227/524 (43%), Gaps = 79/524 (15%)

Query: 189  MNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSIS 248
            + + +H    F DT  +G +++R   D   +   + + V           VG+ +M  + 
Sbjct: 973  LKRIIHTPMSFMDTTPIGRILNRFTKDTDSLDNELIENVRLTVSQF-ANIVGVCVMCIV- 1030

Query: 249  PELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVA-----------EEQLSG 297
                  L +FA  + +   +F     H     Q A  ++ R+             E L G
Sbjct: 1031 -----YLPWFAIAVPFLVFIFVFIQNH----YQSAGREIKRLEAIQRSFVYNNFNEILGG 1081

Query: 298  VKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYL 357
            + T++ + +E+R + + +  I  +     +A ++         +L DM  +   L  + L
Sbjct: 1082 MDTIKFYKSEERYIAKSDYLIDKM----NEAGYLTVCVQRWVAILVDMIAVAFALIITLL 1137

Query: 358  VLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSIS---P 414
             +     I   +  +L T      V  L   ++ L++ V       + T+ + S +   P
Sbjct: 1138 CVTRQFHISASSVGVLLT-----YVLQLPGLFNTLLRAVSQVENDMNSTERLVSYATDLP 1192

Query: 415  TKGQKY---------IPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPS 464
             + Q +          P +G I+F+NV F+Y P  P   + K+IN+++     + I G +
Sbjct: 1193 LEAQYHKPETAPPESWPEEGTIKFENVDFAYRPGLP--IVLKNINLQINGTEKIGICGRT 1250

Query: 465  GRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNIT 524
            G GKSTI   L R    T+G IL+D  DI+K+    LR+ + ++ Q+P+L  G IR N+ 
Sbjct: 1251 GAGKSTIMTALYRLNELTSGSILIDDVDINKLGLHELRKKLAIIPQDPVLFRGDIRKNL- 1309

Query: 525  YGLAEPATKEEIRSV------------AKQCFCHNFITKFPDG---------YDTMIGAQ 563
                   T EE+  V            A+    H  IT+  DG          D ++   
Sbjct: 1310 -DPFHERTDEELWDVLVRGGAIAPEDLAETKAQH--ITE--DGTSADLHKFHLDKVVEED 1364

Query: 564  GALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSI 623
            GA  S G+RQ +A+ RAL++   IL+LDEATS++D E++  I             TI+ I
Sbjct: 1365 GANFSLGERQILALTRALVRNTKILILDEATSSVDYETDRKIQERIATAF--SHCTILCI 1422

Query: 624  AHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS---ELCK 664
            AHRL TI   + ++VL + G V E      LF +  +    +CK
Sbjct: 1423 AHRLKTILNYDRILVL-EHGEVAEFDTPMNLFKDETTIFHNMCK 1465

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/230 (29%), Positives = 121/230 (52%), Gaps = 22/230 (9%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           F ++N ++  G  V I GP G GK+++      +   T+G I ++G D+           
Sbjct: 612 FTNLNFEIKKGEFVMITGPIGTGKTSLLNSFAGFMEKTSGTIQING-DL----------- 659

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
             L+   P + + T+RDNI +G   P  +++ + V + C   + +   P G  T IG +G
Sbjct: 660 --LMGGYPWIQNATVRDNIIFG--SPYEEDKYKEVLRACSLESDLDILPAGDKTEIGERG 715

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSMTIVSI 623
             LSGGQ+ RI +AR + K+ +I +LD+  SA+D    +  ++    +L+  G+ T +  
Sbjct: 716 ITLSGGQKARINLARCVYKEKDIYLLDDVLSAVDSRVGKHIMDECLTKLI--GNKTRLLA 773

Query: 624 AHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRS 673
            H+LS I ++  +IVLG DGSV E G  +  +    ++  K+L E ++++
Sbjct: 774 THQLSLIDKASRIIVLGNDGSV-EIGDVQ--YMKETNKTLKVLLENTNQA 820

>TDEL0G00330 Chr7 complement(58587..62984) [4398 bp, 1465 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1465

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 127/506 (25%), Positives = 216/506 (42%), Gaps = 61/506 (12%)

Query: 189  MNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSIS 248
            + + LH    + DT  +G +++R   D   +   +T+ +   F       +G+ +M  I 
Sbjct: 963  VERVLHTPMAYMDTTPIGRILNRFTKDTDSLDNELTESLR-LFMTQFANIIGVCVMCIIY 1021

Query: 249  -PELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAE 307
             P  +  + F     +  A  +    R   +        +     E L G+ T++++ ++
Sbjct: 1022 LPWFAIAIPFLVLIFVLIADHYQASGREVKRLDAIQRSFVYNNLNEVLGGMDTIKAYGSQ 1081

Query: 308  QRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGD 367
            +R L + +  I    N   +A ++         +  DM  +   L  S L +     I  
Sbjct: 1082 ERFLVKTDFLI----NKMNEAGYLLVALQRWVAIFLDMIAVAFALIISLLCVTRQFHISP 1137

Query: 368  LTAFMLYTEYTGSSVFGLTTFYSELMQ---GVGAASRLFDLTDHIS--------SISPTK 416
             +  +L T Y       L T    L Q    + +A RL    + +          ++P +
Sbjct: 1138 ASVGVLLT-YVLQLPGLLNTILRALTQTENDMNSAERLVYCANELPLEADYKRPELAPPE 1196

Query: 417  GQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLL 475
                 P KG+I F++VSF+Y P  P   + K I++ +     + I G +G GKSTI   L
Sbjct: 1197 SW---PSKGEIVFEDVSFAYRPGLP--VVLKGISLDIKSQEKIGICGRTGAGKSTIMSAL 1251

Query: 476  LRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEP----- 530
             R    ++G+I +D  DI ++    LR+ + ++ Q+P+L  GTIR N+      P     
Sbjct: 1252 YRLNELSDGKIFIDSVDIGQIGLYDLRKKLSIIPQDPVLFRGTIRKNLDPFQEHPDELLW 1311

Query: 531  --------ATKEEIRSVAKQ--------CFCHNFITKFPDGYDTMIGAQGALLSGGQRQR 574
                     + EE+  V  Q           H F        D  +  +GA  S G+RQ 
Sbjct: 1312 KSLVSGGAISAEEVEVVKGQKPDSIGSLSSMHKF------HLDQKVEEEGANFSLGERQL 1365

Query: 575  IAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSE 634
            +A+ RAL+++  IL+LDEATS++D E++  I          G  TI+ IAHRL TI   +
Sbjct: 1366 LALTRALVRQSKILILDEATSSVDYETDNKIQSRIAAAF--GDCTILCIAHRLKTILTYD 1423

Query: 635  NVIVLGKDGSVIEAGKFKELFANPNS 660
             ++VL       E G+ +E F  P S
Sbjct: 1424 RILVL-------EQGEIEE-FDTPRS 1441

 Score =  107 bits (267), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 82/236 (34%), Positives = 119/236 (50%), Gaps = 23/236 (9%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           FK++NI +  G  V I GP G GKS++   +  +   T+G + VDG D+           
Sbjct: 596 FKNLNIDIKKGDFVMITGPIGTGKSSLLSAMAGFMRKTSGTVEVDG-DL----------- 643

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
             L+   P + + T+RDNI +G   P  KE    V + C     I   P G  T IG +G
Sbjct: 644 --LMCGYPWIQNATVRDNIIFG--SPYDKERFDEVVRVCSLKADIDILPGGELTEIGERG 699

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAI--NYTFGQLMKSGSMTIVS 622
             LSGGQ+ RI +AR++ K  +I + D+  SA+D      I      G+L   G   I++
Sbjct: 700 ITLSGGQKARINLARSVYKDKDIFLFDDVLSAVDSRVGKHIMDECLLGRL--KGKTRILA 757

Query: 623 IAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDS 678
             H+LS I+++  VIVLG DGS  EAGK ++L    N  L  LL   S +S   ++
Sbjct: 758 -THQLSLIEKASVVIVLGVDGS-FEAGKLEDL-KRSNKTLINLLHFSSQKSSSKEA 810

>KLLA0C14234g Chr3 (1234598..1238962) [4365 bp, 1454 aa] {ON} similar
            to uniprot|P53049 Saccharomyces cerevisiae YGR281W YOR1
            Plasma membrane transporter of the ATP- binding cassette
            (ABC) family mediates export of many different organic
            anions including oligomycin
          Length = 1454

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 126/526 (23%), Positives = 230/526 (43%), Gaps = 39/526 (7%)

Query: 167  FARIVMLRILSERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQK 226
            F + + + +L       L    + + LH    F D   +G +++R   D   +   +T+ 
Sbjct: 927  FTQFISIGLLGTYASKHLNIKALQRLLHAPMSFMDVTPIGRVMNRFTKDTDTLDNEITES 986

Query: 227  VSDGFKALICGGVGIG----MMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQE 282
            V    + LI     +     + +   P  +  + F     ++ A  +    R   +    
Sbjct: 987  V----RLLIFQIANLTGIIILCIIYIPWFAIAMPFLVFLYVFVADHYQASGREIKRMDAV 1042

Query: 283  ATGQLTRVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTML 342
                +     E L G+ T++++ +EQR L + +  I  +   G     I      S  ML
Sbjct: 1043 QRSFVYNNFNEVLGGMDTIKAYRSEQRFLMKSDFLINKMNEAGYLVTSIQRWVAISLDML 1102

Query: 343  GDMSFIVVLLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRL 402
              +  +++ L    +  Q  ++ G +   + Y       +  L    ++    + +A RL
Sbjct: 1103 AVIFALIIALLC--VTRQFHVSAGSVGVMVTYVLQLPGLLNALLRSQTQTENDLNSAERL 1160

Query: 403  ----FDL-TDHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQI-FKDINIKVPPGS 456
                +DL  +    I  T+  +  P +G I+F+NVS +Y  RPE  +  K+++I +    
Sbjct: 1161 VNYAYDLPIEAKYRILETQPPEQWPSEGRIKFENVSLAY--RPELPVALKNVSIDIGSNE 1218

Query: 457  NVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMS 516
             + I G +G GKSTI   L R      G+I +D  DIS +    LR  + ++ Q+P+L  
Sbjct: 1219 KIGICGRTGAGKSTIMSALYRLVELKTGKITIDDIDISTLGLYELRSKLAIIPQDPVLFK 1278

Query: 517  GTIRDNI-------------TYGLAEPATKEEIRSVAKQCFCHNFIT--KFPDGYDTMIG 561
            G IR N+                      ++++ S+  Q    N ++   F    D M+ 
Sbjct: 1279 GDIRRNLDPFQECTDEQLWDALVRGGAIDRKDVDSIRAQHKDANGLSGDMFKFHLDQMVE 1338

Query: 562  AQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIV 621
              G+  S G+RQ +A+ RAL++   IL+LDEATS++D  ++  I     +  +  + TI+
Sbjct: 1339 DDGSNFSLGERQLLALTRALVRGSKILILDEATSSVDYATDAKIQSRIVE--EFSNCTIL 1396

Query: 622  SIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS---ELCK 664
             IAHRL TI     ++VL + G V+E    K+L+ + +S   E+C+
Sbjct: 1397 CIAHRLKTILAYNRILVLDQ-GQVVEFDTPKKLYNDRDSIFNEMCR 1441

 Score = 80.9 bits (198), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 98/201 (48%), Gaps = 19/201 (9%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           F  +N  V     + I GP G GKS++   L  +   ++G + + G D+           
Sbjct: 592 FHGLNFDVKENEFIIITGPIGTGKSSLLNALAGFMRRSSGSMTIKG-DL----------- 639

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
             L+   P + + T++DNI +G   P  K + + V + C     +   P G  T IG +G
Sbjct: 640 --LLCGYPWVQNATVKDNILFG--SPFDKPKYQKVIEICSLQADLDILPAGDRTEIGERG 695

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSMTIVSI 623
             LSGGQ+ RIA+AR++ K  +I + D+  SA+D    +  ++      +K  +  + + 
Sbjct: 696 ITLSGGQKARIALARSVYKDMDIYLFDDVLSAVDSRVCKHIVDECMMGYLKQKTRILAT- 754

Query: 624 AHRLSTIKRSENVIVLGKDGS 644
            H+LS I ++  VI LG DGS
Sbjct: 755 -HQLSLIDKASRVIFLGLDGS 774

>Kpol_1060.7 s1060 complement(13248..17630) [4383 bp, 1460 aa] {ON}
            complement(13248..17630) [4383 nt, 1461 aa]
          Length = 1460

 Score =  121 bits (304), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 136/510 (26%), Positives = 234/510 (45%), Gaps = 76/510 (14%)

Query: 183  RLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIG 242
            +L    + + LH    F DT  +G +++R   D   +   +T+ V     A     +G+ 
Sbjct: 951  KLNLSAVRRILHTPMAFLDTTPLGRILNRFTKDTDSLDNELTENVRLML-AQFANIIGVC 1009

Query: 243  MMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVA----------- 291
            +M  I       L +FA  I +   +F     H     Q A  ++ R+            
Sbjct: 1010 VMCII------YLPWFAIAIPFILLIFVLVSNH----YQSAGREIKRLEAIQRSFVYNNL 1059

Query: 292  EEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLG-DMSFIVV 350
             E L G+ T++ + +E+R + + +  I  +   G     +         M+    + I+ 
Sbjct: 1060 NEVLGGMDTIRFYNSEERFMAKSDYLIDKMNEAGYLVVCVQRWVAVLLDMIAVCFALIIA 1119

Query: 351  LLYGSYLVLQGSLTIGDLTAFMLY--------------TEYTGSSVFGLTTFYSELMQGV 396
            LL  +      + ++G L  ++L               TE   +SV  L ++ +EL    
Sbjct: 1120 LLCVTRQFHISASSVGVLLTYVLQLPGLLNTVLRALTQTENDMNSVERLVSYATEL--PT 1177

Query: 397  GAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPG 455
             AA R  +     SS  P+      P +G I+F+ VSF+Y P  P   + K++++ +  G
Sbjct: 1178 EAAYRKPE-----SSPDPS-----WPQEGKIDFEEVSFAYRPGLP--AVLKNLSMSINGG 1225

Query: 456  SNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILM 515
              + I G +G GKSTI   L R     +G+I++DG +IS +    LRR + ++ Q+P+L 
Sbjct: 1226 EKIGICGRTGAGKSTIMSALYRLNELESGRIIIDGVNISNIGLFDLRRSLSIIPQDPVLF 1285

Query: 516  SGTIRDNIT-YG------LAEPAT------KEEIRSVAKQCFCHNF----ITKFPDGYDT 558
             GTIR N+  +G      L +  +      KE +  V  Q    N     + KF    D 
Sbjct: 1286 RGTIRKNLDPFGERSDDELWDALSRGGSIDKESLEEVKTQKSTGNSKVQELHKF--HLDQ 1343

Query: 559  MIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGS- 617
             +  +G+  S G+RQ +A+ARAL++   +L+LDEATS++D E++  I     +++++ S 
Sbjct: 1344 EVEEEGSNFSLGERQLLALARALVRNSKVLILDEATSSVDYETDNKIQ---NRIIEAFSE 1400

Query: 618  MTIVSIAHRLSTIKRSENVIVLGKDGSVIE 647
             TI+ IAHRL TI   + ++VL K G + E
Sbjct: 1401 CTILCIAHRLKTILNYDRILVLEK-GEIAE 1429

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 104/210 (49%), Gaps = 18/210 (8%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           FKDIN+++  G  + I GP G GK+++   +      T G + ++G+             
Sbjct: 604 FKDINLEIHKGEFIMITGPIGTGKTSLLNAMSGLMEKTEGSVQINGE------------- 650

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
             L+   P + + T+RDNI +G   P  K +   V K C     +   P G  T IG +G
Sbjct: 651 -LLMGGYPWIQNATVRDNIIFG--SPFDKSKYNMVVKACCLDADLDILPAGDMTEIGERG 707

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIA 624
             LSGGQ+ RI +AR + K  +I + D+  SA+D      I       + +G   +++  
Sbjct: 708 INLSGGQKARINLARCVYKNKDIYLFDDVLSAVDSRVGKLIMDECLLGLLNGKTRVLA-T 766

Query: 625 HRLSTIKRSENVIVLGKDGSVIEAGKFKEL 654
           H+LS ++ +  VIVLG DGSV + G  +EL
Sbjct: 767 HQLSLVENASRVIVLGNDGSV-DIGTVEEL 795

>Kwal_26.9532 s26 complement(1256241..1260656) [4416 bp, 1471 aa] {ON}
            YGR281W (YOR1) - ABC transporter [contig 363] FULL
          Length = 1471

 Score =  120 bits (300), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 136/520 (26%), Positives = 232/520 (44%), Gaps = 61/520 (11%)

Query: 189  MNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSIS 248
            + + LH    F DT  +G +++R   D   +   +T+ V   F       VG+ +M  I 
Sbjct: 966  VKRLLHTPMSFLDTTPIGRVLNRFTKDTDTLDTELTESVR-LFLFQASNIVGVVIMCII- 1023

Query: 249  PELSGVLLFFAPPILWSASVFGKKIRH---TSKDLQEATG-QLTRVAE---EQLSGVKTV 301
                  L +FA  + +   +F     H   +S++++     Q + V     E LSG+ T+
Sbjct: 1024 -----YLPWFAIAVPFLLLIFAAVADHYQSSSREIKRLEAVQRSHVFNNFNEVLSGMDTI 1078

Query: 302  QSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSF--IVVLLYGSYLVL 359
            +++  E R L + +  I  +   G     I      +  M+  M+F  I+ LL  +    
Sbjct: 1079 RAYRGEARFLTKSDFLINKMNEAGYVVVAIQRWVSIALDMIA-MAFALIITLLCVTRQFS 1137

Query: 360  QGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQG---VGAASRLF----DLTDHISSI 412
              + ++G L  ++L  +  G     L T    + QG   + +A RL     DL    +  
Sbjct: 1138 ISAASVGVLLTYVL--QLPGL----LNTLMRAMTQGENDMNSAERLISYATDLPLEAAYR 1191

Query: 413  SP-TKGQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKST 470
             P T   +  P +G I+F +VS +Y P  P   +  D+++ V  G  + I G +G GKST
Sbjct: 1192 RPETSPPESWPSEGAIDFDHVSLAYRPGLP--LVLHDVSLHVRGGEKIGICGRTGAGKST 1249

Query: 471  IALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNIT------ 524
            I   L R     +G I +DG DI+++    LR  + ++ Q+P+L  G +R N+       
Sbjct: 1250 IMSALYRMIELHDGSITIDGIDIAQLGLYELRSKLAIIPQDPVLFKGDVRKNLDPFHERS 1309

Query: 525  --------YGLAEPATKEEIRSVAKQCFCHNFITKFPDGY-DTMIGAQGALLSGGQRQRI 575
                          AT++E  + A        +T     + +  +   G+  S G+RQ +
Sbjct: 1310 DNELWDALVRAGAIATEDEAAARAVTRATAGALTNLHKFHLEQEVEEDGSNFSLGERQLL 1369

Query: 576  AIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSEN 635
            A+ RAL++   IL+LDEATS++D E++  I             T++ IAHRL+TI   + 
Sbjct: 1370 ALTRALVRSSRILILDEATSSVDYETDAKIQARIADAF--SECTVLCIAHRLNTILDYDR 1427

Query: 636  VIVLGKDGSVIEAGKFKELFANPNSELCK--LLTEKSSRS 673
            ++VL + G V E       F  P++   +  L TE  +RS
Sbjct: 1428 ILVLDQ-GRVCE-------FDTPHALFVRNGLFTEMCARS 1459

 Score = 84.0 bits (206), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 68/214 (31%), Positives = 101/214 (47%), Gaps = 26/214 (12%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           FK++NI++  G  V + G  G GKS++   +  +    +G I  +G   S + C      
Sbjct: 594 FKNLNIEIAKGELVIVTGSVGTGKSSLLAAMSGFMKKKSGDIYKNG---SLLLCGY---- 646

Query: 505 IGLVQQEPILMSGTIRDNITYG--LAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGA 562
                  P + + T++DNI +G    E   KE IR     C     +   P G  T IG 
Sbjct: 647 -------PWIQNTTVKDNILFGSPFDEARYKETIRV----CSLQADLDLLPAGDKTEIGE 695

Query: 563 QGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAI--NYTFGQLMKSGSMTI 620
           +G  LSGGQ+ RI +AR++ KK +I + D+  SA+D      I      G L      T 
Sbjct: 696 RGITLSGGQKARINLARSVYKKKDIYLFDDVLSAVDARVGKHIMDECMMGAL---DGKTR 752

Query: 621 VSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKEL 654
           V   H+LS I R+  VI +  DG+V ++G   EL
Sbjct: 753 VLATHQLSLIARASKVIFIDLDGTV-DSGTLDEL 785

>Skud_18.2 Chr18 (5442..10184) [4743 bp, 1580 aa] {ON} YHL035C (REAL)
          Length = 1580

 Score =  119 bits (298), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 128/531 (24%), Positives = 240/531 (45%), Gaps = 75/531 (14%)

Query: 177  SERVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALIC 236
            ++++ ++L S +    L     F+D   VG +++R   D  ++ + +       F +++ 
Sbjct: 1058 TKKIFSKLLSSIFEAKLR----FHDITPVGRIMNRFSKDMDIIDQQLIPNFEGLFYSVVV 1113

Query: 237  GGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEA----TGQLTRVAE 292
                + ++  ++P      L FA P+       G      S++L+         + ++  
Sbjct: 1114 CLWIVILIGYVTPRF----LIFAIPLCGLYYFVGALYLRASRELKRIDNINVSPIHQLFT 1169

Query: 293  EQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLL 352
            E + GV T+++   E+R +     AI G           NA FF  +     +++ V ++
Sbjct: 1170 EAIKGVVTIRALADERRFITHTLEAIDGS----------NAPFFYLSVATEWITYRVDII 1219

Query: 353  YGSYLVLQGSLTI--------GDLTAFML-----YTEYTGSSVFGLTTFYSELMQGVGAA 399
             G+ ++   SL I          L   +L     +TE T   +  + +    LM  V   
Sbjct: 1220 -GALVLFSSSLMIIARAPYLDAGLAGILLSNAFSFTE-TAQWIIKVFSGVELLMSSVERI 1277

Query: 400  SRLFDL-----TDHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPP 454
                ++       + S+ SP       P  G+IEFKN+S  Y       +  +++ KV  
Sbjct: 1278 KEYIEVPLEFSKSNDSATSPVDW----PQTGEIEFKNLSLRYSPHSSKAL-DNVSFKVRT 1332

