Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0E09570g3.569ON70670637370.0
NCAS0E002503.569ON70870430280.0
NDAI0I032503.569ON70970430200.0
KAFR0J028903.569ON70670430120.0
KNAG0I002203.569ON70770429790.0
TDEL0D063703.569ON70670729770.0
Suva_7.163.569ON70870429690.0
YGL245W (GUS1)3.569ON70870429530.0
Smik_7.163.569ON70870429500.0
Kpol_507.83.569ON70770429400.0
CAGL0C01947g3.569ON70570529280.0
Skud_7.223.569ON70870429160.0
SAKL0F00748g3.569ON70770528970.0
Kwal_47.192723.569ON70470928540.0
AFR264W3.569ON70770428290.0
KLTH0G00682g3.569ON70470728260.0
TPHA0A060203.569ON70770628240.0
KLLA0A00682g3.569ON70870728010.0
TBLA0E001903.569ON70770427860.0
YOR168W (GLN4)6.51ON8093756064e-67
Smik_15.3486.51ON8103775942e-65
TDEL0G041906.51ON8093775906e-65
Skud_15.3326.51ON8093755862e-64
ZYRO0C07018g6.51ON8034195835e-64
KNAG0M011006.51ON7993785835e-64
Suva_8.2236.51ON8213755821e-63
SAKL0E02134g6.51ON8013805783e-63
NDAI0K028606.51ON8143755703e-62
CAGL0L04532g6.51ON7953795686e-62
TBLA0G004506.51ON8083755652e-61
Kpol_1037.386.51ON8083775652e-61
AGR259C6.51ON7983805642e-61
Kwal_56.225596.51ON8003805633e-61
KLTH0C10340g6.51ON8003775623e-61
TPHA0J005506.51ON8083785617e-61
KAFR0G026106.51ON7943735591e-60
NCAS0F002406.51ON8113795572e-60
Ecym_31356.51ON8043805431e-58
KLLA0F20449g6.51ON8043785371e-57
KNAG0L006207.100ON5172321752e-12
NDAI0A084607.100ON5292671691e-11
NCAS0I005607.100ON5272171564e-10
CAGL0F01133g7.100ON5322191502e-09
TPHA0L005907.100ON5582781458e-09
Suva_15.1347.100ON5353651451e-08
YOL033W (MSE1)7.100ON5363671451e-08
KAFR0D013207.100ON5142381432e-08
Skud_15.1227.100ON5323231386e-08
Ecym_26267.100ON5733151379e-08
KLLA0F07975g7.100ON5422751323e-07
Kpol_1044.127.100ON5362271323e-07
TBLA0E021807.100ON5312781315e-07
TDEL0H035007.100ON5342371271e-06
AEL338C7.100ON5332361271e-06
Smik_15.1327.100ON5351171181e-05
KLTH0D02794g7.100ON5462321163e-05
SAKL0B09548g7.100ON5541301163e-05
Kwal_26.72027.100ON5672361153e-05
ZYRO0D05808g7.100ON5331161074e-04
TDEL0A036605.502ON54968830.20
Smik_12.4694.236ON89566810.43
Skud_7.1706.153ON37764790.56
YGL105W (ARC1)6.153ON37664790.64
Smik_7.1696.153ON37664780.75
Suva_7.1626.153ON37864770.95
SAKL0G04180g5.502ON54069761.4
TPHA0B023104.236ON91082761.8
NCAS0H024405.502ON55768742.7
NDAI0C012105.502ON55767733.2
TBLA0I028804.236ON892181743.4
ZYRO0G00990g1.360ON213153725.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0E09570g
         (706 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {...  1444   0.0  
NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569     1170   0.0  
NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {O...  1167   0.0  
KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {...  1164   0.0  
KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569...  1152   0.0  
TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa] ...  1151   0.0  
Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1148   0.0  
YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}  GUS1Glutamyl...  1142   0.0  
Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1140   0.0  
Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON} (51597..53...  1137   0.0  
CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly...  1132   0.0  
Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)  1127   0.0  
SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly s...  1120   0.0  
Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]...  1103   0.0  
AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic ho...  1094   0.0  
KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly s...  1093   0.0  
TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa] ...  1092   0.0  
KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly s...  1083   0.0  
TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569...  1077   0.0  
YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}  GLN4Gluta...   238   4e-67
Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168...   233   2e-65
TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.5...   231   6e-65
Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168...   230   2e-64
ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly...   229   5e-64
KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6....   229   5e-64
Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W ...   228   1e-63
SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {...   227   3e-63
NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6....   224   3e-62
CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highl...   223   6e-62
TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}...   222   2e-61
Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {O...   222   2e-61
AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}...   221   2e-61
Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {...   221   3e-61
KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly...   221   3e-61
TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {...   220   7e-61
KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.5...   219   1e-60
NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}...   219   2e-60
Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar t...   213   1e-58
KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} high...   211   1e-57
KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON...    72   2e-12
NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON} Anc_7...    70   1e-11
NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}...    65   4e-10
CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {...    62   2e-09
TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {...    60   8e-09
Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033...    60   1e-08
YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}  MSE1Mitoc...    60   1e-08
KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {O...    60   2e-08
Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033...    58   6e-08
Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar...    57   9e-08
KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {...    55   3e-07
Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {O...    55   3e-07
TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {O...    55   5e-07
TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.1...    54   1e-06
AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON} Syn...    54   1e-06
Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033...    50   1e-05
KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {...    49   3e-05
SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} simila...    49   3e-05
Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {O...    49   3e-05
ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {...    46   4e-04
TDEL0A03660 Chr1 (652837..654486) [1650 bp, 549 aa] {ON} Anc_5.5...    37   0.20 
Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {...    36   0.43 
Skud_7.170 Chr7 (311782..312915) [1134 bp, 377 aa] {ON} YGL105W ...    35   0.56 
YGL105W Chr7 (307437..308567) [1131 bp, 376 aa] {ON}  ARC1Protei...    35   0.64 
Smik_7.169 Chr7 (302749..303879) [1131 bp, 376 aa] {ON} YGL105W ...    35   0.75 
Suva_7.162 Chr7 (302203..303339) [1137 bp, 378 aa] {ON} YGL105W ...    34   0.95 
SAKL0G04180g Chr7 (343513..345135) [1623 bp, 540 aa] {ON} simila...    34   1.4  
TPHA0B02310 Chr2 (527211..529943) [2733 bp, 910 aa] {ON} Anc_4.2...    34   1.8  
NCAS0H02440 Chr8 (484622..486295) [1674 bp, 557 aa] {ON} Anc_5.5...    33   2.7  
NDAI0C01210 Chr3 complement(241458..243131) [1674 bp, 557 aa] {O...    33   3.2  
TBLA0I02880 Chr9 complement(680214..682892) [2679 bp, 892 aa] {O...    33   3.4  
ZYRO0G00990g Chr7 complement(74957..81352) [6396 bp, 2131 aa] {O...    32   5.1  

>ZYRO0E09570g Chr5 complement(762205..764325) [2121 bp, 706 aa] {ON}
           highly similar to uniprot|P46655 Saccharomyces
           cerevisiae YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS)
           forms a complex with methionyl-tRNA synthetase (Mes1p)
           and Arc1p complex formation increases the catalytic
           efficiency of both tRNA synthetases and ensures their
           correct localization to the cytoplasm
          Length = 706

 Score = 1444 bits (3737), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 698/706 (98%), Positives = 698/706 (98%)

Query: 1   MVNLVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIIS 60
           MVNLVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIIS
Sbjct: 1   MVNLVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIIS 60

Query: 61  TYPDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAAD 120
           TYPDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAAD
Sbjct: 61  TYPDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAAD 120

Query: 121 IVCWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGK 180
           IVCWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGK
Sbjct: 121 IVCWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGK 180

Query: 181 KKEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFD 240
           KKEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFD
Sbjct: 181 KKEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFD 240

Query: 241 DTNPSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVE 300
           DTNPSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVE
Sbjct: 241 DTNPSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVE 300

Query: 301 KMREERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVI 360
           KMREERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVI
Sbjct: 301 KMREERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVI 360

Query: 361 YRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLR 420
           YRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLR
Sbjct: 