Query: 455  GSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPIL 514
            G+ V IVG +G GKS+I   + R  +  +G I++D +DI  V+ + LR  I  + Q P L
Sbjct: 1333 GTKVGIVGRTGAGKSSIIAAIYRLSDWESGTIIIDNKDIKCVSLECLRNSISCIPQNPTL 1392

Query: 515  MSGTIRDNITYGLAEPATKEEIRSVAK-------QCFCHNFIT-----------KFPDGY 556
              GTIR N+     + + K+   ++AK       +  C   +T           KF D  
Sbjct: 1393 FDGTIRSNLD-PYNQYSDKQVFDALAKVGLIERNEVLC--LVTDRQQSSSFSPNKFSD-L 1448

Query: 557  DTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG 616
            ++++ + G+ LS GQRQ + +AR+++    I+++DEAT+++D  S+  I  T  + M+  
Sbjct: 1449 NSVVRSGGSNLSQGQRQLLCLARSMLGSRKIMLIDEATASIDYISDAKIQKTIRETME-- 1506

Query: 617  SMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS---ELCK 664
            + TI++IAHRL ++     ++V+   G V E      L ++ N+    LC+
Sbjct: 1507 NTTILTIAHRLRSVIDYNKILVMDM-GRVKEYDHPYNLISDKNTIFHHLCE 1556

 Score = 85.9 bits (211), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 134/519 (25%), Positives = 224/519 (43%), Gaps = 50/519 (9%)

Query: 195 QDSEFYDTHKVGDLISR--------LGSDAYVVSRSMTQKVSDGFKALICGGV--GIGMM 244
           +D E+ +T  V +  SR        +  DA+ VS +M+         L C  V   I  +
Sbjct: 430 EDHEYSET-DVNEAASRKDNSVNNIMSVDAFKVSEAMSTFY------LACEAVFMTITAL 482

Query: 245 VSISPEL-------SGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSG 297
           V++   L       +  L+   P   W A+ +GK       D    T + T    E L+ 
Sbjct: 483 VTLYSLLGWSAFAGTFALIAMIPLNFWCATFYGK----YQADQLLLTDKRTSDISEALNS 538

Query: 298 VKTVQSFVAEQRELHRYNGAIRGIYNVGRKAA---FINAE-FFTSTTMLGDMSFIVVLLY 353
           ++ ++    E+    +      G   + RK A   F+N   +F   T++  ++F V + +
Sbjct: 539 IRVIKVLAWEKLFYQKIMNIREGEIRILRKKATIFFLNHLIWFFGPTLVSVVTFAVFIKF 598

Query: 354 GSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSIS 413
                L  S+    L+ F +      + +  + +  S L+Q   +  R+    D++    
Sbjct: 599 QKQ-TLTPSVAFTALSLFAILR----TPMDQIASTISLLVQSFISLKRI---EDYLDESE 650

Query: 414 PTKGQKYIPGKGDIEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIAL 473
            +K +     K  + FK+ +  +     +   K+I+I+    S   I+GP+G GKS++ L
Sbjct: 651 TSKYEILTQSKSKVGFKDANMEWDADETSFKLKNISIEFKLNSLNAIIGPTGSGKSSLLL 710

Query: 474 LLLRYYNPTNGQILV---DGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEP 530
            LL   N  +GQI V   D +D  +V    +   +    Q P L+SGTI DNI +G  E 
Sbjct: 711 GLLGELNLCSGQIYVPSVDSRDDLEVGIDGMTNSMAYCSQSPWLISGTIEDNIVFG--ER 768

Query: 531 ATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVL 590
             +    +V K C     +     G  T +G  G  LSGGQ+QR+A+ARA+      L+L
Sbjct: 769 PNQRRFNAVIKACCLEKDVKAMSAGLKTSVGGGGFSLSGGQQQRVALARAIYSSSRFLLL 828

Query: 591 DEATSALDVESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEA 648
           D+  SA+D E+   I      G +MK  +  I S  H +S I +    +V+  +G V   
Sbjct: 829 DDCLSAVDPETALNIYEKCLCGPIMKGRTCIITS--HNISLITKKAEWLVILDNGEVKGQ 886

Query: 649 GKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPPPNAT 687
           GK  +L A  N+ L + +    +   GN + P     AT
Sbjct: 887 GKPSDL-AESNNFLKESMNNGLADESGNQAKPKSKTAAT 924

>KLTH0B09724g Chr2 complement(796023..800483) [4461 bp, 1486 aa] {ON}
            similar to uniprot|P53049 Saccharomyces cerevisiae
            YGR281W YOR1 Plasma membrane transporter of the ATP-
            binding cassette (ABC) family mediates export of many
            different organic anions including oligomycin
          Length = 1486

 Score =  117 bits (293), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 138/527 (26%), Positives = 226/527 (42%), Gaps = 76/527 (14%)

Query: 183  RLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIG 242
            RL    + + LH    F DT  +G +++R   D   V   +T+ V   F   +   VG+ 
Sbjct: 975  RLNLKAVQRLLHTPMSFLDTTPIGRVLNRFTKDTDTVDTELTESVR-LFVFQLSNIVGVI 1033

Query: 243  MMVSISPELSGVLLFFAPPILWSASVF---GKKIRHTSKDLQEATG-QLTRVAE---EQL 295
            +M  I       L +FA  + +   VF       + +S++++     Q + V     E L
Sbjct: 1034 VMCII------YLPWFAIAVPFLMLVFVGVADHYQSSSREIKRLEAVQRSHVFNNFNEVL 1087

Query: 296  SGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSF--IVVLLY 353
             G+ T++++  E+R L + +     +   G     I      +  M+  M+F  IV LL 
Sbjct: 1088 GGMDTIRAYRGERRFLTKSDFLTNKMNEAGYLVVAIQRWVAIALDMIA-MAFALIVTLLC 1146

Query: 354  GSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQG---VGAASRLFDLTDHIS 410
             +      + ++G L  ++L  +  G     L      + QG   + +  RL      + 
Sbjct: 1147 VTRQFHISAASVGVLLTYVL--QLPGL----LNMLLRAMTQGENDMNSTERLISYATELP 1200

Query: 411  --------SISPTKGQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIV 461
                     +SP       P  G IEF +VS +Y P  P   + KD+ + V  G  + I 
Sbjct: 1201 LEAAYRRPEMSPPAEW---PTDGRIEFDHVSLAYRPGLP--LVLKDVTLHVAAGEKIGIC 1255

Query: 462  GPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRD 521
            G +G GKSTI   L R     +G I +DG DIS +    LR  + ++ Q+P++  G +R 
Sbjct: 1256 GRTGAGKSTIMSALYRMCELHDGSITIDGVDISTLGLYDLRSKLSIIPQDPVMFKGDVRK 1315

Query: 522  N---------------ITYGLAEPATKEEIRSVAKQCF--------CHNFITKFPDGYDT 558
            N               +  G A PA  E + +V  Q           H F          
Sbjct: 1316 NLDPFHERTDDELWHALVRGGAIPA--ESLATVRAQTHENAGSLSNMHKF------HLQQ 1367

Query: 559  MIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSM 618
             +   G   S G+RQ +A+ RAL+++  IL+LDEATS++D E++  I     +     + 
Sbjct: 1368 EVEEDGTNFSLGERQLLALTRALVRQSKILILDEATSSVDYETDAKIQTRIVEAF--SNC 1425

Query: 619  TIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPN--SELC 663
            TI+ IAHRL+TI   + ++VL + G V E      L+A     +E+C
Sbjct: 1426 TILCIAHRLNTILDYDRILVLDQ-GRVCEFDTPAALYARGGVFTEMC 1471

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 102/212 (48%), Gaps = 22/212 (10%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           F ++NI++  G  V + G  G GKS++   L  +   T G I  DG              
Sbjct: 603 FDNLNIQITKGELVIVTGSVGTGKSSLLYALSGFMKKTGGDIYKDGT------------- 649

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
             L+   P + + T+RDNI +G   P  +     + + C     +   P G  T IG +G
Sbjct: 650 -MLLCGYPWIQNATVRDNILFG--SPYNEARYNEIIRVCSLQADLELLPAGDRTEIGERG 706

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAI--NYTFGQLMKSGSMTIVS 622
             LSGGQ+ RI +ARA+ KK +I + D+  SA+D      I      G+L   GS  +++
Sbjct: 707 ITLSGGQKARINLARAVYKKKDIYLFDDVLSAVDARVGKHIMDECLMGKL--EGSTRVLA 764

Query: 623 IAHRLSTIKRSENVIVLGKDGSVIEAGKFKEL 654
             H+LS I R+  VI +  DGSV + G  +EL
Sbjct: 765 -THQLSLIARASKVIYIDLDGSV-DVGSVEEL 794

>Zrou_YGOB_Anc_5.10 Chr3 complement(92067..95045) [2979 bp, 992 aa]
           {ON} ANNOTATED BY YGOB -
          Length = 992

 Score =  115 bits (288), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 125/500 (25%), Positives = 226/500 (45%), Gaps = 52/500 (10%)

Query: 193 LHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELS 252
           LH    F DT  +G +++R   D    + SM  ++++  + ++     +G ++ +     
Sbjct: 491 LHTPLSFMDTTPLGRILNRFTKD----TDSMDNELTEDIRLMM---FQLGNIIGVIVMCI 543

Query: 253 GVLLFFA---PPILWSASVFGKKIRHTSKDLQ--EATGQ--LTRVAEEQLSGVKTVQSFV 305
             L +FA   P +L    +     + + ++++  EA  +  +     E L G+ T++++ 
Sbjct: 544 VYLPWFAIAVPFLLIMFVMIADHYQSSGREVKRLEAVQRSFVYNNLNEVLGGLDTIRAYR 603

Query: 306 AEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTI 365
           ++ R L + +  I    N   +A ++ A       +  DM  ++  L  + L +     I
Sbjct: 604 SQDRFLVKSDFLI----NKMNEAGYMVAALQRWVAIFLDMLAVIFALIITLLCVTRQFKI 659

Query: 366 GDLTAFMLYTEYTGSSVFGLTTFYSELMQ---GVGAASRL----FDLTDHISSISPTKGQ 418
              +  +L T Y       L T    L Q   G+ +A RL     DL        P    
Sbjct: 660 SPSSTGVLLT-YVLQLPGLLNTVLRALTQAENGMNSAERLVTYALDLPQEAEYRRPEMSP 718

Query: 419 -KYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLL 476
            +  P +G+I+F+ VSF+Y P+ P   + K+ ++ +  G  + I G +G GKSTI   L 
Sbjct: 719 PENWPDRGEIKFEGVSFAYRPSLP--PVLKNFSLNIGSGEKIGICGRTGAGKSTIMSALY 776

Query: 477 RYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDN-------------- 522
           R     +G+I +D  +I+ +    LR  + ++ Q+P+L  GTI+ N              
Sbjct: 777 RINEVIDGKIFIDNINIADLGLFELRSKLAIIPQDPVLFRGTIKKNLDPFGEKTDQELWE 836

Query: 523 --ITYGLAEPATKEEIRSVAKQCF-CHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIAR 579
             +  G   P   EE ++        H+ + KF    +  +  +G   S G++Q +A+ R
Sbjct: 837 SLVRGGAIAPEDIEETKAQQPDASGSHSKMHKFH--LEQKVEEEGGNFSLGEKQLLALTR 894

Query: 580 ALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVL 639
           AL++   IL+LDEATS++D E++  I     +    G  TI+ IAHRL+TI   + ++VL
Sbjct: 895 ALVRNSRILILDEATSSVDYETDDKIQSRIVEAF--GDCTILCIAHRLNTILNYDRILVL 952

Query: 640 GKDGSVIEAGKFKELFANPN 659
            + G V E      LF   +
Sbjct: 953 -EQGEVAEFDTPWNLFTKED 971

 Score =  101 bits (252), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 119/236 (50%), Gaps = 23/236 (9%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           F+++N  +  G  + + GP G GK+++   +  +   + G + V+G+ +S   C      
Sbjct: 106 FQNLNFDIKKGEFIIVTGPIGTGKTSLLSAMAGFMARSGGSVEVNGRLLS---CGY---- 158

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
                  P + + T+RDNI +G   P  K + R V K C   + +   P G  T IG +G
Sbjct: 159 -------PWIQNATVRDNIIFG--SPYEKAKYRKVIKACSLDSDLEILPAGDMTEIGERG 209

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAI--NYTFGQLMKSGSMTIVS 622
             LSGGQ+ RI +AR + K  +I + D+  SA+D      I      G L   G  T + 
Sbjct: 210 INLSGGQKARINLARCVYKDKDIYLFDDVLSAVDARVGKHIMDECLLGLL---GQKTRIL 266

Query: 623 IAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDS 678
             H+L+ I+++  +IVLG DGS    G ++EL    NS+L KLL   S +S+ +D+
Sbjct: 267 ATHQLALIEKATRLIVLGNDGS-FTIGTYEEL-QKSNSQLKKLLQFTSDKSEEDDN 320

>TBLA0A06840 Chr1 (1666910..1670086) [3177 bp, 1058 aa] {ON} Anc_5.10
            YGR281W possible pseudogene; NNN added to avoid internal
            stop codon; truncated at 5' end
          Length = 1058

 Score =  112 bits (279), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 82/250 (32%), Positives = 127/250 (50%), Gaps = 21/250 (8%)

Query: 422  PGKGDIEFKNVSFSYPT-RPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYN 480
            P  G I+FK+ +F Y    P   I K+ N+ V  G  + I G +G GKSTI   L R   
Sbjct: 797  PENGKIQFKDANFRYKEGLP--LILKNFNMLVQSGEKIGICGRTGAGKSTIMNCLFRLDE 854

Query: 481  PTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNIT-YGLAEPATKEEIRSV 539
             T+G I +D  DIS +    LR+++ ++ Q+PIL  GTIR N+  +   + AT  E   +
Sbjct: 855  LTDGAIYIDDIDISTLGLHDLRKNLSIIPQDPILFEGTIRKNLDPFSYFDDATLWEAMIL 914

Query: 540  A----KQCFCH--------NFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNI 587
            +    +  F H          +TKF       +   G   S G++Q +A  RA+I    +
Sbjct: 915  SGFIDRDTFGHFSEKPVNNKELTKFH--LTAHVEEDGTNYSLGEKQLLAFTRAIIHHSKV 972

Query: 588  LVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIE 647
            +VLDEA+S++D E++  I     +       TI+ IAHRL+TI + + ++VL   G++I 
Sbjct: 973  VVLDEASSSVDYETDAKIQTLISKQFSHN--TILCIAHRLNTILKYDRILVLDH-GNIIG 1029

Query: 648  AGKFKELFAN 657
                + LF N
Sbjct: 1030 FENPRVLFEN 1039

 Score = 87.8 bits (216), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 112/251 (44%), Gaps = 43/251 (17%)

Query: 427 IEFKNVSFSYPT------RPENQI---------------FKDINIKVPPGSNVCIVGPSG 465
           I+F N SF + T      + EN I               F ++N  +  G  + I GP G
Sbjct: 166 IKFNNASFEWETFEDDIIKDENNINQILENKTNNCHFNGFNNLNFSIX-GEFIIITGPIG 224

Query: 466 RGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITY 525
            GK+++   +        G I +DG             ++ L    P + + T+RDNI +
Sbjct: 225 TGKTSLLYAMSGLMKKLEGTIEIDG-------------NLQLCGY-PWVQNTTVRDNIIF 270

Query: 526 GLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKP 585
           G      KE+   V + C     +  F     T IG  G  LSGGQ+ RI +ARA+ K  
Sbjct: 271 G--SKYEKEKFDHVIRICALTEDLENFSGKDLTEIGELGITLSGGQKARINLARAIYKTS 328

Query: 586 NILVLDEATSALDVESEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDG 643
           +I + D+  SA+D      I  N   G L  SG    +   H+LS IK+++ ++VLG D 
Sbjct: 329 DIYLFDDILSAVDSRVGNFIMENCLLGAL--SGKTXXILATHQLSLIKKADRIVVLGNDN 386

Query: 644 SVIEAGKFKEL 654
           S  E G +KEL
Sbjct: 387 S-FEIGPYKEL 396

>TBLA0C07100 Chr3 (1721628..1726085) [4458 bp, 1485 aa] {ON} 
          Length = 1485

 Score =  111 bits (278), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 129/505 (25%), Positives = 220/505 (43%), Gaps = 60/505 (11%)

Query: 189  MNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSIS 248
            ++K LH    F DT+ +G +++R   D   +   +T+ +       I   +G+G M  I 
Sbjct: 981  LHKILHTPMSFMDTNPLGRILNRFTKDTDALDNELTENLRLAMSQ-IANIIGVGAMCII- 1038

Query: 249  PELSGVLLFFA---PPILWSASVFGKKIRHTSKDLQ--EATGQ--LTRVAEEQLSGVKTV 301
                  L +FA   P +L    +     + T ++++  EA  +  +     E L+G+ T+
Sbjct: 1039 -----YLPWFAIAIPFLLLIFLLIADHYQSTGREVKRLEAIQRSFVYNNLNEMLTGMDTI 1093

Query: 302  QSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQG 361
            +++ A+ R   +    I  +     +AA+I+        +  D+  +   L  + L +  
Sbjct: 1094 KAYNAQDRFATKSEFLIDKM----NEAAYISIAVQRWAGIFLDLVAVAFALIITLLCVTR 1149

Query: 362  SLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHISSIS---PTKGQ 418
               I      +L T      V  L    + +++ +       + T+ + S +   P + Q
Sbjct: 1150 QFHISGADTGVLLT-----YVLQLPGLLNTVLRALTQTENDMNSTERLVSYATQLPQEAQ 1204

Query: 419  KY---------IPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGK 468
                        P  G I F+N++F+Y P  P   I K+ N+ + P   + I G +G GK
Sbjct: 1205 YRKPECSPPIDWPQNGHIVFENINFAYRPGLP--IILKNFNLIIKPNEKIGICGRTGAGK 1262

Query: 469  STIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDN------ 522
            STI   L R    T G+I++D  DIS +    LR  + ++ Q+P+L  G IR N      
Sbjct: 1263 STIMNALYRLTELTTGKIIIDDIDISNLGLYELRSKLAIIPQDPVLFRGNIRRNLDPFDE 1322

Query: 523  ----------ITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQR 572
                      +  G  +    E ++S  K     N + KF    +  +   G   S G+R
Sbjct: 1323 YQDDLLWESLVKAGAIDSQELETVKSQDKNSDAKN-LHKF--HLNQSVDEDGNNFSLGER 1379

Query: 573  QRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKR 632
            Q +A+ RAL+++  IL+LDEATS++D E++  I             TI+ IAHRL TI  
Sbjct: 1380 QVLALTRALVRQSKILILDEATSSVDYETDAKIQNLIATAF--NHCTILCIAHRLKTILN 1437

Query: 633  SENVIVLGKDGSVIEAGKFKELFAN 657
             + ++VL K G V E      LF N
Sbjct: 1438 YDRILVLEK-GEVAEFDTPWNLFNN 1461

 Score = 92.0 bits (227), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 110/235 (46%), Gaps = 26/235 (11%)

Query: 444 IFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRR 503
           +  +IN  +P G  V + GP G GK+++   L       +G++                 
Sbjct: 624 LLSNINFTIPKGEFVVVTGPVGSGKTSLLFALAGLMEQLSGEM----------------N 667

Query: 504 HIG--LVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIG 561
           H G  L+   P + + TIRDNI +G   P      + V   C   + +   P    T +G
Sbjct: 668 HSGDLLLCGIPWVQNATIRDNILFG--SPYDPTFYKRVLHVCALESDLENLPAHDKTEVG 725

Query: 562 AQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE-SEGAINYTFGQLMKSGSMTI 620
            +G  LSGGQ+ RI++ARA+ K  +I + D+  SA+D       ++Y     +   +  +
Sbjct: 726 ERGVTLSGGQKARISLARAVYKNKDIYLFDDVLSAVDARVGRHIMDYCMNDHLSDKTRIL 785

Query: 621 VSIAHRLSTIKRSENVIVL--GKDGSVIEAGKFKELFANPNSELCKLLTEKSSRS 673
            +  H+LS +++++ +IVL   KD    E G FKEL    NS L  L+   SS+S
Sbjct: 786 AT--HQLSLVEKADRIIVLSTSKDAPHFEIGTFKELIKT-NSTLQSLMQFTSSQS 837

>AGL346W Chr7 (61232..65434) [4203 bp, 1400 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YGR281W (YOR1)
          Length = 1400

 Score =  106 bits (265), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 121/500 (24%), Positives = 220/500 (44%), Gaps = 44/500 (8%)

Query: 183  RLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIG 242
            RL      + L+    F DT  +G +++R   D  V+   +T   +  F   +   VG+ 
Sbjct: 898  RLNLSAAKRILYAPMSFIDTTPMGRILNRFTKDTDVLDNELTDS-TRMFVFQMANVVGVF 956

Query: 243  MM-------VSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQL 295
            ++       V+I+  +S +LL F      SA    K++    +        +     E L
Sbjct: 957  ILSIAYLPYVAIAVPISVLLLLFIGDHYQSAGREVKRLEAIQRSF------VYNNLGEVL 1010

Query: 296  SGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGS 355
             G+ T++++ A+ R L + +  +      G     I A  + + T   D+  I + L  +
Sbjct: 1011 DGLDTIRAYNAQSRFLRKSDYFLNRTNEAGYLV--IGARCWVALTT--DLVAIAIALIVT 1066

Query: 356  YLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTDHI---SSI 412
             L +   + I   +A +L T      V  +  +++ +++G        + T  +   ++ 
Sbjct: 1067 LLCVTRVIHITPSSAGVLLT-----VVLQMPAYFNMVLRGFTELENNMNSTQRVHYYATA 1121

Query: 413  SPTKGQKYIPGKG---------DIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVG 462
             P +  +Y+PG           +I F+ VSF+Y P  P       ++  V  G  + I G
Sbjct: 1122 LPQEAPQYLPGAAPPAGWPAAGEIVFQEVSFAYRPGLP--LALCGVSFHVRAGEKIGICG 1179

Query: 463  PSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDN 522
             +G GK+++   L R     +G I +DG DI+ +    LR  + ++ Q+P+L  GT+R N
Sbjct: 1180 RTGAGKTSVTTALYRLSELESGSIKIDGVDIATLGLHDLRSALSIIPQDPLLFRGTVRKN 1239

Query: 523  ITYGLAEPATKEEIRSVAKQCFCHNFI--TKFPDGYDTMIGAQGALLSGGQRQRIAIARA 580
            +    AE        ++ +       +  T      D  +   GA  S G+RQ +A+ARA
Sbjct: 1240 LD-PFAEHTDGTLWSALVRSGVVPAGVVPTSHKFHLDQEVDEGGANFSLGERQLLALARA 1298

Query: 581  LIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLG 640
            L++   IL+LDEATS++D  ++  +        +    T++ +AHRL TI   + ++VL 
Sbjct: 1299 LVRSTRILILDEATSSVDYATDARVQARIAAEFRQA--TVLCVAHRLRTIISYDRILVLD 1356

Query: 641  KDGSVIEAGKFKELFANPNS 660
            + G V E      LFA  +S
Sbjct: 1357 Q-GRVAEFDTPYRLFARKDS 1375

 Score = 84.3 bits (207), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 58/200 (29%), Positives = 95/200 (47%), Gaps = 17/200 (8%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
             D+   +  G  + ++G  G GK+++   +  Y   T G + V+G   S + C      
Sbjct: 551 LNDLLFSIKKGEFIIVIGAIGTGKTSLLNAVAGYMKKTTGSVHVNG---SLLFCGV---- 603

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
                  P + + TIRDNI +G +   T+ +   V   C        FP G  T +G +G
Sbjct: 604 -------PWIQNATIRDNIIFGSSFDQTRYD--EVVNACALEADFKIFPAGDKTEVGERG 654

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIA 624
             LSGGQ+ RI++ARA+ K  +I + D+  SA+D      I      L +  + T +   
Sbjct: 655 ITLSGGQKARISLARAIYKDRDIYLFDDIISAVDANVAAHITQK-CLLDRLQNRTRILAT 713

Query: 625 HRLSTIKRSENVIVLGKDGS 644
           H+L+ ++ +  VI LG+DGS
Sbjct: 714 HQLALVQEASRVIFLGQDGS 733

>TBLA0C06400 Chr3 complement(1545011..1549144) [4134 bp, 1377 aa] {ON}
            Anc_5.10 YGR281W
          Length = 1377

 Score =  106 bits (265), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 130/526 (24%), Positives = 231/526 (43%), Gaps = 82/526 (15%)

Query: 179  RVVARLRSGVMNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALI--- 235
            R    L    +N+ +H    F ++  +G +++R   D    + S+  ++ D  + ++   
Sbjct: 868  RASKSLNLQAVNRVIHSPMWFMESTPMGRIMNRFTKD----TESLDNQILDNLRFVVYQA 923

Query: 236  CGGVGIGMMVSIS-PELS------GVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLT 288
            C  VGI ++  I  P  +      G++LF A     S++   K++    +        + 
Sbjct: 924  CTIVGISVLCIIYLPWFAIAIPGLGLILFVACSHYQSSAREIKRLEAVQRSF------IY 977

Query: 289  RVAEEQLSGVKTVQSFVAEQRELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLG-DMSF 347
                + L GV T++++ AE+R  ++ +  I            +         ++G   + 
Sbjct: 978  NHLNDVLGGVDTIRAYGAEERFSYKLDYLIDKTNEASYLYTAVQRWINIVINLVGISFTL 1037

Query: 348  IVVLLY----------GSYLVLQGSLTIGDLT----AFMLYTEYTGSSVFGLTTFYSELM 393
            IV LL            + +VL   L I DL       +  TE   +SV  L T+ +EL 
Sbjct: 1038 IVSLLCVTKVFNLSGASTGVVLSYVLLIPDLLNNTLTMVTQTENDMNSVERLVTYATELP 1097

Query: 394  QGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPT-RPENQIFKDINIKV 452
            Q       +           P+K     P  G+I+F+NV +++    P   +     +K+
Sbjct: 1098 QEASHGEEV-----------PSKTW---PENGEIKFENVRYTHRDGLP--AVLDKFTLKI 1141

Query: 453  PPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEP 512
              G  V I G +G GKST+   L R     +G++++D  D+SK+N   LR  + ++ Q+P
Sbjct: 1142 AAGERVGICGRTGAGKSTVLGALYRLREVESGRVMIDDVDVSKLNLTALRSRLAIIPQDP 1201

Query: 513  ILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKF-------PDGYDT-----MI 560
            +L  G++R N+     +P  + +   V K       + KF        +G DT     ++
Sbjct: 1202 VLFQGSVRHNL-----DPFGEYD-DDVLKNALMRCTVGKFNKTGNESTEGIDTDADNGLV 1255

Query: 561  G---------AQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQ 611
            G           G   S G+RQ +A+ARALI+  +ILVLDEAT+A+D  ++  +     +
Sbjct: 1256 GKFRLDQDVEENGCNFSVGERQVLALARALIRNSSILVLDEATAAVDAATDAHVQRLVAE 1315

Query: 612  LMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFAN 657
              K    T++ +AHRL TI   + ++VL ++G +I     K L  N
Sbjct: 1316 AFK--GRTVLCVAHRLDTILNYDRILVL-ENGKIIGLDTPKSLLDN 1358

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 118/448 (26%), Positives = 204/448 (45%), Gaps = 65/448 (14%)

Query: 235 ICGGVGIGMMVSISPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQ 294
           IC G+ I  +  I+  +SGV LFF   I+    +FG  ++    ++ + T Q   +  E 
Sbjct: 314 ICLGLLIKNLGGIA--MSGVGLFFVTIIV-VIFLFGIVMK-MRLNINQVTDQRVSILREV 369

Query: 295 LSGVKTVQSFVAEQRELHRYNGAIRGIYNVGR----KAAFINAEFFTSTTMLGDMSFIVV 350
           L+ +K V+ +  EQ     Y  +I+ I ++      +   +    F+ T  L ++  ++ 
Sbjct: 370 LNNIKMVKLYCWEQA----YEKSIKKIRSLETSKLTRMEILKNVIFSVTFSLPNICSLMT 425

Query: 351 LLYGSYLVLQGSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQG-----VGAASRLFDL 405
            L  +   + G L      A  +++  +   +  L +FY  L  G     V +  R  + 
Sbjct: 426 FL--ALFKIHGGLK----NAATIFSSLSLFKILSLLSFYIPLSLGTAIDIVTSLDRFQEF 479

Query: 406 TDHISS-----ISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQI-------FKDINIKVP 453
            +   S     I  T  + Y      I+  + SF + T  ++         F D+N ++ 
Sbjct: 480 LEAEESKETRIIRETNSEIYGDNTVAIKASHCSFRWDTEEKDNNEEKEFSGFHDLNFEIM 539

Query: 454 PGSNVCIVGPSGRGKST----IALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQ 509
            G  + IVGP G GK++    I  L+ +Y N   G++ VDG   S V+C           
Sbjct: 540 KGELIIIVGPIGSGKTSLLNAICGLMPQYGNE--GELEVDG---SLVSCGY--------- 585

Query: 510 QEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYD-TMIGAQGALLS 568
             P + + T+RDNI +G     +K   + V + C     + K    YD T IG +G  LS
Sbjct: 586 --PWIQNTTVRDNILFGSKYDESK--FKRVIRMCSLEEDLEKLS-AYDMTEIGERGVTLS 640

Query: 569 GGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG--SMTIVSIAHR 626
           GGQ+ RI +AR+L K+ +I + D+  SA+D     +I     + +  G  + T V   H+
Sbjct: 641 GGQKSRINLARSLYKEKDIYLFDDILSAVDSRVGQSI---MKECLMEGLKNKTRVLATHQ 697

Query: 627 LSTIKRSENVIVLGKDGSVIEAGKFKEL 654
           LS I +++ +IVLG DG   + G++++L
Sbjct: 698 LSLIGKADQLIVLGNDGK-FDMGRYEDL 724

>Ecym_5660 Chr5 complement(1331316..1335926) [4611 bp, 1536 aa] {ON}
           similar to Ashbya gossypii AGL346W
          Length = 1536

 Score = 94.0 bits (232), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 115/241 (47%), Gaps = 32/241 (13%)

Query: 445 FKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           F D++ +V  G  + I G  G GK+++   L  + + TNG I  +G+             
Sbjct: 590 FSDLSFEVKKGELLVITGAIGTGKTSLLNALAGFMHKTNGDIQYNGR------------- 636

Query: 505 IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQG 564
             L    P + + TIRDNIT+G   P  +   R V + C     ++  P G  T +G +G
Sbjct: 637 -MLFCGAPWIQNATIRDNITFG--SPYDENLYREVMRVCSLDRDMSVLPAGDKTEVGERG 693

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAI--NYTFGQLMKSGSMTIVS 622
             LSGGQ+ RI +AR + K  +I + D+  SA+D     +I  +   G+L   G  T + 
Sbjct: 694 ITLSGGQKARINLARCVYKVRDIYLFDDILSAVDARVGASIMNDCLLGKL---GDKTRIL 750

Query: 623 IAHRLSTIKRSENVIVLGKDGSVIEAGKFKEL------FANPNSELCKLLTEKSSRSDGN 676
             H++S  +++  VI LG DGS  + G   EL      FAN    L KL ++  S S  +
Sbjct: 751 ATHQISLTEQASRVIYLGTDGS-FDIGTVDELKTRNVQFAN----LMKLASQTESESKDD 805

Query: 677 D 677
           +
Sbjct: 806 N 806

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 80/356 (22%), Positives = 151/356 (42%), Gaps = 40/356 (11%)

Query: 189  MNKTLHQDSEFYDTHKVGDLISRLGSDAYVVSRSMTQKVSD-GFKALICGGVGIGMMVSI 247
            +++ LH    F DT  +G +++R   D  ++   +T+ +    ++  +  GV I M +  
Sbjct: 959  LHRLLHVPVSFIDTTPLGRILNRFTKDTDILDNELTESLRMFSYQFTVIWGVII-MSIIY 1017

Query: 248  SPELSGVLLFFAPPILWSASVFGKKIRHTSKDLQEATGQLTRVAEEQLSGVKTVQSFVAE 307
             P  +  +       +  +  +    R   +        +     E +SGV T++++ AE
Sbjct: 1018 LPWFAVAVPLLVVVFILVSDHYQCSAREIKRLEAVQRSFVLNNFNEVISGVDTIKAYHAE 1077

Query: 308  QRELH-------RYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQ 360
             R L        R N     +Y   R  +           ++G ++ +  L+  S L + 
Sbjct: 1078 ARFLKKSDILIDRMNEMTFPLYASQRWVSI----------LIGMIAVLFALII-SILCVT 1126

Query: 361  GSLTIGDLTAFMLYTEYTGSSVFGLTTFYSELMQGV-------GAASRLFDLTDHISSIS 413
            G   I   +  +L T      V  L   ++ L++ +        +A R+    + +   +
Sbjct: 1127 GWFNISPASTGVLLT-----YVLQLPNLFNTLLRAMTQLENDMNSAERVLSYANSLPKEA 1181

Query: 414  PTK-----GQKYIPGKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRG 467
            P +       K  P +G I F NV+ +Y P  P   + +D++  +  G  + I G +G G
Sbjct: 1182 PYRIPEMAPPKAWPERGAITFDNVALAYRPGLP--LVLQDVSFHISSGEKIGICGRTGAG 1239

Query: 468  KSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNI 523
            KSTI   L R    +NG + +DG DI+ +    LR  + ++ Q+P+L  GTIR N+
Sbjct: 1240 KSTITNALYRLVELSNGSVTIDGVDIATIGLYNLRSKLSIIPQDPLLFRGTIRKNL 1295

 Score = 64.7 bits (156), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 56/91 (61%), Gaps = 3/91 (3%)

Query: 557  DTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG 616
            D  +   G+  S G+RQ +A+ARAL+++  IL+LDEATS++D E++  I     Q  +  
Sbjct: 1418 DQTVEEDGSNFSVGERQFLALARALVRQTKILILDEATSSVDYETDAQIQARIVQEFQHA 1477

Query: 617  SMTIVSIAHRLSTIKRSENVIVLGKDGSVIE 647
              TI+ +AHRL TI   + ++V+ K G V E
Sbjct: 1478 --TIMCVAHRLKTILHYDRILVMEK-GRVAE 1505

>YKR103W Chr11 (653080..656736) [3657 bp, 1218 aa] {ON}
           NFT1Putative transporter of the multidrug
           resistance-associated protein (MRP) subfamily; adjacent
           ORFs YKR103W and YKR104W are merged in different strain
           backgrounds.
          Length = 1218

 Score = 85.5 bits (210), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 91/312 (29%), Positives = 140/312 (44%), Gaps = 38/312 (12%)

Query: 429 FKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLL--------RYYN 480
           F++ S  +     +   K+I+I     S   I+GP+G GKS++ L LL        + Y 
Sbjct: 653 FEDASMEWEAAETSFKLKNISIDFKLNSLNAIIGPTGSGKSSLLLGLLGELNLLSGKIYV 712

Query: 481 PTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVA 540
           PT     V+ +D  ++    +   +    Q P L+SGTI+DN+ +G  E   K++   V 
Sbjct: 713 PT-----VESRDDLEIGKDGMTNSMAYCSQTPWLISGTIKDNVVFG--EIFNKQKFDDVM 765

Query: 541 KQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVE 600
           K C     I     G  T +G  G  LSGGQ+QRIA+ARA+      L+LD+  SA+D E
Sbjct: 766 KSCCLDKDIKAMTAGIRTDVGDGGFSLSGGQQQRIALARAIYSSSRYLILDDCLSAVDPE 825

Query: 601 SEGAI--NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANP 658
           +   I      G +MK  +  I S  H +S + +  + +V+   G V   GK  +L  + 
Sbjct: 826 TALYIYEECLCGPMMKGRTCIITS--HNISLVTKRADWLVILDRGEVKSQGKPSDLIKS- 882

Query: 659 NSELCKLLTEKSSRSDGNDSLPPPPPNATQDKV---VEQIAEKILERFPEAGQSPDATVK 715
                    E    S  NDS      N T +++       ++K     PE G S D    
Sbjct: 883 --------NEFLRESINNDS-----KNTTHNQIDLKRSTTSKKTKNGDPEGGNSQDEVCA 929

Query: 716 EI--FKDVSSEG 725
           E+  F++   EG
Sbjct: 930 EVENFEETKMEG 941

>ZYRO0A04114g Chr1 complement(328582..333138) [4557 bp, 1518 aa] {ON}
            similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011W SNQ2 ABC transporter
          Length = 1518

 Score = 78.2 bits (191), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 70/267 (26%), Positives = 130/267 (48%), Gaps = 22/267 (8%)

Query: 404  DLTDHISS---ISPTKGQ------KYIPGKGDIEFKNVSFSYPTRP-ENQIFKDINIKVP 453
            D+ D  SS   I+P   Q      K    KG   +KN+ +  P +  E  +  ++   V 
Sbjct: 840  DVKDKYSSGSDITPNNDQEIEQSFKDFASKGIFIWKNICYVIPYKGGERTLLDNVTGYVA 899

Query: 454  PGSNVCIVGPSGRGKSTIALLLLRYYNP--TNGQILVDGQDISKVNCKTLRRHIGLVQQE 511
            PG+   ++G SG GK+T+   L +  N     G +L++G+ +      +  R  G VQQ+
Sbjct: 900  PGTMTALMGESGAGKTTLLNTLAKRVNVGVVTGDMLINGKPVDS----SFERRTGYVQQQ 955

Query: 512  PILMSG-TIRDNITYG--LAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLS 568
             I ++  T+R+++ +   L  P +  +   VA        +    +  D ++G  GA L+
Sbjct: 956  DIHIAEMTVRESLIFSARLRRPQSIPDAEKVADAETVMKLL-DMEEYADALVGGLGAGLN 1014

Query: 569  GGQRQRIAIARALIKKPNILV-LDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRL 627
              QR++++I   L+ KP++L+ LDE TS LD +S  AI     ++ ++G   + +I    
Sbjct: 1015 VEQRKKLSIGVELVSKPDLLLFLDEPTSGLDSQSSWAIVQLLKRISRAGQSILCTIHQPS 1074

Query: 628  STI-KRSENVIVLGKDGSVIEAGKFKE 653
            +T+ ++ + +++L K G  +  G   E
Sbjct: 1075 ATLFEQFDRLLLLKKGGQTVYFGDIGE 1101

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 51/226 (22%), Positives = 97/226 (42%), Gaps = 22/226 (9%)

Query: 439 RPENQIFKDINIKVPPGSNVCIVGPSGRGKS----TIALLLLRYYNPTNGQILVDG--QD 492
           R   +I +++N    PG  V ++G  G G S    T A +  ++     G I+ DG  QD
Sbjct: 177 RRMRKIIRNVNAFALPGEMVLVLGRPGSGCSSFLKTAAGVTDQFAGGVEGDIMYDGVPQD 236

Query: 493 ISKVNCKTLRRHIG-LVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCF------C 545
               + ++   + G L    P L   T++  + + +A       + +V++  +       
Sbjct: 237 TMMKHYRSDVIYNGELDVHFPYL---TVKQTLDFAIACKTPAIRVNNVSRSEYIRETRDL 293

Query: 546 HNFITKFPDGYDTMIGAQGAL-LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGA 604
           +  I      YDT +G      +SGG+R+R++IA AL  +      D AT  LD  +  A
Sbjct: 294 YATIFGLTHTYDTKVGNDFVRGVSGGERKRVSIAEALAARGTFYCWDNATRGLDAST--A 351

Query: 605 INYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGK 650
           + Y     + +  +   +    ++  + SEN+       +V+ +G+
Sbjct: 352 LEYAMAIRIMTNLLNSTAF---VTIYQASENIYETFDKVTVLHSGR 394

>KAFR0C00820 Chr3 (157878..162431) [4554 bp, 1517 aa] {ON} 
          Length = 1517

 Score = 77.0 bits (188), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 152/324 (46%), Gaps = 29/324 (8%)

Query: 421  IPGKGDIEFKNVSFSYPTRPENQIFKD-INIKVPPGSNVCIVGPSGRGKSTI-ALLLLRY 478
            +  KG   +K+V ++ P     ++  D ++    PG+   ++G SG GK+T+   L  R 
Sbjct: 858  LESKGVFIWKDVCYTIPYDGGQRMLLDHVSGFCKPGTLTALMGESGAGKTTLLNTLAQRN 917

Query: 479  YNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSG-TIRDNITYG--LAEPAT--- 532
                 G +LV+G  I      +  R  G VQQ+ I +S  T+R+++ +   +  P +   
Sbjct: 918  VGIITGDMLVNGHPIDT----SFERRTGYVQQQDIHISELTVRESLQFSARMRRPQSVTD 973

Query: 533  KEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LD 591
            KE++  V K    H  +    D  + ++G  G+ L+  QR++++I   L+ KP++L+ LD
Sbjct: 974  KEKMTYVEK--IIH--VLDMEDYAEALVGTVGSGLNVEQRKKLSIGVELVAKPDLLLFLD 1029

Query: 592  EATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTI-KRSENVIVLGKDGSVIEAGK 650
            E TS LD +S  AI     +L  SG   + +I    +T+ ++ + +++L K G  +  G 
Sbjct: 1030 EPTSGLDSQSSWAIVQLLKKLAHSGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGN 1089

Query: 651  FKELFANPNSELCKLLTEKSSRSDGNDSLPPPPP-----NATQDKVVEQIAEKILERFPE 705
              E     NS L     E++     + S  P         A     V++   +I    PE
Sbjct: 1090 IGE-----NSSLLLDYFERNGARQCSSSENPAEYILEAIGAGATATVKEDWNEIWRNSPE 1144

Query: 706  AGQSPDATVKEIFKDVSSEGKPIK 729
            +  S +  + E+ +++S E  P K
Sbjct: 1145 SRNSQNE-ITELIENLSKEVDPSK 1167

 Score = 38.1 bits (87), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 68/146 (46%), Gaps = 12/146 (8%)

Query: 518 TIRDNITYGLAEPATKEEIRSVAKQCFCHN----FITKF--PDGYDTMIGAQGAL-LSGG 570
           T++  + + +A       + +V+++ +  +    F T F     Y T +G      +SGG
Sbjct: 262 TVQQTLDFAIACKTPSTRVNNVSRKEYIESRRDLFATIFGLTHTYHTKVGNDFVRGVSGG 321

Query: 571 QRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFG-QLMKS--GSMTIVSIAHRL 627
           +R+R++IA AL    ++ + D AT  LD  +  A+ Y    ++M +  GS   V+I    
Sbjct: 322 ERKRVSIAEALAANGSVYLWDNATRGLDAST--ALEYAKAIRIMTNLLGSTAFVTIYQAS 379

Query: 628 STIKRSENVIVLGKDGSVIEAGKFKE 653
             I  + + + +   G  I  GK ++
Sbjct: 380 ENIYETFDKVTVLHSGRQIYFGKIED 405

>Kpol_175.1 s175 complement(1..4131) [4131 bp, 1377 aa] {ON}
           complement(1..4131) [4131 nt, 1377 aa]
          Length = 1377

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 70/274 (25%), Positives = 125/274 (45%), Gaps = 22/274 (8%)

Query: 429 FKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILV 488
           F   +  +    +  I +++N+K        + GP+G GKS + + LL   +   G+I V
Sbjct: 693 FSGATIGWSINNKGFILENLNVKFKSKKLNVVAGPTGAGKSLLLMSLLGETHLFKGEIHV 752

Query: 489 ---DGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFC 545
                +    ++   L   I    Q P +++ +I++NI +G       +    V + C  
Sbjct: 753 PSLASKHELMIHGDGLTNSISYCSQIPWIINDSIKNNILFG--SEFNLKRYNDVIRACCL 810

Query: 546 HNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAI 605
            N +    DG ++++G +G  LSGGQRQR+++ARA+  K   ++LD+  SA+D +    I
Sbjct: 811 TNDLRLLQDGDNSIVGDRGQNLSGGQRQRVSLARAIYSKSMHIILDDCLSAVDSKCAKDI 870

Query: 606 NYTF---GQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNSEL 662
            Y     G LMK  +  +VS    L  IK++  +++L    +          +  P  +L
Sbjct: 871 -YDLCLTGPLMKGRTCILVSHNVEL-VIKKAAYLLILDNRTTA---------YKGPPGDL 919

Query: 663 C--KLLTEKSSRSDGNDSLPPPPPNATQDKVVEQ 694
              K L ++  + D N+ L    PN     VV +
Sbjct: 920 LKDKALRQRYCKFDFNE-LNENCPNQCTTSVVHK 952

 Score = 45.1 bits (105), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 58/287 (20%), Positives = 117/287 (40%), Gaps = 34/287 (11%)

Query: 199  FYDTHKVGDLISRLGSDAYVVSRSMTQKVSDGFKALICGGVGIGMMVSISPELSGVLLFF 258
            F++   +G +++    D   +   ++  +   F   +   + + ++  ++P      +F 
Sbjct: 1108 FFEKTPIGSIMNNFSKDIRSLDFELSPFIEGTFSCTLQTLMSLILITYVNPNF----IFP 1163

Query: 259  APPILWSASVFGKKIRHTSKDLQE----ATGQLTRVAEEQLSGVKTVQSFVAEQR----- 309
            A  I       G      S++L+         + +   E L+G+ ++++F  E R     
Sbjct: 1164 AIFIFLFCCFIGHSYLCCSRELKRYESITKTPIYQHFSESLAGLVSIRAFGDELRFIKVI 1223

Query: 310  --ELHRYNGAIRGIYNVGRKAAFINAEFFTSTTMLGDMSFIVVLLYGSYLVLQGSLTIGD 367
               +  YN +   ++      +F   E   S T+L    F   LL  + +V  G   I  
Sbjct: 1224 FTRVDEYNKSFFYLWEANNWLSF-RIELIGSITILATGLF---LLSNANMVDSGLAGIT- 1278

Query: 368  LTAFMLYTEYTGSSVFGLTTFYSELMQGVGAASRLFDLTD-----HISSISPTKGQKYIP 422
             T  + +TE    S   +  FY+ +   + +  RL++ T+     +   I+    Q   P
Sbjct: 1279 FTYAIAFTE----SALWMIKFYATMEMNMNSVERLYEYTNLEQEPYSRCITNVDNQW--P 1332

Query: 423  GKGDIEFKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGK 468
              GDI+FKNV+  Y P  P  ++ +D+   +     + +VG +G GK
Sbjct: 1333 NSGDIKFKNVTLRYSPELP--KVLQDVTFVIGDKEKIGVVGRTGAGK 1377

>ACR128C Chr3 complement(573251..575734) [2484 bp, 827 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL147W
           (PXA1)
          Length = 827

 Score = 75.1 bits (183), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 59/192 (30%), Positives = 96/192 (50%), Gaps = 21/192 (10%)

Query: 454 PGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPI 513
           PGS++ I+GP+  GKS+I  +L   +   N   LV     S + C        + Q+   
Sbjct: 597 PGSSLLILGPNSCGKSSIQRILAEIWPIYNKTGLVSIPAESDLMC--------IAQRPYF 648

Query: 514 LMSGTIRDNITYGLA-----EPATKE-EIRSVAKQCFCHNFITKFPDG--YDTMIGAQGA 565
           +  GT RD I Y ++     E   K+ E+  + K+    +++ K  +G  Y   +     
Sbjct: 649 IQGGTFRDQIIYPMSVDRFYEKGHKDRELVRILKEVKL-DYLLKRSEGLSYLDFVADWKD 707

Query: 566 LLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625
           +LSGG++QR+  AR +  +P  LVLDEAT+A+ V+ E   +Y F  L K      +SI+ 
Sbjct: 708 ILSGGEKQRMNFARIMFHRPKFLVLDEATNAISVDME---DYLFNMLRKC-RFNFISISQ 763

Query: 626 RLSTIKRSENVI 637
           R S IK  + ++
Sbjct: 764 RPSLIKYHDYLL 775

>NCAS0E01630 Chr5 complement(308563..313260) [4698 bp, 1565 aa] {ON} 
          Length = 1565

 Score = 75.5 bits (184), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 79/309 (25%), Positives = 141/309 (45%), Gaps = 35/309 (11%)

Query: 421  IPGKGDIEFKNVSFSYP-TRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRY- 478
            +  KG   +K V ++ P  R +  +   ++    PG+   ++G SG GK+T+   L +  
Sbjct: 906  LESKGVFLWKEVCYTIPYERGKRMLLDHVSGYCVPGTLTALMGESGAGKTTLLNTLAKRN 965

Query: 479  -YNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSG-TIRDNITYGLAEPATKEEI 536
                  G +LV+G+ +      +  R  G VQQ+ I ++  T+R+++ +  A     E +
Sbjct: 966  EIGVVTGDMLVNGRPVDA----SFERRTGYVQQQDIHIAELTVRESLQFS-ARMRRSEHV 1020

Query: 537  RSVAKQCFCHNFI--TKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEA 593
                K  +    I   +  +  D ++GA G  L+  QR++++I   L+ KP++L+ LDE 
Sbjct: 1021 SDEEKLAYVEKIIRVLEMEEFADALVGAIGCGLNVEQRKKLSIGVELVAKPDLLLFLDEP 1080

Query: 594  TSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTI-KRSENVIVLGKDGSVIEAGKFK 652
            TS LD +S  AI     +L ++G   + +I    +T+ ++ + +++L K G  +  G   
Sbjct: 1081 TSGLDSQSSWAIVQLLRKLAQAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDIG 1140

Query: 653  ELFANPNSELCKLLTEKSSRSDGNDSLPPPPPNATQDKVVEQIAEKILERFPEAGQSPDA 712
            E     NSE+     EKS     +    P              AE ILE     G    A
Sbjct: 1141 E-----NSEILLKYFEKSGARKCDRKENP--------------AEYILEAI---GAGATA 1178

Query: 713  TVKEIFKDV 721
            +VKE +  +
Sbjct: 1179 SVKEDWHQI 1187

 Score = 39.3 bits (90), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 52/238 (21%), Positives = 103/238 (43%), Gaps = 34/238 (14%)

Query: 439 RPENQIFKDINIKVPPGSNVCIVGPSGRGKST----IALLLLRYYNPTNGQILVDGQDIS 494
           R   +I ++      PG  + ++G  G G S+    IA  + ++     G+I  DG    
Sbjct: 228 RKWRKIIQNSYALAKPGEMILVLGRPGAGCSSFLKVIAGEIDQFPGGVKGEITYDG---- 283

Query: 495 KVNCKTLRRHIGLVQQEPILMSG---------TIRDNITYGLAEPATKEEIRSVAKQCFC 545
            +  K + +H     +  ++ +G         T++  + + LA     + + ++++  + 
Sbjct: 284 -IPQKEMMKHY----KSDVIYNGELDVHFPHLTVQQTLDFALACKTPAKRVNNISRDEYI 338

Query: 546 HN----FITKF--PDGYDTMIGAQGAL-LSGGQRQRIAIARALIKKPNILVLDEATSALD 598
            +    + T F     Y+T +G      +SGG+R+R++IA AL    +I   D AT  LD
Sbjct: 339 KSSRELYATIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAANGSIYCWDNATRGLD 398

Query: 599 VESEGAINYTFG-QLMKS--GSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKE 653
             +  A+ Y    ++M +  GS   V+I      I  + + + +   G  I  GK ++
Sbjct: 399 AST--ALEYAKAIRIMTNLLGSTAFVTIYQASENIYETFDKVTVLAKGRQIYFGKIED 454

>KLTH0D10890g Chr4 complement(891012..893504) [2493 bp, 830 aa] {ON}
           similar to uniprot|P41909 Saccharomyces cerevisiae
           YPL147W PXA1 Pxa1p and Pxa2p appear to be subunits of a
           peroxisomal ATP-binding cassette transporter necessary
           for transport of long-chain fatty acids into peroxisomes
           ABC family long-chain fatty acid transporter
          Length = 830

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 57/200 (28%), Positives = 99/200 (49%), Gaps = 23/200 (11%)

Query: 454 PGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPI 513
           PGS++ I+GP+G GK++I  ++   +   N   L+     S + C         V Q+P 
Sbjct: 599 PGSSMLILGPNGSGKTSIQRIIAEIWPIYNKNGLLSIPPASDLFC---------VPQKPY 649

Query: 514 LMSG-TIRDNITYGLAEPAT------KEEIRSVAKQCFCHNFITKFPDGYDTM--IGAQG 564
            + G T R+ I Y ++           +E+  +  +    +++ K   G+  +  +    
Sbjct: 650 FIQGGTFREQIIYPMSADQYFDMGYRDKELTHILGEVKL-DYLLKRDKGWRYLDAVAEWK 708

Query: 565 ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIA 624
            +LSGG+RQRI  AR +  KP  +VLDEAT+A+  + E   +Y FG L+K      ++I+
Sbjct: 709 DVLSGGERQRINFARIMFHKPRFVVLDEATNAISADME---DYLFG-LLKRYRFNFITIS 764

Query: 625 HRLSTIKRSENVIVLGKDGS 644
            R S IK  +  + +  DG+
Sbjct: 765 QRPSLIKYHDLALDISTDGT 784

>SAKL0C11616g Chr3 complement(1041794..1046248) [4455 bp, 1484 aa]
            {ON} highly similar to uniprot|P32568 Saccharomyces
            cerevisiae YDR011W SNQ2 ABC transporter
          Length = 1484

 Score = 74.3 bits (181), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 82/323 (25%), Positives = 146/323 (45%), Gaps = 27/323 (8%)

Query: 421  IPGKGDIEFKNVSFSYPTRP-ENQIFKDINIKVPPGSNVCIVGPSGRGKSTIA-LLLLRY 478
            +  +G   +K+V ++ P +  + Q+  +I+    PG+   ++G SG GK+T+   L  R 
Sbjct: 831  LQSEGVFLWKDVCYTIPFKGGQRQLLDNISGYCAPGTLTALMGESGAGKTTLLNTLAQRN 890

Query: 479  YNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPI-LMSGTIRDNITYGLAEPATKEEIR 537
                 G +LV+G  I      +  R  G VQQ+ I +   T+R+++ +  A     E I 
Sbjct: 891  VGIITGDMLVNGSPIDA----SFERRTGYVQQQDIHIKEMTVRESLQFS-ARMRRPESIP 945

Query: 538  SVAKQCFCHNFIT--KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEAT 594
               K  +    I      +  D ++G  G  L+  QR++++I   L  KPN+L+ LDE T
Sbjct: 946  DSEKMSYVEKLIEILGMQEYADALVGDVGYGLNVEQRKKLSIGVELAAKPNLLLFLDEPT 1005

Query: 595  SALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTI-KRSENVIVLGKDGSVIEAGKFKE 653
            S LD ++  AI     +L ++G   + +I    +T+ ++ + +++L K G  +  G   E
Sbjct: 1006 SGLDSQASWAIVQLLKKLAQAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGPIGE 1065

Query: 654  LFANPNSELCKLLTEKSSRSDGNDSLPPPP-------PNATQD-KVVEQIAEKILERFPE 705
                 +S +     E++      DS  P           AT   K    +  K    F E
Sbjct: 1066 -----HSRVLLDYFERNGARQCEDSENPAEYILESIGAGATASVKEDWHLKWKASPEFQE 1120

Query: 706  AGQSPDATVKEIF--KDVSSEGK 726
                 +A +KE+F  +D + +GK
Sbjct: 1121 TNTQVEAYIKELFGKRDPADDGK 1143

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 50/229 (21%), Positives = 96/229 (41%), Gaps = 33/229 (14%)

Query: 443 QIFKDINIKVPPGSNVCIVGPSGRGKSTIALLL---LRYYNPTNGQILVDG---QDISKV 496
           +I + +N+   PG  + ++G  G G S+    +   +  +    G I  DG   +D+ K 
Sbjct: 159 KIIQGVNLLALPGEMILVLGRPGAGCSSFLKTISGEVDQFPEVTGDISYDGIPQKDMMKK 218

Query: 497 NCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGY 556
               +  +  +    P L   T++  + + LA       + + +++     +I    + Y
Sbjct: 219 YKPDVIYNGEMDVHFPHL---TVKQTLDFALACKVPSVRVNNASRK----QYIASMRELY 271

Query: 557 DTMIGAQGAL-----------LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAI 605
            T+ G +              +SGG+R+R++IA AL  + +I   D AT  LD  +  A+
Sbjct: 272 ATIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDAST--AL 329

Query: 606 NYT-----FGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAG 649
            Y         L+KS ++  V+I      I  + + + +  DG  I  G
Sbjct: 330 EYAQAIRIMTNLLKSTAL--VTIYQASENIYETFDKVTVLYDGRQIYFG 376

>SAKL0D10208g Chr4 complement(855378..857636) [2259 bp, 752 aa] {ON}
           highly similar to uniprot|P43535 Saccharomyces
           cerevisiae YFR009W GCN20 Positive regulator of the Gcn2p
           kinase activity forms a complex with Gcn1p proposed to
           stimulate Gcn2p activation by an uncharged tRNA
          Length = 752

 Score = 73.9 bits (180), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 106/237 (44%), Gaps = 50/237 (21%)

Query: 427 IEFKNVSFSYPTRPENQ-IFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQ 485
           I+ ++VSF Y    EN  + KD+N+ V   S + +VG +G GK+T+  +++    PT G 
Sbjct: 532 IQLQDVSFGYE---ENSPLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTKGY 588

Query: 486 ILVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFC 545
           +            +  R  IG   Q  +       D++           ++ + A     
Sbjct: 589 V-----------SRNPRLRIGYFTQHHV-------DSM-----------DLNTSAVDWMS 619

Query: 546 HNFITKFPDGYDTMIGAQG----------ALLSGGQRQRIAIARALIKKPNILVLDEATS 595
             F  K  + Y   +GA G           LLSGGQ+ R+A A   +  P+ILVLDE ++
Sbjct: 620 KTFPGKTDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSN 679

Query: 596 ALDVESEGAI-----NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIE 647
            LD     A+     N+T G LM S  +++  I H  S I  SE+  V   DG++ +
Sbjct: 680 HLDTAGLDALIDALKNFTGGVLMVSHDISV--IDHVCSEIWVSEDGTVKRFDGTIYD 734

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 567 LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625
            SGG R R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATVLVVSH 422

>ZYRO0D11858g Chr4 (998646..1003157) [4512 bp, 1503 aa] {ON} highly
            similar to gnl|GLV|CAGL0M01760g Candida glabrata
            CAGL0M01760g and similar to YOR153W uniprot|P33302
            Saccharomyces cerevisiae YOR153W PDR5 Short- lived
            membrane ABC (ATP-binding cassette) transporter actively
            exports various drugs expression regulated by Pdr1p also
            involved in steroid transport cation resistance and
            cellular detoxification during exponential growth
          Length = 1503

 Score = 73.9 bits (180), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 81/311 (26%), Positives = 144/311 (46%), Gaps = 40/311 (12%)

Query: 394  QGVGAASRLFDLTDHI----SSISPTKGQK---YIPGKGDIEFKNVSFSYPTRPENQ-IF 445
            + +GA +   DLTD      SS S  +GQ+       +    ++N+ +    + E + I 
Sbjct: 810  KAIGANAN--DLTDATLIKDSSDSMDEGQEQTGLTKSEAIFHWRNLCYDVQIKSETRRIL 867

Query: 446  KDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYN--PTNGQILVDGQDISKVNCKTLRR 503
             +++  V PG+   ++G SG GK+T+   L          G I V+G    K+  ++  R
Sbjct: 868  NNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVITGDIFVNG----KLRDESFPR 923

Query: 504  HIGLVQQEPI-LMSGTIRDNITYG--LAEPAT--KEEIRSVAKQCFCHNFITKFPDGYDT 558
             IG  QQ+ + L + T+R+++ +   L +P +    E R   ++      I +     D 
Sbjct: 924  SIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKRKYVEEVIK---ILEMEPYADA 980

Query: 559  MIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEATSALDVESEGAINYTFGQLMKSGS 617
            ++G  G  L+  QR+R+ I   L+ KP +LV LDE TS LD ++  +I     +L   G 
Sbjct: 981  IVGVAGEGLNVEQRKRLTIGVELVAKPKLLVFLDEPTSGLDSQTAWSICQLMKKLSNHGQ 1040

Query: 618  MTIVSIAHRLST--IKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDG 675
              + +I H+ S   ++  + ++ L K G  +  G+          E CK++ +   R+  
Sbjct: 1041 AILCTI-HQPSAMLMQEFDRLLFLQKGGKTVYFGEL--------GEGCKVMIDYFERNGA 1091

Query: 676  NDSLPPPPPNA 686
            N    P PP+A
Sbjct: 1092 N----PCPPDA 1098

 Score = 33.1 bits (74), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 52/216 (24%), Positives = 92/216 (42%), Gaps = 27/216 (12%)

Query: 408 HISSISPTKGQKYIPGKGDIEFKNVSFSY----PTRPEN--QIFKDINIKVPPGSNVCIV 461
           ++S+I  +    Y     ++ +K +S+ Y    PT+  N  QI K ++  V P   + ++
Sbjct: 109 NLSAIGASVDVAYQTTVDNLPWKFLSWVYRSLAPTKASNSFQILKPMDGIVKPSELLVVL 168

Query: 462 GPSGRGKSTIALLLLRYYNPTNGQILVDGQDISK--VNCKTLRRHI-GLVQQEP----IL 514
           G  G G +T   LL    + T+G  + +   IS   ++ K + +H  G V   P     L
Sbjct: 169 GRPGSGCTT---LLKSISSNTHGFKITEDSTISYSGLSPKDINKHFRGEVVYNPEADIHL 225

Query: 515 MSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGY------DTMIGAQGALL- 567
              T+ + +         +  IR V ++ +  +        Y      +T +G  G L+ 
Sbjct: 226 PHLTVYETLVTVARLKTAQNRIRGVDRESWARHITEVAMATYGLSHTRNTKVG--GDLVR 283

Query: 568 --SGGQRQRIAIARALIKKPNILVLDEATSALDVES 601
             SGG+R+R++IA   I        D AT  LD  +
Sbjct: 284 GVSGGERKRVSIAEVTICGSKFQCWDNATRGLDAAT 319

>SAKL0H21010g Chr8 (1835185..1839528) [4344 bp, 1447 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1447

 Score = 73.6 bits (179), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 121/238 (50%), Gaps = 15/238 (6%)

Query: 421  IPGKGDIEFKNVSFSYPTR-PENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYY 479
            +  KG   +K+V +  P +  E ++   ++  V PG    ++G SG GK+T+  +L +  
Sbjct: 796  LKSKGVFMWKDVDYVIPYKGSEKKLLDKVSGFVKPGL-TALMGASGAGKTTLLNVLAQRM 854

Query: 480  N---PTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSG-TIRDNITYGLAEPATKEE 535
            +    ++G+ILVD + + +      +R +G VQQ+ I     T+R+++ +  A     + 
Sbjct: 855  DFGIVSSGEILVDAKPVDR----KFKRSVGYVQQQDIHTQELTVRESLQFS-ARLRRPDS 909

Query: 536  IRSVAKQCFCHNFIT--KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDE 592
            +    K  +    I      D  D ++G  G  L+  QR++++I   L+ KP +L+ LDE
Sbjct: 910  VPDAEKMEYVEKIIVVLGMQDYSDAVVGEAGFGLNVEQRKKLSIGVELVAKPTLLLFLDE 969

Query: 593  ATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKD-GSVIEAG 649
             TS LD +S  AI     +L ++G   + +I    +T+  S + ++L KD GSV+  G
Sbjct: 970  PTSGLDSQSSWAILQLLRRLAEAGQAILCTIHQPSATLFESFDRLLLLKDGGSVVYWG 1027

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 64/272 (23%), Positives = 111/272 (40%), Gaps = 47/272 (17%)

Query: 441 ENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLL---LRYYNPTNGQILVDGQDISKVN 497
           + +I   IN  + PG    ++G  G G S+    +   L  +   +G+I  DG     + 
Sbjct: 115 KRKILSQINFLIKPGEMCLVLGRPGAGCSSFLRTVAGELGNFTDVDGEISYDG-----IP 169

Query: 498 CKTLRRHIGLVQQEPILMSG---------TIRDNITYGLA--EPATKEEIRSVAKQCFCH 546
            K + +H     +  I+ +G         T+   +   +A  EP +  + +   KQ    
Sbjct: 170 QKEMIKHF----KGDIIYNGEMDVHFPHLTVSQTLEMAIACKEPHSLSDEKIPKKQHIHG 225

Query: 547 NF-----ITKFPDGYDTMIGAQGAL-LSGGQRQRIAIARALIKKPNILVLDEATSALDVE 600
           N      I      ++T +G      +SGG+R+R++IA A+  + ++   D ++  LD  
Sbjct: 226 NRDLYAGIFHLTHTFNTKVGNDFVRGVSGGERKRVSIAEAMAARGSVYCWDNSSRGLD-- 283

Query: 601 SEGAINY-----TFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAG---KFK 652
           S  A +Y     T   L+K  S+  V+I      I R  + + +  DG  I  G   K K
Sbjct: 284 SSSAYDYIKAIRTVSDLIK--SVAFVAIYQAGENIYRKFDKVTVLYDGRQIYYGTINKAK 341

Query: 653 ELF------ANPNSELCKLLTEKSSRSDGNDS 678
             F      ++P     + LT  + R D  DS
Sbjct: 342 PYFERMGFQSSPRQTTPEFLTAITQRIDSEDS 373

>ZYRO0B14762g Chr2 (1201028..1205575) [4548 bp, 1515 aa] {ON} similar
            to uniprot|P32568 Saccharomyces cerevisiae YDR011W SNQ2
            ABC transporter
          Length = 1515

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/316 (24%), Positives = 145/316 (45%), Gaps = 35/316 (11%)

Query: 424  KGDIEFKNVSFSYPTRPENQIFKD-INIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNP- 481
            KG   +++V +  P +   +I  D +   V PG+   ++G SG GK+T+   L +  N  
Sbjct: 866  KGVFIWQDVRYVIPYQGTEKILLDNVTGYVAPGTMTALMGESGAGKTTLLNTLAKRANVG 925

Query: 482  -TNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSG-TIRDNITYG--LAEPATKEEIR 537
               G + ++G+ +      +  R  G VQQ+ I ++  T+R+++ +   L  P +  +  
Sbjct: 926  IVTGDMSINGKPVDS----SFERRTGYVQQQDIHIAEMTVRESLVFSARLRRPQSIPDAE 981

Query: 538  SVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEATSA 596
             VA        +     G D ++G  GA L+  QR++++I   L+ KP++L+ LDE TS 
Sbjct: 982  KVADAETVMKLLDMEEYG-DALVGGLGAGLNVEQRKKLSIGVELVAKPDLLLFLDEPTSG 1040

Query: 597  LDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTI-KRSENVIVLGKDGSVIEAGKFKELF 655
            LD +S  AI     ++ K+G   + +I    +T+ ++ + +++L K G  +  G   E  
Sbjct: 1041 LDSQSSWAIVQLLRRIAKAGQCILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDIGE-- 1098

Query: 656  ANPNSELCKLLTEKSSRSDGNDSLPPPPPNATQDKVVEQIAEKILERFPEAGQSPDATVK 715
               NS +     E++               A   +  E  AE +LE     G    A+VK
Sbjct: 1099 ---NSSIVLDYFERN--------------GARHCEQRENPAEYVLEAI---GAGATASVK 1138

Query: 716  EIFKDVSSEGKPIKIT 731
            E + ++    +  + T
Sbjct: 1139 EDWHEIWQRSEECRAT 1154

 Score = 51.6 bits (122), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 59/225 (26%), Positives = 105/225 (46%), Gaps = 28/225 (12%)

Query: 443 QIFKDINIKVPPGSNVCIVGPSGRGKS----TIALLLLRYYNPTNGQILVDG--QDISKV 496
           +I ++IN+   PG  + ++G  G G S    T A +  ++    +G+IL DG  Q++   
Sbjct: 178 KILQNINVLAKPGEMILVLGRPGSGCSSFLKTAAGVTDQFAGGVDGEILYDGIPQNVMMK 237

Query: 497 NCKT-LRRHIGLVQQEPILMSGTIRDNITYGLA--EPAT-------KEEIRSVAKQCFCH 546
           N K+ +  +  L    P L   T++  + + +A   PA        KE IR+       +
Sbjct: 238 NYKSDVIYNPELDVHFPFL---TVKQTLDFAIACKTPAVRVNNVSRKEHIRATRD---LY 291

Query: 547 NFITKFPDGYDTMIGAQGAL-LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAI 605
             I      YDT +G      +SGG+R+R++IA AL  +  +   D AT  LD  +  A+
Sbjct: 292 ATIFGLTHTYDTKVGNDFVRGVSGGERKRVSIAEALAARGTVYSWDNATRGLDAST--AL 349

Query: 606 NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGK 650
            Y   Q ++  +  + S A  ++  + SEN+       +V+ +G+
Sbjct: 350 EY--AQAIRIMTNLLRSTAF-VTIYQASENIYETFDKVTVLHSGR 391

>Ecym_3604 Chr3 complement(1143009..1147433) [4425 bp, 1474 aa] {ON}
            similar to Ashbya gossypii ABR125C
          Length = 1474

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/315 (24%), Positives = 140/315 (44%), Gaps = 31/315 (9%)

Query: 429  FKNVSFSYPTR-PENQIFKDINIKVPPGSNVCIVGPSGRGKSTIA-LLLLRYYNPTNGQI 486
            +KNVS++ P +  + ++  +++    PG+   ++G SG GK+T+   L  R      G +
Sbjct: 841  WKNVSYTIPYKGTKRKLLDEVSGYCIPGTLTALMGESGAGKTTLLNTLAQRNVGIITGDM 900

Query: 487  LVDGQ--DISKVNCKTLRRHIGLVQQEPI-LMSGTIRDNITYGLAEPATKEEIRSVAKQC 543
            LV+G   DIS        R  G VQQ+ + +   T+R+++ +  A     E +    K  
Sbjct: 901  LVNGLPVDIS------FERRTGYVQQQDVHIKEMTVRESLQFS-ARLRRPESVPDAEKLD 953

Query: 544  FCHNFIT--KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEATSALDVE 600
            +    I      D  D ++G  G  L+ GQR++++I   L+ KP++L+ LDE TS LD +
Sbjct: 954  YVEKIIEVLGMTDYADAVVGDVGYGLNVGQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQ 1013

Query: 601  SEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS 660
            S  AI     +L K+G   + +I    +T+    + ++L K G        + ++ N   
Sbjct: 1014 SSWAIVQLLKKLAKAGQSILCTIHQPSATLFEQFDRLLLLKKGG-------QTVYFNDIG 1066

Query: 661  ELCKLLTEKSSRSDGNDSLPPPPP--------NATQDKVVEQIAEKILERFPEAGQSPDA 712
            E  K + +   R+      P   P         A       +   KI    PE  ++ +A
Sbjct: 1067 EHSKTILDYFERNGARKCSPSENPAEYILEVIGAGATATTSEDWAKIWRNSPEFAKA-NA 1125

Query: 713  TVKEIFKDVSSEGKP 727
             + +I  ++     P
Sbjct: 1126 EIDKILDELKKTKTP 1140

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 101/232 (43%), Gaps = 29/232 (12%)

Query: 443 QIFKDINIKVPPGSNVCIVGPSGRGKSTIALLL---LRYYNPTNGQILVDG--QDISKVN 497
            I + ++    PG  V ++G  G G S++   +      +   +G I  DG  QD    N
Sbjct: 157 NILEKVDFIARPGEMVLVLGRPGAGCSSLLKTVAGDTDQFKSVSGSISYDGIPQDEMMSN 216

Query: 498 CKTLRRHIGLVQQEPILMSGTIRDNITYGLA--------EPATKEEIRSVAKQCFCHNFI 549
            K    + G  +++      T+R  + + +A           T+ +  S+ ++ +   F 
Sbjct: 217 FKAEVIYNG--EEDVHFPHLTLRQTLDFAIACKTPHVRVNSLTRADYISMMRELYATIFG 274

Query: 550 TKFPDGYDTMIGAQGAL-LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYT 608
            K    YDT +G +    +SGG+R+R++IA AL    ++   D AT  LD  +  A+ Y 
Sbjct: 275 LK--HAYDTPVGNEFVRGVSGGERKRVSIAEALAANGSVYCWDNATRGLDAST--ALEYA 330

Query: 609 -----FGQLMKSGSM-TIVSIAHRLSTIKRSENVIVLGKD---GSVIEAGKF 651
                   ++KS S+ TI   + ++  +     V+  GK    G V+ A ++
Sbjct: 331 QAIRIMTNILKSTSLVTIYQASEKIYEVFDKVTVLYDGKQIYFGDVMSAREY 382

>TDEL0D04040 Chr4 complement(738550..743052) [4503 bp, 1500 aa] {ON} 
          Length = 1500

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 76/316 (24%), Positives = 148/316 (46%), Gaps = 23/316 (7%)

Query: 421  IPGKGDIEFKNVSFSYPTRP-ENQIFKDINIKVPPGSNVCIVGPSGRGKSTI-ALLLLRY 478
            +  +G   ++ V ++ P +    ++  +++    PG+   ++G SG GK+T+   L  R 
Sbjct: 837  LKSRGVFMWQKVCYTIPYKGGPRRLLDNVSGYCVPGTMTALMGESGAGKTTLLNTLAQRN 896

Query: 479  YNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSG-TIRDNITYGLAEPATKEEIR 537
                 G +LV+G+ I      +  R  G VQQ+ + ++  T+R+++ +  A    K+ + 
Sbjct: 897  VGVITGDMLVNGRPIDA----SFERRTGYVQQQDLHIAEMTVRESLIFS-ARMRRKQSVP 951

Query: 538  SVAKQCFCHNFITKFPDG--YDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEAT 594
               K  F    I     G   + ++G  GA LS  QR++++I   L+ KP++L+ LDE T
Sbjct: 952  DAEKIEFAEKIIDILDMGEYAEALVGEPGAGLSVEQRKKLSIGVELVAKPDLLLFLDEPT 1011

Query: 595  SALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTI-KRSENVIVLGKDGSVIEAGKFKE 653
            S LD +S  AI     +L K+G   + +I    +T+ ++ + +++L K G  +  G    
Sbjct: 1012 SGLDSQSAWAIVQLLRKLAKAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGD--- 1068

Query: 654  LFANPNSELCKLLTEKSSRSDGNDSLPPPPP-----NATQDKVVEQIAEKILERFPEAGQ 708
                 NS +     E++       S  P         A     VE+   +I  + PE  +
Sbjct: 1069 --VGKNSSILLEYFERNGARKCEKSENPAEYILEAIGAGATASVEEDWHQIWTKSPEH-K 1125

Query: 709  SPDATVKEIFKDVSSE 724
            + +  ++++  D+SS+
Sbjct: 1126 TNEEKIQKMISDLSSK 1141

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 80/174 (45%), Gaps = 19/174 (10%)

Query: 443 QIFKDINIKVPPGSNVCIVGPSGRGKS----TIALLLLRYYNPTNGQILVDGQDISKVNC 498
           +I + +N+   PG  V ++G  G G S    T A +  ++    +G I  +G    ++  
Sbjct: 157 KILRGVNLLARPGEMVLVLGRPGAGCSSMLKTAAGVTDQFAGGVSGDISYNGISQDEI-M 215

Query: 499 KTLRRHI----GLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQ---CFCHNF--- 548
           K  R  +     L    P L   T++  + + +A     + + ++++Q    F  +F   
Sbjct: 216 KDFRSDVIYNGELDVHFPYL---TVKQTLDFAIACKTPAKRVNNMSEQEYIDFTRDFYAT 272

Query: 549 ITKFPDGYDTMIGAQGAL-LSGGQRQRIAIARALIKKPNILVLDEATSALDVES 601
           I      YDT +G      +SGG+R+R++IA A++ + ++   D AT  LD  +
Sbjct: 273 IFGLTHTYDTKVGNDFVRGVSGGERKRVSIAEAVVARGSVYCWDNATRGLDAST 326

>Kwal_26.8730 s26 complement(918498..920993) [2496 bp, 831 aa] {ON}
           YPL147W (PXA1) - ABC family long-chain fatty acid
           transporter [contig 67] FULL
          Length = 831

 Score = 72.4 bits (176), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 81/314 (25%), Positives = 135/314 (42%), Gaps = 61/314 (19%)

Query: 375 TEYTGSSVFGLTTFYSELMQGVGAASRLF-DLTDHISSISPTKGQKYIPGK-----GDIE 428
           T YT + +F L T    +   V +   L  D  D + SI P+   + + G        I 
Sbjct: 489 TGYT-NRIFTLLTVLHRVHSSVYSYGALAEDDGDSVDSIDPSANSELVCGTVQRNFNGIR 547

Query: 429 FKNVSFSYPTRPENQIFKDIN---IKVPP------------------------GSNVCIV 461
           F+N+    P++      K IN    +VPP                        GS++ I+
Sbjct: 548 FENIDVVIPSKFGRDGIKLINRLRFQVPPVIGLDNNNSDSQINLSQKLMFKGPGSSMLIL 607

Query: 462 GPSGRGKSTIALLLLRY---YNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSGT 518
           GP+G GK++I  ++      YN  NG + V  +          R  I + Q+   +  GT
Sbjct: 608 GPNGSGKTSIQRIIAEIWPIYNK-NGLLSVPAE----------RELICIPQKPYFIQGGT 656

Query: 519 IRDNITYGLAEPAT------KEEIRSVAKQCFCHNFITKFPDGYDTM--IGAQGALLSGG 570
            R+ I Y ++           +E+  V K+     ++ K   G+  +  +     +LSGG
Sbjct: 657 FREQIIYPMSADQYFDLGYRDKELVHVLKEVKLE-YLLKRDKGWRYLDAVAEWKDVLSGG 715

Query: 571 QRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTI 630
           +RQR+  AR +  KP  +VLDEAT+A+  + E   +Y F  ++K      ++I+ R S I
Sbjct: 716 ERQRMNFARIMFHKPKFVVLDEATNAISADME---DYLFN-MLKRYRFNFITISQRPSLI 771

Query: 631 KRSENVIVLGKDGS 644
           K  +  + +G D S
Sbjct: 772 KYHDLALEIGADES 785

>Skud_4.262 Chr4 (456192..460697) [4506 bp, 1501 aa] {ON} YDR011W
            (REAL)
          Length = 1501

 Score = 72.8 bits (177), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 146/323 (45%), Gaps = 37/323 (11%)

Query: 421  IPGKGDIEFKNVSFSYPTRPENQIFKD-INIKVPPGSNVCIVGPSGRGKSTI-ALLLLRY 478
            +  KG   +K+V F+ P     ++  D ++    PG+   ++G SG GK+T+   L  R 
Sbjct: 847  LEAKGVFIWKDVCFTIPYEGSTRMLLDNVSGYCVPGTMTALMGESGAGKTTLLNTLAQRN 906

Query: 479  YNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSG-TIRDNITYG--------LAE 529
                 G +LV+G+ I      +  R  G VQQ+ I ++  T+R+++ +         L +
Sbjct: 907  VGIITGDMLVNGRPIDA----SFERRTGYVQQQDIHIAELTVRESLQFSARMRRPQRLPD 962

Query: 530  PATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV 589
                E +  + +       +    +  + ++G  G  L+  QR++++I   L+ KP++L+
Sbjct: 963  SEKMEYVEKIIR-------VLGMEEYAEALVGEVGCGLNVEQRKKLSIGVELVAKPDLLL 1015

Query: 590  -LDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTI-KRSENVIVLGKDGSVIE 647
             LDE TS LD +S  AI     +L K+G   + +I    +T+ +  + +++L K G  + 
Sbjct: 1016 FLDEPTSGLDSQSSWAIIQLLRKLSKAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVY 1075

Query: 648  AGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPP------PPNATQDKVVEQIAEKILE 701
             G         ++ +     +  +R   +D  P           AT   V E   EK L 
Sbjct: 1076 FGD----IGKNSAAILGYFEQNGARKCDHDENPAEYILEAIGAGATAS-VKEDWHEKWLN 1130

Query: 702  RFPEAGQSPDATVKEIFKDVSSE 724
              PE  QS D  V+E+  D+S +
Sbjct: 1131 S-PEYKQSQD-KVQELINDLSKQ 1151

 Score = 40.0 bits (92), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 55/227 (24%), Positives = 98/227 (43%), Gaps = 32/227 (14%)

Query: 443 QIFKDINIKVPPGSNVCIVGPSGRGKSTI----ALLLLRYYNPTNGQILVDG---QDISK 495
           +I  ++N     G  + ++G  G G S+     A  + ++    +G I  DG   +++ K
Sbjct: 174 EIICNVNALAEAGEMILVLGRPGAGCSSFLKVTAGEIDQFAGGVSGDIAYDGIPQKEMMK 233

Query: 496 VNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFC----HNFITK 551
                +  +  L    P L   T++  + + +A       + +V+K+ +     H + T 
Sbjct: 234 RYKADVIYNGELDVHFPYL---TVKQTLDFAIACKTPALRVNNVSKEEYIASRRHLYATI 290

Query: 552 FP--DGYDTMIGAQGAL-LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYT 608
           F     Y+T +G      +SGG+R+R++IA AL  K +I   D AT  LD  S  A+ Y 
Sbjct: 291 FGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLD--SSTALEYA 348

Query: 609 -----FGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGK 650
                   L+KS +   +  A        SEN+       +V+ +GK
Sbjct: 349 KAIRIMTNLLKSTAFVTIYQA--------SENIYETFDKVTVLYSGK 387

>Skud_14.404 Chr14 (733442..737716) [4275 bp, 1424 aa] {ON} YNR070W
            (REAL)
          Length = 1424

 Score = 72.4 bits (176), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 79/316 (25%), Positives = 146/316 (46%), Gaps = 22/316 (6%)

Query: 429  FKNVSFSY-PTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIA-LLLLRYYNPTNGQI 486
            ++NVSF+   +  + ++  +++    PG+   ++G SG GK+T+   L  R      G I
Sbjct: 777  WRNVSFTIRHSNGQRKLLDNVSGYCVPGTLTALIGESGAGKTTLLNTLAQRNVGTVTGDI 836

Query: 487  LVDGQDISKVNCKTLRRHIGLVQQEPILMSG-TIRDNITYGLAEPATKEEIRSVAKQCFC 545
            LVDG  +      +  R  G VQQ+ +  +  T+R+++ +  A     + I  V K  + 
Sbjct: 837  LVDGLPMDA----SFERRTGYVQQQDLHTAELTVRESLQFS-ARMRRPQSIPDVEKMEYV 891

Query: 546  HNFIT--KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEATSALDVESE 602
               I   +  +  + ++G  G  L+  QR++++I   L+ KP++L+ LDE TS LD +S 
Sbjct: 892  EKIIDILEMQEFSEALVGEIGYGLNVEQRKKLSIGVELVGKPDLLLFLDEPTSGLDSQSA 951

Query: 603  GAINYTFGQLMKSGSMTIVSIAHRLSTI-KRSENVIVLGKDGSVIEAGKFKELFANPNSE 661
             +I     +L ++G   + +I    +T+ ++ E +++LGK G  +  G+        +S 
Sbjct: 952  WSIVKMLKRLTQAGQSILCTIHQPSATLFEQFERLLLLGKGGQTVYFGE----IGKNSSS 1007

Query: 662  LCKLLTEKSSRSDGNDSLPP----PPPNATQDKVVEQIAEKILERFPEAGQSPDATVKEI 717
            + K      +R       P         A     VEQ    I +  PE  +  +  V  +
Sbjct: 1008 VVKYFESNGARKCEQSENPAEYILEAIGAGATASVEQNWYDIWKASPEIAKV-NEKVDTM 1066

Query: 718  FKDV-SSEGKPIKITP 732
             KD+ SS  + I + P
Sbjct: 1067 IKDLPSSSVRKIDVKP 1082

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 99/224 (44%), Gaps = 26/224 (11%)

Query: 443 QIFKDINIKVPPGSNVCIVGPSGRGKSTI----ALLLLRYYNPTNGQILVDGQDISKVNC 498
           +I KD+++   PG  V ++G  G G S++    A    ++     G I  DG     ++ 
Sbjct: 91  KILKDVSLLAKPGEMVLVLGRPGAGCSSLLKCAAGETNQFAGDLTGDISYDG-----ISQ 145

Query: 499 KTLRRH-----IGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFC------HN 547
           K + +H     I   +Q+      T++  + + +A     + + +V    +       + 
Sbjct: 146 KEMMQHYKADVIYNGEQDVHFPYLTVKQTLDFAIACKMPAKRVNNVTGAEYIAANRDFYA 205

Query: 548 FITKFPDGYDTMIGAQGAL-LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAIN 606
            I      YDT +G      +SGG+R+R++IA AL  + +I   D AT  LD  +     
Sbjct: 206 QIFGLAHTYDTRVGNDFVSGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTA---- 261

Query: 607 YTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGK 650
             F Q +++ +  + S A  ++  + SEN+       +V+ AG+
Sbjct: 262 LEFAQAIRTMTELLGSTA-LITIYQASENIYETFDKVTVLYAGR 304

>NDAI0H03570 Chr8 complement(872905..875172) [2268 bp, 755 aa] {ON}
           Anc_1.366
          Length = 755

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/220 (27%), Positives = 102/220 (46%), Gaps = 29/220 (13%)

Query: 427 IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI 486
           I+ ++VSF Y   PE+ + KD+N+ V   S + +VG +G GK+T+  +++    PT G +
Sbjct: 535 IQLQDVSFGYD--PESLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEELRPTKGFV 592

Query: 487 LVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITY-GLAEPATKEEIRSVAKQCFC 545
             +G           R  IG   Q  +      +  + +   A P   +E        F 
Sbjct: 593 SRNG-----------RLRIGYFTQHHVDSLDLTKSAVDWMSTAYPGKNDEEYRRHLGSF- 640

Query: 546 HNFITKFPDGYDTMIGAQG-ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGA 604
                    G    +G Q   LLSGGQ+ R+A A   +  P+ILVLDE ++ LD     A
Sbjct: 641 ---------GITGSLGLQRMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDTSGLDA 691

Query: 605 INYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGS 644
           +  +    +K+ S  ++ ++H +S I    N I + ++G+
Sbjct: 692 LEDS----LKNFSGGVLMVSHDISIIDSVCNEIWVSENGT 727

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 567 LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625
            SGG R R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 371 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPATVLTVSH 425

>ZYRO0D11880g Chr4 (1003647..1008143) [4497 bp, 1498 aa] {ON} similar
            to uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15
            ATP binding cassette (ABC) transporter of the plasma
            membrane general stress response factor implicated in
            cellular detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1498

 Score = 72.0 bits (175), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 132/292 (45%), Gaps = 38/292 (13%)

Query: 439  RPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNP--TNGQILVDGQDISKV 496
            R   +I  +I+  V PG+   ++G SG GK+T+   L          G I VDG    K+
Sbjct: 866  RESKRILNNIDGWVKPGTLTALMGASGAGKTTLLDCLAERVTTGVITGGIFVDG----KL 921

Query: 497  NCKTLRRHIGLVQQEPI-LMSGTIRDNITYG--LAEPAT--KEEIRSVAKQCFCHNFITK 551
              ++  R IG  QQ+ + L + T+R+++ +   L +P +    E R   ++    N +  
Sbjct: 922  RDESFPRSIGYCQQQDLHLKTATVRESLLFSAMLRQPKSVPASEKRKYVEEVI--NVLEM 979

Query: 552  FPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEATSALDVESEGAINYTFG 610
             P   D ++G  G  L+  QR+R+ I   L+ KP +L+ LDE TS LD ++  +I     
Sbjct: 980  EPYA-DAIVGVAGEGLNVEQRKRLTIGVELVAKPKLLIFLDEPTSGLDSQTAWSICQLIR 1038

Query: 611  QLMKSGSMTIVSIAHRLST--IKRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTE 668
            +L   G   + +I H+ S   I+  + ++ L K G  +  G+          + C ++ +
Sbjct: 1039 KLANRGQAILCTI-HQPSAVLIQEFDRLLFLQKGGETVYFGEL--------GDECNIMVD 1089

Query: 669  KSSRSDGNDSLPPPPPNATQDKVVEQIAEKILERFPEA-GQSPDATVKEIFK 719
               R+  +      PPNA         AE +LE    A G   +    E++K
Sbjct: 1090 YFERNGAHKC----PPNANP-------AEWMLEVVGAAPGSHANRNYHEVWK 1130

>YNR070W Chr14 (765375..769376) [4002 bp, 1333 aa] {ON}
           PDR18Putative transporter of the ATP-binding cassette
           (ABC) family, implicated in pleiotropic drug resistance;
           the authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 1333

 Score = 71.6 bits (174), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/229 (26%), Positives = 119/229 (51%), Gaps = 12/229 (5%)

Query: 429 FKNVSFSYP-TRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIA-LLLLRYYNPTNGQI 486
           +KNVSF+ P +  + ++   ++    PG+   ++G SG GK+T+   L  R      G +
Sbjct: 731 WKNVSFTIPHSSGQRKLLDSVSGYCVPGTLTALIGESGAGKTTLLNTLAQRNVGTITGDM 790

Query: 487 LVDGQDISKVNCKTLRRHIGLVQQEPILMSG-TIRDNITYGLAEPATKEEIRSVAKQCFC 545
           LVDG  +      + +R  G VQQ+ + ++  T+++++ +  A     + I    K  + 
Sbjct: 791 LVDGLPMDA----SFKRRTGYVQQQDLHVAELTVKESLQFS-ARMRRPQSIPDAEKMEYV 845

Query: 546 HNFIT--KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEATSALDVESE 602
              I+  +  +  + ++G  G  L+  QR++++I   L+ KP++L+ LDE TS LD +S 
Sbjct: 846 EKIISILEMQEFSEALVGEIGYGLNVEQRKKLSIGVELVGKPDLLLFLDEPTSGLDSQSA 905

Query: 603 GAINYTFGQLMKSGSMTIVSIAHRLSTI-KRSENVIVLGKDGSVIEAGK 650
            A+     +L  +G   + +I    +T+ ++ + +++LGK G  I  G+
Sbjct: 906 WAVVKMLKRLALAGQSILCTIHQPSATLFEQFDRLLLLGKGGQTIYFGE 954

 Score = 40.4 bits (93), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 73/157 (46%), Gaps = 27/157 (17%)

Query: 532 TKEEIRSVAKQCFC------HNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKP 585
           TKEE  +  ++ +       H F TK   G D + G     +SGG+R+R++IA AL  K 
Sbjct: 146 TKEEYITANREFYAKIFGLTHTFDTKV--GNDFISG-----VSGGERKRVSIAEALAAKG 198

Query: 586 NILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSV 645
           +I   D AT  LD  S  A+   F + +++ +  + + A  ++  + SEN+       +V
Sbjct: 199 SIYCWDNATRGLD--SSTALE--FARAIRTMTNLLGTTA-LVTVYQASENIYETFDKVTV 253

Query: 646 IEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPP 682
           + AG  +++F       C   TE     +    L PP
Sbjct: 254 LYAG--RQIF-------CGKTTEAKDYFENMGYLCPP 281

>KAFR0C00830 Chr3 (163830..168284) [4455 bp, 1484 aa] {ON} Anc_3.220
            YDR011W
          Length = 1484

 Score = 71.6 bits (174), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 91/336 (27%), Positives = 153/336 (45%), Gaps = 44/336 (13%)

Query: 404  DLTDHISSISPTKGQKY----IPGKGDIEFKNVSFSYPTRPENQIFKD-INIKVPPGSNV 458
            DL +  S+ S +KG+      +  KG   +K+V ++ P     ++  D ++    PG+  
Sbjct: 813  DLKERYST-SSSKGEDIQFEDLKSKGVFIWKDVCYTIPYDGGQRMLLDHVSGFCKPGTLT 871

Query: 459  CIVGPSGRGKSTI-ALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSG 517
             ++G SG GK+T+   L  R      G +LV+G  I      +  R  G VQQ+ I ++ 
Sbjct: 872  ALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGHHIDA----SFERRTGYVQQQDIHIAE 927

Query: 518  -TIRDNITYG--LAEP---ATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQ 571
             T+R+++ +   L  P   + KE++  V K       +    D  + ++GA G  L+  Q
Sbjct: 928  LTVRESLQFSARLRRPQNISDKEKMDYVEKIID----VLDMEDYAEALVGAVGNGLNVEQ 983

Query: 572  RQRIAIARALIKKPNILV-LDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTI 630
            R++++I   L+ KP++L+ LDE TS LD +S  AI     +L  +G   + +I    +T+
Sbjct: 984  RKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIIQLLRKLAAAGQSILCTIHQPSATL 1043

Query: 631  -KRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPPPNATQD 689
             ++ + +++L K G  +  G   E     +S L        +R       P         
Sbjct: 1044 FEQFDRLLLLKKGGQTVYFGDIGE----NSSTLLGYFERNGARKCSKAENP--------- 1090

Query: 690  KVVEQIAEKILERF-PEAGQSPDATVKEIFKDVSSE 724
                  AE ILE     A  S DA   EI+K  SSE
Sbjct: 1091 ------AEYILEAIGAGATASTDADWHEIWK-TSSE 1119

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 102/248 (41%), Gaps = 42/248 (16%)

Query: 444 IFKDINIKVPPGSNVCIVGPSGRGKSTI----ALLLLRYYNPTNGQILVDG--QDISKVN 497
           I +++N    PG  V ++G  G G S+     A  + ++     G +  DG  QD    N
Sbjct: 163 ILQNVNALARPGEMVLVLGRPGAGCSSFLKVTAGEIDQFAGGVTGDVAYDGISQDEMMKN 222

Query: 498 CKTLRRHIG-LVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGY 556
            +    + G L    P L   T++  + + +A     + I +++K      +I    D Y
Sbjct: 223 YRADVIYNGELDVHFPYL---TVKQTLDFAIACKMPAKRINNISKS----EYIESTRDLY 275

Query: 557 DTMIGAQGAL-----------LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAI 605
            T+ G +              +SGG+R+R++IA AL  +  +   D AT  LD  +  A+
Sbjct: 276 ATIFGLRHTYQTKVGNDFVRGVSGGERKRVSIAEALAARGTVYCWDNATRGLDAST--AL 333

Query: 606 NYT-----FGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKELFANPNS 660
            Y         L+KS +   +  A        SEN+       +V+ AG  ++++  P  
Sbjct: 334 EYAAAIRIMTNLLKSTAFVTIYQA--------SENIYEKFDKVTVLYAG--RQIYYGPIH 383

Query: 661 ELCKLLTE 668
           E  +   E
Sbjct: 384 EAKEYFAE 391

>Ecym_2410 Chr2 (797543..800029) [2487 bp, 828 aa] {ON} similar to
           Ashbya gossypii ACR128C
          Length = 828

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 97/197 (49%), Gaps = 21/197 (10%)

Query: 449 NIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLV 508
           N+ + PGS++ I+GP+  GKS+I  ++   +   N   L+     S + C        + 
Sbjct: 592 NVLLGPGSSLLILGPNSCGKSSIQRIIAEIWPIYNKTGLLSIPSESDMMC--------IA 643

Query: 509 QQEPILMSGTIRDNITYGL-----AEPATKE-EIRSVAKQCFCHNFITKFPDG--YDTMI 560
           Q+   +  GT RD I Y +      E   K+ E+  V K+    +++ K  D   Y   +
Sbjct: 644 QRPYFIQGGTFRDQIIYPMFVDTFYEKGHKDRELVRVLKEVKL-DYLLKRADALNYLDHV 702

Query: 561 GAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTI 620
                +LSGG++QR+  AR +  +P  +VLDEAT+A+  + E   +Y F  ++K      
Sbjct: 703 ADWKDVLSGGEKQRMNFARIMFHRPKFIVLDEATNAISADME---DYLFN-MLKKFRFNF 758

Query: 621 VSIAHRLSTIKRSENVI 637
           +SI+ R S IK  + ++
Sbjct: 759 ISISQRPSLIKYHDYLL 775

>KAFR0C05210 Chr3 (1037177..1041658) [4482 bp, 1493 aa] {ON} 
          Length = 1493

 Score = 71.2 bits (173), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 76/315 (24%), Positives = 139/315 (44%), Gaps = 41/315 (13%)

Query: 427  IEFKNVSFSYPTRPENQ-IFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLR--YYNPTN 483
              ++N+ +    + E + I  +++  V PG+   ++G SG GK+T+   L          
Sbjct: 853  FHWRNLCYDVQIKDETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVIT 912

Query: 484  GQILVDGQDISKVNCKTLRRHIGLVQQEPI-LMSGTIRDNITYG--LAEPATKEEIRSVA 540
            G +LVDG+   +    +  R IG  QQ+ + L + T+R+++ +   L +PA   E+    
Sbjct: 913  GDVLVDGRPRDE----SFPRSIGYCQQQDLHLKTSTVRESLRFSAYLRQPA---EVSVEE 965

Query: 541  KQCFCHNFIT--KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEATSAL 597
            K  +    I   +     D ++G  G  L+  QR+R+ I   L  KP +LV LDE TS L
Sbjct: 966  KDAYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGL 1025

Query: 598  DVESEGAINYTFGQLMKSGSMTIVSIAHRLSTI--KRSENVIVLGKDGSVIEAGKFKELF 655
            D ++  +I     +L   G   + +I H+ S I  +  + ++ L K G  +  G+     
Sbjct: 1026 DSQTAWSICQLMRKLASHGQAILCTI-HQPSAILMQEFDRLLFLQKGGKTVYFGEL---- 1080

Query: 656  ANPNSELCKLLTEKSSRSDGNDSLPPPPPNATQDKVVEQIAEKILERFPEAGQSPDATVK 715
                 E C+++ +   R+  +   P   P           AE +LE     G +P +   
Sbjct: 1081 ----GEGCQVMIDYFERNGSHKCPPDANP-----------AEWMLEV---VGAAPGSHAN 1122

Query: 716  EIFKDVSSEGKPIKI 730
            + + +V    +  +I
Sbjct: 1123 QDYHEVWRNSEEFRI 1137

>KNAG0C01960 Chr3 complement(380896..383154) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 70.9 bits (172), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 106/238 (44%), Gaps = 55/238 (23%)

Query: 427 IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI 486
           I+ ++VSF Y    ++ + KD+N+ V   S + +VG +G GK+T+  +++    PT+G +
Sbjct: 532 IQLQDVSFGY--EEQSLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPTSGYV 589

Query: 487 LVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCH 546
             +G           R  IG   Q  +       D++           ++ + A      
Sbjct: 590 SRNG-----------RLRIGYFTQHHV-------DSM-----------DLNTSAVDWMSK 620

Query: 547 NFITKFPDGYDTMIGA----------QGALLSGGQRQRIAIARALIKKPNILVLDEATSA 596
            +  K  + Y   +GA          Q  LLSGGQ+ R+A A   +  P+ILVLDE ++ 
Sbjct: 621 TYPGKTDEEYRRHLGAFGITGTLGLQQMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNH 680

Query: 597 LDVESEGAI-----NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAG 649
           LD     A+      +T G LM         ++H +S I    N I + +DG+V + G
Sbjct: 681 LDTTGLEALVDALKKFTGGVLM---------VSHDISVIDSVCNEIWVSEDGNVKKFG 729

 Score = 45.1 bits (105), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 567 LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625
            SGG R R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKTYPSTVLTVSH 422

>KAFR0C05220 Chr3 (1042497..1046996) [4500 bp, 1499 aa] {ON} Anc_5.500
            YDR406W
          Length = 1499

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 119/257 (46%), Gaps = 23/257 (8%)

Query: 403  FDLTDH-------ISSISPTKGQKYIPGKGDIEFKNVSFSYPTRP-ENQIFKDINIKVPP 454
            FD T+H        +  S T G + +  +    ++N+ +  P +    ++  +++  V P
Sbjct: 820  FDATNHDLIKDSESTDESSTNGARLLKSQAVFHWRNLCYDIPIKHGTRRLLDNVDGWVKP 879

Query: 455  GSNVCIVGPSGRGKSTIALLLLRYYNP--TNGQILVDGQDISKVNCKTLRRHIGLVQQEP 512
            G+   ++G SG GK+T+   L          G +LVDG+   +    +  R IG  QQ+ 
Sbjct: 880  GTLTALMGASGAGKTTLLDCLAERVTMGVITGDVLVDGRPRDE----SFPRSIGYCQQQD 935

Query: 513  I-LMSGTIRDNITYG--LAEPATKEEIRSVAKQCFCHNFIT--KFPDGYDTMIGAQGALL 567
            + L + T+R+++ +   L +PA   E+    K  +    I   +     D ++G  G  L
Sbjct: 936  LHLKTSTVRESLRFSAYLRQPA---EVSVEEKDAYVEEVIKILEMEKYADAVVGVAGEGL 992

Query: 568  SGGQRQRIAIARALIKKPNILV-LDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHR 626
            +  QR+R+ I   L  KP +LV LDE TS LD ++  +I     +L   G   + +I   
Sbjct: 993  NVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWSICQLMRKLASHGQAILCTIHQP 1052

Query: 627  LSTIKRSENVIVLGKDG 643
             + + +  + ++  +DG
Sbjct: 1053 SAILMQEFDRLLFLQDG 1069

>Suva_16.163 Chr16 (282462..285074) [2613 bp, 870 aa] {ON} YPL147W
           (REAL)
          Length = 870

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 107/212 (50%), Gaps = 31/212 (14%)

Query: 449 NIKVP----PGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           +IK+P     GS++ I+GP+G GKS+I  ++   +   N   L+     + + C      
Sbjct: 628 DIKLPFLQGSGSSLLILGPNGCGKSSIQRIIADVWPVYNKNGLLSIPSENNIFC------ 681

Query: 505 IGLVQQEPIL-MSGTIRDNITYGLAEP-------ATKEEIRSVAKQCFCHNFITKFPDG- 555
              + Q+P     GT+RD I Y ++           KE ++ +A+     +++ K   G 
Sbjct: 682 ---IPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILAEVRL--DYLLKRGVGL 736

Query: 556 -YDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMK 614
            Y   +     LLSGG++QR+  AR +  KP  +VLDEAT+A+ V+ E   +Y F  L+K
Sbjct: 737 TYLDAVADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LLK 792

Query: 615 SGSMTIVSIAHRLSTIKRSENVIVLG--KDGS 644
                 +SI+ R + IK  E ++ +G  +DG+
Sbjct: 793 RYRFNFISISQRPTLIKYHEMLLEIGENRDGN 824

>CAGL0I04862g Chr9 complement(438338..442861) [4524 bp, 1507 aa] {ON}
            highly similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011w SNQ2 multidrug resistance protein
          Length = 1507

 Score = 70.9 bits (172), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 117/242 (48%), Gaps = 24/242 (9%)

Query: 421  IPGKGDIEFKNVSFSYPTRP-ENQIFKDINIKVPPGSNVCIVGPSGRGKSTI-ALLLLRY 478
            +  KG   ++NV ++ P      Q+  +++    PG+   ++G SG GK+T+   L  R 
Sbjct: 851  LESKGIFIWRNVCYTIPYDGGMRQLLDNVSGFCKPGTLTALMGESGAGKTTLLNTLAQRN 910

Query: 479  YNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMSG-TIRDNITY--------GLAE 529
                 G +LV+G+ I      +  R  G VQQ+ I +S  T+R+++ +         + E
Sbjct: 911  VGIITGDMLVNGKPIDI----SFERRTGYVQQQDIHISELTVRESLQFSARMRRAQNVPE 966

Query: 530  PATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV 589
                E +  + K       +    +  D ++G  G  L+  QR++++I   L+ KP++L+
Sbjct: 967  EEKMEHVERIIK-------VLDMEEYADALVGDVGRGLNVEQRKKLSIGVELVAKPDLLL 1019

Query: 590  -LDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTI-KRSENVIVLGKDGSVIE 647
             LDE TS LD +S  AI     +L K+G   + +I    +T+ +  + +++L K G  + 
Sbjct: 1020 FLDEPTSGLDSQSSWAIVQLLKKLAKAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVY 1079

Query: 648  AG 649
             G
Sbjct: 1080 FG 1081

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 94/225 (41%), Gaps = 18/225 (8%)

Query: 444 IFKDINIKVPPGSNVCIVGPSGRGKSTI----ALLLLRYYNPTNGQILVDGQDISKVNCK 499
           I  D++     G  V ++G  G G S++    A  + ++     G+I+ DG    ++  +
Sbjct: 177 ILNDVSGLARAGEMVLVLGRPGAGCSSMLKVTAGEIDQFAGGVEGEIMYDGIPQKEMMKR 236

Query: 500 TLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCF------CHNFITKFP 553
                I   +Q+      T++  + + +A     + +  V+++ +       H  I    
Sbjct: 237 YKPDVIYNGEQDVHFPHLTVQQTLDFAIACKTPSKRVNDVSREEYIASTRDLHATIFGLR 296

Query: 554 DGYDTMIGAQGAL-LSGGQRQRIAIARALIKKPNILVLDEATSALD----VESEGAINYT 608
             Y T +G      +SGG+R+R++IA AL+ K +I   D AT  LD    +E   AI  T
Sbjct: 297 HTYHTKVGNDFVRGVSGGERKRVSIAEALVTKGSIYCWDNATRGLDASTALEYAKAIRIT 356

Query: 609 FGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKE 653
              L   GS   V+I      I  + + + +   G  I  G   E
Sbjct: 357 TNLL---GSTAFVTIYQASENIYETFDKVTVLYTGRQIYFGPIDE 398

>KAFR0A03790 Chr1 complement(770906..773536) [2631 bp, 876 aa] {ON}
           Anc_8.661 YPL147W
          Length = 876

 Score = 70.5 bits (171), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 104/218 (47%), Gaps = 33/218 (15%)

Query: 442 NQIFKDINIKV--PPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCK 499
           N+I  DI+I      GS++ I+GP+G GKS+I  ++   +   N   L+     + + C 
Sbjct: 629 NEITNDISIPFLNSAGSSLLILGPNGCGKSSIQRIIAEIWPIYNKNGLLSKPTEANLLC- 687

Query: 500 TLRRHIGLVQQEPILMSG-TIRDNITY----------GLAEPATKEEIRSVAKQCFCHNF 548
                   V Q+P    G T+RD I Y          GL +    + +R V       ++
Sbjct: 688 --------VPQKPYFTRGGTLRDQIIYPMSSDEFFDRGLKDKLLVQVLREVKL-----DY 734

Query: 549 ITKFPDGYDTM--IGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAIN 606
           + K   G+  +  +     +LSGG++QR+  AR +  KP  +VLDEAT+A+  + E   +
Sbjct: 735 LLKRDKGWSYLDTVSDWKDVLSGGEKQRMNFARIMFHKPRFVVLDEATNAISADME---D 791

Query: 607 YTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGS 644
           Y F  ++K      ++I+ R S IK  + ++ +  D S
Sbjct: 792 YLFN-VLKRYRFNFITISQRPSLIKYHDLLLEISDDNS 828

>KNAG0I00530 Chr9 (88076..91219) [3144 bp, 1047 aa] {ON} Anc_1.427
           YCR011C
          Length = 1047

 Score = 70.5 bits (171), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 69/242 (28%), Positives = 112/242 (46%), Gaps = 31/242 (12%)

Query: 427 IEFKNVSFSYP----TRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIA--LLLLRYYN 480
           + F+N+S+  P    ++ E ++   I   V PG  + I+G SG GK+T+   L + R   
Sbjct: 396 LSFENISYDVPGAKDSKIEEKVLNSITGMVKPGQMLAIMGGSGAGKTTLLDILAMKRKTG 455

Query: 481 PTNGQILVDGQDISKVNCKTLRRHIGLVQQ-----------EPILMSGTIRDNITYGLAE 529
              G I V+G  I     K   + IG V Q           E +L S  +R  +   +  
Sbjct: 456 RVQGTIAVNGHSILN---KLYSKMIGFVDQDDFLLPTLTVYETVLNSALLR--LPRSMPF 510

Query: 530 PATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGAL-LSGGQRQRIAIARALIKKPNIL 588
            A ++ +  V ++        +  D  D +IG      +SGG+++R++IA  L+  P IL
Sbjct: 511 TAKRKRVNRVLEE-------LRIMDIKDRIIGNDFERGISGGEKRRVSIACELVTSPAIL 563

Query: 589 VLDEATSALDVESEGAINYTFGQLMKSGSMTIV-SIAHRLSTIKRSENVIVLGKDGSVIE 647
            LDE TS LD  +   +     +L K+ + T+V SI    S I    + +VL  DG +I 
Sbjct: 564 FLDEPTSGLDANNANNVIECLVRLAKNYNRTLVLSIHQPRSNIFNLFDKLVLLSDGEMIY 623

Query: 648 AG 649
           +G
Sbjct: 624 SG 625

>KAFR0C04540 Chr3 complement(907385..909643) [2259 bp, 752 aa] {ON}
           Anc_1.366 YFR009W
          Length = 752

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/238 (26%), Positives = 105/238 (44%), Gaps = 55/238 (23%)

Query: 427 IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI 486
           I+ ++VSF Y  +  N + KD+N+ V   S + +VG +G GK+T+  +++    P  G +
Sbjct: 532 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMEQLRPLQGYV 589

Query: 487 LVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCH 546
             +G           R  IG   Q  +       D++           ++ + A      
Sbjct: 590 SRNG-----------RLRIGYFTQHHV-------DSM-----------DLTTSAVDWMSK 620

Query: 547 NFITKFPDGYDTMIGAQG----------ALLSGGQRQRIAIARALIKKPNILVLDEATSA 596
            F  K  + Y   +GA G           LLSGGQ+ R+A A   +  P+IL+LDE ++ 
Sbjct: 621 TFPGKNDEEYRRHLGAFGITGSLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 597 LDVESEGAI-----NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAG 649
           LD     A+     N++ G LM         ++H +S I    N I + ++G+V + G
Sbjct: 681 LDTTGLDALIDALKNFSGGVLM---------VSHDISVINSVCNEIWVSEEGTVKKFG 729

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 567 LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625
            SGG R R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPATLLVVSH 422

>ZYRO0E04092g Chr5 (308495..311683) [3189 bp, 1062 aa] {ON} similar
           to uniprot|P25371 Saccharomyces cerevisiae YCR011C ADP1
           Shows homology to ATP-dependent permeases Active
           transport ATPase
          Length = 1062

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 120/248 (48%), Gaps = 33/248 (13%)

Query: 424 KGDIE----FKNVSFSYPTRPENQ--IFKDINIKVPPGSNVCIVGPSGRGKSTIA--LLL 475
           K D+E    FK++ +  P   +N   +  +++  V PG  + ++G SG GK+T+   L +
Sbjct: 389 KTDVEAVLTFKDIVYQVPINRDNSETVLNEVSGVVQPGEMMALLGGSGAGKTTLLDILAM 448

Query: 476 LRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQ-----------EPILMSGTIRDNIT 524
            +     +GQI V+G+ ISK   K   + IG V Q           E +L S  +R  + 
Sbjct: 449 KKKAGKVSGQIKVNGKSISK---KDYTKLIGFVDQDDYLLQTLTVFETVLNSALLR--LP 503

Query: 525 YGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGAL-LSGGQRQRIAIARALIK 583
             L   A +  +  V ++        +  D  D +IG +    +SGG+++R++IA  L+ 
Sbjct: 504 RALPFEAKRSRVYKVLEE-------LRILDIKDKIIGNEFERGISGGEKRRVSIACELVT 556

Query: 584 KPNILVLDEATSALDVESEGAINYTFGQLMKS-GSMTIVSIAHRLSTIKRSENVIVLGKD 642
            P IL LDE TS LD  +   +     +L ++ G   ++SI    S I +  + +VL  +
Sbjct: 557 SPLILFLDEPTSGLDANNASNVVDCLVRLARNYGRTLVLSIHQPRSNIFQMFDKLVLLSN 616

Query: 643 GSVIEAGK 650
           G ++ +G+
Sbjct: 617 GEMVYSGE 624

>Kwal_23.5161 s23 (1040608..1045077) [4470 bp, 1489 aa] {ON} YDR011W
            (SNQ2) - ABC transporter [contig 8] FULL
          Length = 1489

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 79/313 (25%), Positives = 140/313 (44%), Gaps = 34/313 (10%)

Query: 425  GDIEFKNVSFSYPTR-PENQIFKDINIKVPPGSNVCIVGPSGRGKSTI-ALLLLRYYNPT 482
            G   +K V+F+ P +    ++  +++    PGS   ++G SG GK+T+   L  R     
Sbjct: 843  GVFVWKEVNFTIPYKGSTRKLLDNVSGYCAPGSLTALMGESGAGKTTLLNTLAQRNVGII 902

Query: 483  NGQILVDGQDISKVNCKTLRRHIGLVQQEPI-LMSGTIRDNITYGLAEPATKEEIRSVAK 541
             G +LV+G+ I      +  R  G VQQ+ + +   T+R++  +  A     + I    K
Sbjct: 903  TGDMLVNGKPIDA----SFERRTGYVQQQDVHVKEMTVRESFQFA-ARMRRPQSIPESEK 957

Query: 542  QCFCHNFIT--KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEATSALD 598
              +    I      D  + +IG  G  L+  QR++++I   L  KP++L+ LDE TS LD
Sbjct: 958  LAYVEKIIEILDMEDYAEALIGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTSGLD 1017

Query: 599  VESEGAINYTFGQLMKSGSMTIVSIAHRLSTI-KRSENVIVLGKDGSVIEAGKFKELFAN 657
             +S  AI     +L ++G   + +I    +T+ +  + +++L K G  +  G        
Sbjct: 1018 SQSSWAIVQLMRRLAEAGQSILCTIHQPSATLFEEFDRLLLLKKGGQTVYFG-------- 1069

Query: 658  PNSELCKLLTEKSSRSDGNDSLPPPPPNATQDKVVEQIAEKILERFPEAGQSPDATVKEI 717
            P  +  ++L +    +            A + +  E  AE ILE     G    A+VKE 
Sbjct: 1070 PIGKNSRMLLDYFEEN-----------GARKCEKTENPAEYILEAI---GAGATASVKED 1115

Query: 718  FKDVSSEGKPIKI 730
            + D+  +    KI
Sbjct: 1116 WHDIWKKSSQFKI 1128

 Score = 39.7 bits (91), Expect = 0.029,   Method: Compositional matrix adjust.
 Identities = 51/227 (22%), Positives = 94/227 (41%), Gaps = 25/227 (11%)

Query: 439 RPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLL---LRYYNPTNGQILVDGQDISK 495
           R    I ++ ++   PG  V ++G  G G S+    +    R +    G I  DG    +
Sbjct: 161 RGNRDIVRNASLLARPGDMVLVLGRPGAGCSSFLKTIAGETRNFEEVRGSISYDGIPQEE 220

Query: 496 VNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDG 555
           +  K     I   + +      T++  + + L+    +  +   ++      +IT   + 
Sbjct: 221 MMKKYKTDVIYNGEMDVHFPHLTVQQTLDFALSCTTPRVRLDGASRS----EYITAMREL 276

Query: 556 YDTMIGAQGAL-----------LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGA 604
           Y T+ G +              +SGG+R+R++IA AL  + +I   D AT  LD  +   
Sbjct: 277 YGTIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALAARGSIYCWDNATRGLDASTA-- 334

Query: 605 INYTFGQLMKSGSMTIVSIAHRLSTI-KRSENVIVLGKDGSVIEAGK 650
               F Q +++ +    SIA  L TI + SEN+       +V+  G+
Sbjct: 335 --LEFAQAIRTMTNLQKSIA--LVTIYQASENIYECFDKVTVLYDGR 377

>ZYRO0D11836g Chr4 (993707..998095) [4389 bp, 1462 aa] {ON} similar to
            uniprot|Q04182 Saccharomyces cerevisiae YDR406W PDR15 ATP
            binding cassette (ABC) transporter of the plasma membrane
            general stress response factor implicated in cellular
            detoxification target of Pdr1p Pdr3p and Pdr8p
            transcription regulators promoter contains a PDR
            responsive element
          Length = 1462

 Score = 70.5 bits (171), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/234 (27%), Positives = 114/234 (48%), Gaps = 19/234 (8%)

Query: 427  IEFKNVSFSYPTRPENQ-IFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNP--TN 483
              ++NV +    + E + I  +I+  V PG+   ++G +G GK+T+   L +        
Sbjct: 819  FHWRNVCYDVQIKSETRRILDNIDGWVKPGTLTALMGATGAGKTTLLDSLAQRVTTGVLT 878

Query: 484  GQILVDGQDISKVNCKTLRRHIGLVQQEPI-LMSGTIRDNITYG--LAEPAT--KEEIRS 538
            G I VDG    K+  ++  R IG  QQ+ + L + T+R+++ +   L +P +    E R 
Sbjct: 879  GSIFVDG----KLRDESFARSIGYCQQQDLHLTTATVRESLLFSAMLRQPKSVPASEKRK 934

Query: 539  VAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEATSAL 597
              ++    N +   P   D ++G  G  L+  QR+R+ I   L  KPN+L+ LDE TS L
Sbjct: 935  YVEEVI--NVLEMEPYA-DAIVGVAGEGLNVEQRKRLTIGVELAAKPNLLLFLDEPTSGL 991

Query: 598  DVESEGAINYTFGQLMKSGSMTIVSIAHRLST--IKRSENVIVLGKDGSVIEAG 649
            D ++  +I     +L   G   + +I H+ S   I+  + ++ L K G  +  G
Sbjct: 992  DSQTAWSICQLMKKLANRGQAILCTI-HQPSAMLIQEFDRLLFLQKGGQTVYFG 1044

>NDAI0G01840 Chr7 complement(404289..408797) [4509 bp, 1502 aa] {ON} 
          Length = 1502

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 86/340 (25%), Positives = 153/340 (45%), Gaps = 43/340 (12%)

Query: 404  DLTDHISSISPTKGQKYIPG---KGDIEFKNVSFSYPTR-PENQIFKDINIKVPPGSNVC 459
            DL +   S +  +G+    G   +G   +K + ++ P    + ++  +I+    PG+   
Sbjct: 822  DLKEMYYSSNSAEGEAVFEGLESRGVFIWKEILYTIPYEGTQRKLLDNISGYCIPGTMTA 881

Query: 460  IVGPSGRGKSTIALLLLRYYNP---TNGQILVDGQDISKVNCKTLRRHIGLVQQEPILMS 516
            ++G SG GK+T+ L  L   N      G ILV+G+ I      +  R  G VQQ+ I ++
Sbjct: 882  LIGESGAGKTTL-LNTLAQRNEIGVVTGDILVNGRPIDS----SFERRTGYVQQQDIHIA 936

Query: 517  G-TIRDNITYGLAEPATKEEIRSVAKQCFCHNFIT--KFPDGYDTMIGAQGALLSGGQRQ 573
              ++R+++ +  A     E +    K  +    I      +  + ++GA G  L+  QR+
Sbjct: 937  ELSVRESLQFS-ARMRRPESVPDEEKMAYVEKIIQVLDMEEYAEALVGAIGYGLNVEQRK 995

Query: 574  RIAIARALIKKPNILV-LDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTI-K 631
            +++I   L  KP++L+ LDE TS LD +S  AI     +L  +G   + ++    +T+ +
Sbjct: 996  KLSIGVELCAKPDLLLFLDEPTSGLDSQSSWAIIQLLKRLTHAGQSILCTVHQPSATLFE 1055

Query: 632  RSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPPPNATQDKV 691
            + + +++L K G  +  G   E     NSE   +L     R+      P   P       
Sbjct: 1056 QFDRLLLLRKGGQTVYFGDIGE-----NSE---ILLSYFERNSARKCSPKENP------- 1100

Query: 692  VEQIAEKILERFPEAGQSPDATVKEIFKDV---SSEGKPI 728
                AE ILE     G    A++KE +  +   SSE K +
Sbjct: 1101 ----AEYILEII---GAGATASIKEDWHSIWKNSSEYKEV 1133

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/174 (22%), Positives = 74/174 (42%), Gaps = 19/174 (10%)

Query: 443 QIFKDINIKVPPGSNVCIVGPSGRGKS----TIALLLLRYYNPTNGQILVDGQDISKVNC 498
           QI ++      PG  + ++G  G G S    TIA  + ++     G++  DG    ++  
Sbjct: 168 QIIRNCYALAEPGEMILVLGRPGAGCSSLLKTIAGEIDQFAGGVEGEMTYDGISQKEMMQ 227

Query: 499 KTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDGYDT 558
           K     I   +Q+      T++  + + +A       + +V+++     +I    D Y T
Sbjct: 228 KFKGDVIYNGEQDVHFPHITVQQTLDFAIACKTPARRVNNVSRE----EYIVSTRDLYAT 283

Query: 559 MIGAQGAL-----------LSGGQRQRIAIARALIKKPNILVLDEATSALDVES 601
           + G +              +SGG+R+R++IA AL    +I   D AT  LD  +
Sbjct: 284 IFGLRHTYNTKVGNEYVRGISGGERKRVSIAEALAANGSIYCWDNATRGLDAST 337

>KNAG0A02980 Chr1 (363468..366083) [2616 bp, 871 aa] {ON} Anc_8.661
           YPL147W
          Length = 871

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 102/208 (49%), Gaps = 26/208 (12%)

Query: 449 NIKVP----PGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQILVDGQDISKVNCKTLRRH 504
           NI +P      S++ I+GP+G GKS+I  ++   +   N   L+   D S + C      
Sbjct: 630 NIPLPFLSGQASSLLILGPNGCGKSSIQRIIAEIWPIYNKNGLLSKPDSSSLLC------ 683

Query: 505 IGLVQQEPILMSG-TIRDNITYGLA-----EPATKEEIRSVAKQCFCHNFITKFPDGYDT 558
              + Q+P    G T RD I Y ++     +   K+++          +++ K   G+  
Sbjct: 684 ---IPQKPYFTRGGTFRDQIIYPMSSDEFFDNGFKDKVLVWILSEVHLDYLLKRAPGWSY 740

Query: 559 M--IGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSG 616
           +  +     +LSGG++QR+  AR L  KP  +VLDEAT+A+  + E   +Y F  ++K  
Sbjct: 741 LDEVTEWKDVLSGGEKQRMNFARILFHKPKFIVLDEATNAISADME---DYLFN-MLKKF 796

Query: 617 SMTIVSIAHRLSTIKRSENVI-VLGKDG 643
             + ++I+ R S IK  + ++ +  +DG
Sbjct: 797 RFSFITISQRPSLIKYHDMLLEIADRDG 824

>YPL147W Chr16 (273255..275867) [2613 bp, 870 aa] {ON}  PXA1Subunit
           of a heterodimeric peroxisomal ATP-binding cassette
           transporter complex (Pxa1p-Pxa2p), required for import
           of long-chain fatty acids into peroxisomes; similarity
           to human adrenoleukodystrophy transporter ABCD1 and
           ABCD2 and ALD-related proteins; mutations in ABCD1 cause
           X-linked adrenoleukodystrophy (X-ALD), a peroxisomal
           disorder
          Length = 870

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 103/209 (49%), Gaps = 31/209 (14%)

Query: 449 NIKVP----PGSNVCIVGPSGRGKSTIALLLLR---YYNPTNGQILVDGQDISKVNCKTL 501
           +IK+P     GS++ I+GP+G GKS+I  ++      YN  NG + +  ++         
Sbjct: 628 DIKLPFLQGSGSSLLILGPNGCGKSSIQRIIAEIWPVYNK-NGLLSIPSEN--------- 677

Query: 502 RRHIGLVQQEPIL-MSGTIRDNITYGLAEPA-------TKEEIRSVAKQCFCHNFITKFP 553
             +I  + Q+P     GT+RD I Y ++           KE ++ + +    +       
Sbjct: 678 --NIFFIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFRDKELVQILVEVKLDYLLKRGVG 735

Query: 554 DGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLM 613
             Y   I     LLSGG++QR+  AR +  KP  +VLDEAT+A+ V+ E   +Y F  L+
Sbjct: 736 LTYLDAIADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN-LL 791

Query: 614 KSGSMTIVSIAHRLSTIKRSENVIVLGKD 642
           K      +SI+ R + IK  E ++ +G++
Sbjct: 792 KRYRFNFISISQRPTLIKYHEMLLEIGEN 820

>TDEL0B05760 Chr2 (1017816..1020926) [3111 bp, 1036 aa] {ON}
           Anc_1.427 YCR011C
          Length = 1036

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 80/296 (27%), Positives = 136/296 (45%), Gaps = 45/296 (15%)

Query: 378 TGSSVFGLTTFYSELMQGVGAASRLF-DLTDHISSISPTKGQKYIPGK--GDIEFKNVSF 434
           T  S+  L TF S  +    + S LF + T H+     T  + ++       + F+N+++
Sbjct: 329 TSMSLLALITFVSFYI----SKSTLFKNGTIHLVDEVETLDESFLKSDNAAALSFENITY 384

Query: 435 SYPT-RPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIA--LLLLRYYNPTNGQILVDGQ 491
           +  + + +  I K I+  + PG  + ++G SG GK+T+   L + R      G I V+G 
Sbjct: 385 NVSSSKTDENILKGISGIIKPGQMMALLGGSGAGKTTLLDILAMKRKTGQVTGSIKVNGS 444

Query: 492 DISKVNCKTLRRHIGLVQQ-----------EPILMSGTIRDNITYGLAEPATK-----EE 535
           DI +   K   + IG V Q           E +L S  +R   ++  A   T+     EE
Sbjct: 445 DIPR---KDFTKLIGFVDQDDYLLPTLTVYETVLNSALLRLPRSFSFAAKQTRVYQVLEE 501

Query: 536 IRSVAKQCFCHNFITKFPDGYDTMIGAQGAL-LSGGQRQRIAIARALIKKPNILVLDEAT 594
           +R +              D  D +IG      +SGG+++R++IA  L+  P IL LDE T
Sbjct: 502 LRIL--------------DIKDRVIGNDFERGISGGEKRRVSIACELVTSPLILFLDEPT 547

Query: 595 SALDVESEGAINYTFGQLMKSGSMTIV-SIAHRLSTIKRSENVIVLGKDGSVIEAG 649
           S LD  +   +     +L K+ + T+V SI    S I +  + +VL  +G ++ +G
Sbjct: 548 SGLDANNANNVVECLVRLAKTYNRTLVLSIHQPRSNIFQLFDKLVLLSNGEMVYSG 603

>TBLA0D04350 Chr4 complement(1076344..1079703) [3360 bp, 1119 aa]
           {ON} Anc_1.427 YCR011C
          Length = 1119

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/305 (24%), Positives = 141/305 (46%), Gaps = 51/305 (16%)

Query: 380 SSVFGLTTFYSELMQGVGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPTR 439
           +++FGLT      +QG       F  + H++++S               F+N+S++ P+ 
Sbjct: 404 TTIFGLTAVADTSIQGRDDD---FLTSKHVAALS---------------FENISYNVPSI 445

Query: 440 PENQ----IFKDINIKVPPGSNVCIVGPSGRGKSTIA--LLLLRYYNPTNGQILVDGQDI 493
            +N     I K+++  V PG  + I+G SG GK+T+   L   R     +G I ++G+++
Sbjct: 446 SDNNSERDILKNVSGIVKPGEIMAILGGSGAGKTTLLDILAFKRKSGHVSGDIKINGKNV 505

Query: 494 SKVNCKTLRRHIGLVQQ-----------EPILMSGTIRDNITYGLAEPATKEEIRSVAKQ 542
           S+   + + + IG V Q           E +L S  +R  +   +     ++ +  V ++
Sbjct: 506 SR---EIISKMIGFVDQDDFLFPTLTVYEAVLNSALLR--LPNSMTFYQKQQRVFQVLEE 560

Query: 543 CFCHNFITKFPDGYDTMIGAQGAL-LSGGQRQRIAIARALIKKPNILVLDEATSALDVES 601
              +N         D +IG      +SGG+++R++IA  L+  P IL LDE TS LD  +
Sbjct: 561 LRIYNI-------KDRLIGDDFERGISGGEKRRVSIACELVTSPLILFLDEPTSGLDSNN 613

Query: 602 EGAINYTFGQLMKSGSMTIVSIAHR-LSTIKRSENVIVLGKDGSVIEAGKFKEL--FANP 658
              +     +L K+ + T+V   H+  S I    + +VL   G ++ +G+ + +  F   
Sbjct: 614 ANNVVECLVRLAKNYNRTLVLTIHQPRSNIFHLFSKLVLLSSGEMVYSGEIRRVGEFLKT 673

Query: 659 NSELC 663
           N   C
Sbjct: 674 NGYRC 678

>KLTH0A01914g Chr1 complement(165071..169570) [4500 bp, 1499 aa] {ON}
            similar to uniprot|P32568 Saccharomyces cerevisiae
            YDR011W SNQ2 ABC transporter
          Length = 1499

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 58/228 (25%), Positives = 113/228 (49%), Gaps = 12/228 (5%)

Query: 429  FKNVSFSYPTR-PENQIFKDINIKVPPGSNVCIVGPSGRGKSTI-ALLLLRYYNPTNGQI 486
            ++NV ++ P R    ++  +++    PG+   ++G SG GK+T+   L  R      G +
Sbjct: 855  WRNVCYTIPYRGSTRRLLDNVSGYCAPGTLTALMGESGAGKTTLLNTLAQRNVGIITGDM 914

Query: 487  LVDGQDISKVNCKTLRRHIGLVQQEPI-LMSGTIRDNITYGLAEPATKEEIRSVAKQCFC 545
            LV+G  I      +  R  G VQQ+ + +   T+R+++ +  A     + +    K  + 
Sbjct: 915  LVNGNHIDA----SFERRTGYVQQQDVHVKEMTVRESLQFA-ARMRRPQSVPEAEKMAYV 969

Query: 546  HNFIT--KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEATSALDVESE 602
             + I      +  D ++G  G  L+  QR++++I   L  KP++L+ LDE TS LD +S 
Sbjct: 970  EDIIEILDMEEYADALVGDVGYGLNVEQRKKVSIGVELAAKPDLLLFLDEPTSGLDSQSS 1029

Query: 603  GAINYTFGQLMKSGSMTIVSIAHRLSTI-KRSENVIVLGKDGSVIEAG 649
             AI     +L ++G   + +I    +T+ ++ + +++L K G  +  G
Sbjct: 1030 WAIVQLMRRLAEAGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFG 1077

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/177 (21%), Positives = 75/177 (42%), Gaps = 18/177 (10%)

Query: 439 RPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLL---LRYYNPTNGQILVDGQDISK 495
           R    I ++ NI   PG  + ++G  G G S+    +   +  +    G+I  DG    +
Sbjct: 168 RKTRDIVRNANILARPGEMILVLGRPGAGCSSFLKTVSGEVDNFEEVRGEISYDGISQKE 227

Query: 496 VNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDG 555
           +  K     I   + +      T++  + + L+    ++ + + ++      +IT   + 
Sbjct: 228 MMAKFKTDVIYNGETDVHFPHLTVQQTLDFALSCTTPQKRLDNASRS----EYITAMREL 283

Query: 556 YDTMIGAQGAL-----------LSGGQRQRIAIARALIKKPNILVLDEATSALDVES 601
           Y T+ G +              +SGG+R+R++IA AL  + +I   D AT  LD  +
Sbjct: 284 YGTIFGLRHTYNTKVGNDFVRGVSGGERKRVSIAEALASRGSIYCWDNATRGLDAST 340

>ABR125C Chr2 complement(623888..628354) [4467 bp, 1488 aa] {ON}
            Non-syntenic homolog of Saccharomyces cerevisiae YDR011W
            (SNQ2), YNR070W and YPL058C (PDR12)
          Length = 1488

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 112/232 (48%), Gaps = 12/232 (5%)

Query: 429  FKNVSFSYPTRPENQIFKD-INIKVPPGSNVCIVGPSGRGKSTIA-LLLLRYYNPTNGQI 486
            ++++SFS     + +   D I     PG+   ++G SG GK+T+   L  R      G +
Sbjct: 854  WRDISFSITHNGDKKKLLDQITGYCIPGTLTALMGESGAGKTTLLNTLAQRNVGVITGDM 913

Query: 487  LVDGQDISKVNCKTLRRHIGLVQQEPI-LMSGTIRDNITYGLAEPATKEEIRSVAKQCFC 545
            LV+G  I      +  R  G VQQ+ + +   T+R+++ +  A     E +    K  + 
Sbjct: 914  LVNGLPIDA----SFERRTGYVQQQDVHVKEMTVRESLQFS-ARLRRPESVSEAEKMNYV 968

Query: 546  HNFIT--KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEATSALDVESE 602
               I      D  D ++G  G  L+  QR++++I   L+ KP++L+ LDE TS LD +S 
Sbjct: 969  EKIIEILGMSDFADALVGDAGYGLNVEQRKKLSIGVELVAKPSLLLFLDEPTSGLDSQSS 1028

Query: 603  GAINYTFGQLMKSGSMTIVSIAHRLSTI-KRSENVIVLGKDGSVIEAGKFKE 653
             AI     +L +SG   + +I    +T+ ++ + +++L K G  +  G   E
Sbjct: 1029 WAIVQLLKRLAQSGQAILCTIHQPSATLFEQFDRLLLLQKGGQTVYFGDIGE 1080

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 38/181 (20%), Positives = 75/181 (41%), Gaps = 26/181 (14%)

Query: 439 RPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLL---LRYYNPTNGQILVDGQDISK 495
           R    I + + +   PG  V ++G  G G +++   +      ++   G I  DG    +
Sbjct: 172 RRYRNILESVTLLARPGEMVLVLGRPGAGCTSLLKTVAGETDQFHSVEGAISYDGIPQRE 231

Query: 496 VNCKTLRRHIGLV----QQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITK 551
           +    +RR+   V    + +      T++  + + LA       + +V++      +IT 
Sbjct: 232 M----MRRYRAEVVYNSEIDVHFPHLTVKQTLDFALACKTPHMRVNNVSRA----EYITL 283

Query: 552 FPDGYDTMIGAQGAL-----------LSGGQRQRIAIARALIKKPNILVLDEATSALDVE 600
             + Y T+ G +              +SGG+R+R++IA AL    ++   D AT  LD  
Sbjct: 284 MRELYATVFGLRHTYDTKVGNDYIRGVSGGERKRVSIAEALAANASVYCWDNATRGLDAS 343

Query: 601 S 601
           +
Sbjct: 344 T 344

>KNAG0K01350 Chr11 complement(265564..270069) [4506 bp, 1501 aa] {ON} 
          Length = 1501

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 138/300 (46%), Gaps = 34/300 (11%)

Query: 429  FKNVSFSYPTRP-ENQIFKDINIKVPPGSNVCIVGPSGRGKSTI-ALLLLRYYNPTNGQI 486
            +++V F+ P    + ++  +++    PG+   ++G SG GK+T+   L  R      G +
Sbjct: 855  WRDVCFTIPYDGGQRRLLDNVSGYCIPGTMTALMGESGAGKTTLLNTLAQRNVGVITGDM 914

Query: 487  LVDGQDISKVNCKTLRRHIGLVQQEPILMSG-TIRDNITYGLAEPATKEEIRSVAKQCFC 545
            LV+G  I      +  R  G VQQ+ I ++  T+R+++ +  A     + I    K  + 
Sbjct: 915  LVNGHPIDT----SFERRTGYVQQQDIHIAEMTVRESLRFS-ARMRRPQHIPDAEKLDYV 969

Query: 546  HNFIT--KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEATSALDVESE 602
               I      +  + ++GA G+ L+  QR++++I   L  KP++L+ LDE TS LD +S 
Sbjct: 970  EKIIQVLNMEEYAEALVGALGSGLNVEQRKKLSIGVELAAKPDLLLFLDEPTSGLDSQSS 1029

Query: 603  GAINYTFGQLMKSGSMTIVSIAHRLSTI-KRSENVIVLGKDGSVIEAGKFKELFANPNSE 661
             AI     +L  SG   + +I    +T+ ++ + +++L K G  +  G   E   N N+ 
Sbjct: 1030 WAIIQLLKKLAASGQSILCTIHQPSATLFEQFDRLLLLKKGGQTVYFGDIGE---NSNTV 1086

Query: 662  LCKLLTEKSSRSDGNDSLPPPPPNATQDKVVEQIAEKILERFPEAGQSPDATVKEIFKDV 721
            L     E++               A +    E  AE ILE     G    A+VKE + D 
Sbjct: 1087 LSYF--ERNG--------------ARKCSAAENPAEYILEAI---GAGATASVKEDWYDT 1127

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 55/244 (22%), Positives = 104/244 (42%), Gaps = 45/244 (18%)

Query: 443 QIFKDINIKVPPGSNVCIVGPSGRGKSTI----ALLLLRYYNPTNGQILVDGQDISKVNC 498
           QI +++N     G  V ++G  G G S+     A  + ++     G I  DG     +  
Sbjct: 175 QILQNVNCLAKAGEMVLVLGRPGAGCSSFLKVTAGEIDQFAGGVLGDIAYDG-----IPQ 229

Query: 499 KTLRRHIGLVQQEPILMSG---------TIRDNITYGLAEPATKEEIRSVAKQCFCHNFI 549
           K + +H     +  ++ +G         T++  + + +A     + + +V++      +I
Sbjct: 230 KEMMKHY----KADVIYNGELDVHFPYLTVQQTLDFAIACKTPAKRVNNVSRS----EYI 281

Query: 550 TKFPDGYDTMIGAQGAL-----------LSGGQRQRIAIARALIKKPNILVLDEATSALD 598
               + Y T+ G +              +SGG+R+R++IA AL  K +I   D AT  LD
Sbjct: 282 ASTRELYATIFGLRHTYHTKVGNDFVRGVSGGERKRVSIAEALAAKGSIYCWDNATRGLD 341

Query: 599 VESEGAINYTFG-QLMKS--GSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKF---K 652
             +  A+ Y    ++M +  GS   V+I      I  + + +V+  +G  I  G+    K
Sbjct: 342 AST--ALEYARAIRIMTNLLGSTAFVTIYQASENIYETFDKVVVLYEGRQIYYGEIDDAK 399

Query: 653 ELFA 656
           + FA
Sbjct: 400 DYFA 403

>TBLA0D01820 Chr4 (448516..453171) [4656 bp, 1551 aa] {ON} 
          Length = 1551

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 68/269 (25%), Positives = 123/269 (45%), Gaps = 24/269 (8%)

Query: 396  VGAASRLFDLTDHISSISPTKGQKYIPGKGDIEFKNVSFSYPTRPENQ-IFKDINIKVPP 454
            +  +S   D  D +S+     G + I       ++N+ +    + E + I  +++  V P
Sbjct: 867  INESSHYHDDNDAVSNEVNITGSEAI-----FHWRNLCYDVQIKTETRRILNNVDGWVKP 921

Query: 455  GSNVCIVGPSGRGKSTIALLLLRYYN--PTNGQILVDGQDISKVNCKTLRRHIGLVQQEP 512
            G+   ++G SG GK+T+   L          G + +DG    K   ++  R IG  QQ+ 
Sbjct: 922  GTLTALMGASGAGKTTLLDCLAERVTMGVITGDVFIDG----KPRDESFPRSIGYCQQQD 977

Query: 513  I-LMSGTIRDNITYG--LAEPATKEEIRSVAKQCFCHNFIT--KFPDGYDTMIGAQGALL 567
            + L + T+R+++ +   L +PA   E+    K  +  + I   +     D ++G  G  L
Sbjct: 978  LHLKTATVRESLRFSAYLRQPA---EVSIAEKNAYVEDIIKILEMEKYADAIVGVAGEGL 1034

Query: 568  SGGQRQRIAIARALIKKPNILV-LDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHR 626
            +  QR+R+ I   L  KP +LV LDE TS LD ++  AI     +L   G   + +I H+
Sbjct: 1035 NVEQRKRLTIGVELAAKPKLLVFLDEPTSGLDSQTAWAICQLMRKLCNQGQAILCTI-HQ 1093

Query: 627  LSTI--KRSENVIVLGKDGSVIEAGKFKE 653
             S I  +  + ++ + + G     G+  E
Sbjct: 1094 PSAILMQEFDRLLFMQRGGQTCYFGELGE 1122

>KAFR0E03450 Chr5 complement(689571..694232) [4662 bp, 1553 aa] {ON} 
          Length = 1553

 Score = 69.3 bits (168), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 71/266 (26%), Positives = 121/266 (45%), Gaps = 28/266 (10%)

Query: 427  IEFKNVSFSYPTRPENQ-IFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYN--PTN 483
              ++++ +    + E + +  +++  V PG+   ++G SG GK+T+   L          
Sbjct: 908  FHWRDLCYDVQIKSETRRLLNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVIT 967

Query: 484  GQILVDGQDISKVNCKTLRRHIGLVQQEPI-LMSGTIRDNITYG--LAEPA--TKEEIRS 538
            G I VDG    ++  ++  R IG  QQ+ + L + T+R+++ +   L +PA  TKEE   
Sbjct: 968  GNIFVDG----RLRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPASVTKEEKDH 1023

Query: 539  VAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEATSAL 597
              +Q      I +     D ++G  G  L+  QR+R+ I   L  KP +LV LDE TS L
Sbjct: 1024 YVEQVIK---ILEMETYADAVVGVPGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGL 1080

Query: 598  DVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSE--NVIVLGKDGSVIEAGKFKELF 655
            D ++  A      +L   G   + +I H+ S I   E   ++ L K G  +  G      
Sbjct: 1081 DSQTAWATCQLMRKLANHGQAILCTI-HQPSAILMQEFDRLLFLQKGGKTVYFGDL---- 1135

Query: 656  ANPNSELCKLLTEKSSRSDGNDSLPP 681
                 + CK + E   +  G  + PP
Sbjct: 1136 ----GKGCKTMIEYFEK-HGAQACPP 1156

>TPHA0D04700 Chr4 (1026978..1031510) [4533 bp, 1510 aa] {ON} 
          Length = 1510

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 75/279 (26%), Positives = 124/279 (44%), Gaps = 31/279 (11%)

Query: 427  IEFKNVSFSYPTRPENQ-IFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYN--PTN 483
              ++N+ +    + E + I  +++  V PG+   ++G SG GK+T+   L          
Sbjct: 868  FHWRNLCYDVQIKSETRRILNNVDGWVKPGTLTALMGSSGAGKTTLLDCLAERVTMGVIT 927

Query: 484  GQILVDG--QDISKVNCKTLRRHIGLVQQEPI-LMSGTIRDNITYG--LAEPATKEEIRS 538
            G I VDG  +D S        R IG  QQ+ + L + T+R+++ +   L +PA   ++  
Sbjct: 928  GDIFVDGLPRDTS------FPRSIGYCQQQDLHLTTATVRESLRFSAELRQPA---DVSV 978

Query: 539  VAKQCFCHNFIT--KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEATS 595
              K  +    I   +     D ++G  G  L+  QR+R+ I   L  KP +LV LDE TS
Sbjct: 979  SEKHAYVEEVIKILEMEKYADAVVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTS 1038

Query: 596  ALDVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSE--NVIVLGKDGSVIEAGKFKE 653
             LD ++  +I     +L K G   + +I H+ S I   E   ++ L K G  +    F E
Sbjct: 1039 GLDSQTAWSICQLMKKLAKFGQAILCTI-HQPSAILMQEFDRLLFLQKGGKTV---YFGE 1094

Query: 654  LFANPNSELCKLLTEKSSRSDGNDSLPPPPPNATQDKVV 692
            L  N     C  + +   R+  +   P   P     +VV
Sbjct: 1095 LGDN-----CTTMIDYFERNGAHKCPPDANPAEWMLEVV 1128

>Smik_6.344 Chr6 complement(548373..550985) [2613 bp, 870 aa] {ON}
           YPL147W (REAL)
          Length = 870

 Score = 68.6 bits (166), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 107/211 (50%), Gaps = 35/211 (16%)

Query: 449 NIKVP----PGSNVCIVGPSGRGKSTIALLLLR---YYNPTNGQILVDGQDISKVNCKTL 501
           +IK+P     GS++ I+GP+G GKS+I  ++      YN  NG + +  ++         
Sbjct: 628 DIKLPFLQGSGSSLLILGPNGCGKSSIQRIIAEIWPVYNK-NGLLSIPPEN--------- 677

Query: 502 RRHIGLVQQEPIL-MSGTIRDNITYGLAEP-------ATKEEIRSVAKQCFCHNFITKFP 553
             +I  + Q+P     GT+RD I Y ++           KE ++ + +     +++ K  
Sbjct: 678 --NIFFIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFKDKELVQILVEVKL--DYLLKRA 733

Query: 554 DG--YDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQ 611
            G  Y   +     LLSGG++QR+  AR +  KP  +VLDEAT+A+ V+ E   +Y F  
Sbjct: 734 VGLTYLDAVADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDME---DYLFN- 789

Query: 612 LMKSGSMTIVSIAHRLSTIKRSENVIVLGKD 642
           L+K      +SI+ R + IK  E ++ +G++
Sbjct: 790 LLKRYRFNFISISQRPTLIKYHEMLLEIGEN 820

>TBLA0C01220 Chr3 complement(263093..265348) [2256 bp, 751 aa] {ON}
           Anc_1.366 YFR009W
          Length = 751

 Score = 68.2 bits (165), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 103/227 (45%), Gaps = 34/227 (14%)

Query: 427 IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI 486
           I+ ++VSF Y  +  N + KD+N+ V   S + +VG +G GK+T+  +++    P  G +
Sbjct: 531 IQLQDVSFGYDEK--NLLLKDVNLDVQMDSRIALVGANGCGKTTLLKVMMNQLKPLKGYV 588

Query: 487 LVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITY-GLAEPA-TKEEIRSVAKQCF 544
             +G           R  IG   Q  +      +  + +  +  P  T EE R       
Sbjct: 589 SSNG-----------RLRIGYFTQHHVDSMDLTKSAVDWMSVKYPGKTDEEYR------- 630

Query: 545 CHNFITKFPDGYDTMIGAQG-ALLSGGQRQRIAIARALIKKPNILVLDEATSALDVESEG 603
               +  F  G    +G Q   LLSGGQ+ R+A A   +  P+ILVLDE ++ LD     
Sbjct: 631 --RHLGSF--GITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILVLDEPSNHLDNTGLD 686

Query: 604 AI-----NYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSV 645
           A+     N++ G LM S  ++++        I  SEN  V   DG++
Sbjct: 687 ALVESLKNFSGGVLMVSHDISVIDSV--CKEIWVSENGTVRRFDGTI 731

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 39/59 (66%), Gaps = 4/59 (6%)

Query: 567 LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625
            SGG R R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +K+   T++ ++H
Sbjct: 367 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LSEYLKTYPSTLLVVSH 421

>TBLA0D01780 Chr4 complement(438830..443617) [4788 bp, 1595 aa] {ON}
            Anc_5.500 YDR406W
          Length = 1595

 Score = 68.2 bits (165), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 111/238 (46%), Gaps = 19/238 (7%)

Query: 427  IEFKNVSFSYPTRPENQ-IFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYN--PTN 483
              ++N+ +    + E + I  +++  V PG+   ++G SG GK+T+   L          
Sbjct: 951  FHWRNLCYDVQIKKETRRILNNVDGWVKPGTLTALMGASGAGKTTLLDCLAERVTMGVIT 1010

Query: 484  GQILVDGQDISKVNCKTLRRHIGLVQQEPI-LMSGTIRDNITYG--LAEPATKEEIRSVA 540
            G + +DG    K   ++  R IG  QQ+ + L + T+R+++ +   L +PA   E+    
Sbjct: 1011 GDVFIDG----KPRDESFPRSIGYCQQQDLHLKTATVRESLRFSAYLRQPA---EVSIAE 1063

Query: 541  KQCFCHNFIT--KFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILV-LDEATSAL 597
            K  +  + I   +     D ++G  G  L+  QR+R+ I   L  KP +LV LDE TS L
Sbjct: 1064 KNAYVEDIIKILEMEKYADAIVGVAGEGLNVEQRKRLTIGVELAAKPKLLVFLDEPTSGL 1123

Query: 598  DVESEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSE--NVIVLGKDGSVIEAGKFKE 653
            D ++  AI     +L   G   + +I H+ S I   E   ++ + + G     G+  E
Sbjct: 1124 DSQTAWAICQLMRKLCNQGQAILCTI-HQPSAILMQEFDRLLFMQRGGQTCYFGELGE 1180

>AFR232C Chr6 complement(859612..861435) [1824 bp, 607 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER036C
           (ARB1)
          Length = 607

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 60/240 (25%), Positives = 98/240 (40%), Gaps = 52/240 (21%)

Query: 427 IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI 486
           + F  +SFSY   PEN +++ +N  V   S   +VGP+G GKST+  ++     P  G++
Sbjct: 390 LAFDEISFSYDGNPENNLYEKLNFGVDMDSRTALVGPNGVGKSTLLKIMTGELTPHGGRV 449

Query: 487 --------------LVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPAT 532
                           D  D++K   + +R     + ++     G +     YGL   A 
Sbjct: 450 SRHTHVKLGVYSQHSQDQLDLTKSALEFVRDKYAHISEDFQFWRGQLG---RYGLTGEAQ 506

Query: 533 KEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDE 592
                                        AQ A LS GQR R+  A   +++PN+L+LDE
Sbjct: 507 T----------------------------AQMATLSEGQRSRVVFALLALEQPNVLLLDE 538

Query: 593 ATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRL-----STIKRSENVIVLGKDGSVIE 647
            T+ LD+ +  ++         +G + +VS   RL       I   EN      DGS+++
Sbjct: 539 PTNGLDIPTIDSLADAIDAF--NGGVVVVSHDFRLLDRIAKDIYVVENKTATRWDGSILD 596

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 37/59 (62%), Gaps = 4/59 (6%)

Query: 567 LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625
           +SGG + R+A+A+AL  KP +L+LD+ T+ LD+E+         + +K    T+V ++H
Sbjct: 224 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA----CVWLEEYLKRFDRTLVLVSH 278

>CAGL0K10472g Chr11 (1020845..1023103) [2259 bp, 752 aa] {ON} highly
           similar to uniprot|P43535 Saccharomyces cerevisiae
           YFR009w GCN20 positive effector of GCN2P
          Length = 752

 Score = 67.8 bits (164), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 95/211 (45%), Gaps = 46/211 (21%)

Query: 427 IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI 486
           I+ ++VSF Y   P+  + KD+N+ +   S + +VG +G GK+T+  ++L    P +G +
Sbjct: 532 IQLQDVSFGYS--PDKLLLKDVNLDIQMDSRIALVGANGCGKTTLLKVMLEQLRPLSGYV 589

Query: 487 LVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCH 546
                       +  R  IG   Q  +       D++           ++ + A      
Sbjct: 590 -----------SRNPRLRIGYFTQHHV-------DSM-----------DLSTSAVDWMSK 620

Query: 547 NFITKFPDGYDTMIGAQG----------ALLSGGQRQRIAIARALIKKPNILVLDEATSA 596
            F  K  + Y   +G+ G           LLSGGQ+ R+A A   +  P+IL+LDE ++ 
Sbjct: 621 TFPGKTDEEYRRHLGSFGITGTLGLQKMQLLSGGQKSRVAFAALCLNNPHILILDEPSNH 680

Query: 597 LDVESEGAI-----NYTFGQLMKSGSMTIVS 622
           LD     A+     N+T G LM S  +++++
Sbjct: 681 LDTTGIDALVDAMKNFTGGILMVSHDISVIN 711

 Score = 46.2 bits (108), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 40/59 (67%), Gaps = 4/59 (6%)

Query: 567 LSGGQRQRIAIARALIKKPNILVLDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAH 625
            SGG R R+++ARAL  +P++L+LDE ++ LDV S   I Y   + +KS   T+++++H
Sbjct: 368 FSGGWRMRLSLARALFCQPDLLLLDEPSNMLDVPS---IAY-LAEYLKSYPSTVLTVSH 422

>ZYRO0E08800g Chr5 complement(702554..704386) [1833 bp, 610 aa] {ON}
           highly similar to uniprot|P40024 Saccharomyces
           cerevisiae YER036C
          Length = 610

 Score = 67.4 bits (163), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 65/244 (26%), Positives = 101/244 (41%), Gaps = 60/244 (24%)

Query: 427 IEFKNVSFSYPTRPENQIFKDINIKVPPGSNVCIVGPSGRGKSTIALLLLRYYNPTNGQI 486
           + F  +SF+Y   PE+ +++++N  V   S + +VGP+G GKST+  ++     P  G++
Sbjct: 393 LAFDEISFAYDGNPEHNLYENLNFGVDMDSRIALVGPNGVGKSTLLKIMTGDLTPQAGRV 452

Query: 487 --------------LVDGQDISKVNCKTLRRHIGLVQQEPILMSGTIRDNITYGLAEPAT 532
                           D  D++K   + +R     + Q+     G +     YGL     
Sbjct: 453 SRHTHVKLGVYSQHSQDQLDLTKSALEFVREKYSHISQDFQYWRGQLG---RYGLTGDGQ 509

Query: 533 KEEIRSVAKQCFCHNFITKFPDGYDTMIGAQGALLSGGQRQRIAIARALIKKPNILVLDE 592
           K                            AQ   LS GQR R+  A   ++ PNIL+LDE
Sbjct: 510 K----------------------------AQMGTLSEGQRSRVVFALLALQAPNILLLDE 541

Query: 593 ATSALDVES----EGAINYTFGQLMKSGSMTIVSIAHRL-----STIKRSENVIVLGKDG 643
            T+ LD+ +      AIN TF     +G + +VS   RL       I   EN      DG
Sbjct: 542 PTNGLDIPTIDSLAEAIN-TF-----NGGVVVVSHDFRLLDKIAQDIFVVENKTAYRWDG 595

Query: 644 SVIE 647
           S++E
Sbjct: 596 SILE 599

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 17/35 (48%), Positives = 28/35 (80%)

Query: 567 LSGGQRQRIAIARALIKKPNILVLDEATSALDVES 601
           +SGG + R+A+A+AL  KP +L+LD+ T+ LD+E+
Sbjct: 227 MSGGWKMRVALAKALFVKPTLLLLDDPTAHLDLEA 261

>TBLA0G02820 Chr7 (745762..750297) [4536 bp, 1511 aa] {ON} Anc_3.220
            YDR011W
          Length = 1511

 Score = 68.2 bits (165), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 71/274 (25%), Positives = 127/274 (46%), Gaps = 33/274 (12%)

Query: 454  PGSNVCIVGPSGRGKSTI-ALLLLRYYNPTNGQILVDGQDISKVNCKTLRRHIGLVQQEP 512
            PG+   ++G SG GK+T+   L  R      G +LV+GQ I      +  R  G VQQ+ 
Sbjct: 897  PGTMTALMGESGAGKTTLLNTLAQRNVGIITGDMLVNGQPIDA----SFERRAGYVQQQD 952

Query: 513  ILMSG-TIRDNITYGLAEPATKEEIRSVAKQCFCHNFIT--KFPDGYDTMIGAQGALLSG 569
            + ++  T+R+++ +  A     +++    K  +    I      +  + ++GA G  L+ 
Sbjct: 953  LHVAEMTVRESLQFS-ARMRRNQDVPDEEKMAYVEKIIEVLGMEEYSEALVGAIGCGLNV 1011

Query: 570  GQRQRIAIARALIKKPNILV-LDEATSALDVESEGAINYTFGQLMKSGSMTIVSIAHRLS 628
             QR++++I   L+ KP++L+ LDE TS LD +S  AI     +L  +G   + +I    +
Sbjct: 1012 EQRKKLSIGVELVAKPDLLLFLDEPTSGLDSQSSWAIVQLLKKLANAGQSILCTIHQPSA 1071

Query: 629  TI-KRSENVIVLGKDGSVIEAGKFKELFANPNSELCKLLTEKSSRSDGNDSLPPPPPNAT 687
            T+ ++ + +++L K G  +  G   E     NS++     E++       S  P      
Sbjct: 1072 TLFEQFDRLLLLKKGGQTVYFGDIGE-----NSDILLKYFERNGARKCTSSENP------ 1120

Query: 688  QDKVVEQIAEKILERFPEAGQSPDATVKEIFKDV 721
                    AE ILE     G    A+V+E + +V
Sbjct: 1121 --------AEYILEAI---GAGATASVQEDWHEV 1143

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 57/233 (24%), Positives = 98/233 (42%), Gaps = 32/233 (13%)

Query: 443 QIFKDINIKVPPGSNVCIVGPSGRGKS----TIALLLLRYYNPTNGQILVDGQDISKV-- 496
           +I ++IN+   PG  V ++G  G G S    T A  + ++     G+I  DG   S++  
Sbjct: 191 KIIQNINVLAKPGEMVLVLGRPGAGCSSFLKTTAGEIDQFAGGVEGEIYYDGIPQSEMMK 250

Query: 497 NCKTLRRHIG-LVQQEPILMSGTIRDNITYGLAEPATKEEIRSVAKQCFCHNFITKFPDG 555
           N K    + G L    P L   T++  + + +A       + ++++     ++I    D 
Sbjct: 251 NYKADVIYNGELDVHFPYL---TVQQTLDFAIACKTPAIRVDNLSRS----DYIAFIRDL 303

Query: 556 YDTMIGAQGAL-----------LSGGQRQRIAIARALIKKPNILVLDEATSALD----VE 600
           Y T+ G +              +SGG+R+R++IA AL  +  I   D AT  LD    +E
Sbjct: 304 YATIFGLRHTYNTLVGNDFVRGVSGGERKRVSIAEALAARGTIYCWDNATRGLDASTALE 363

Query: 601 SEGAINYTFGQLMKSGSMTIVSIAHRLSTIKRSENVIVLGKDGSVIEAGKFKE 653
              AI         +  +TI   +  +        V+ LGK    I  GK ++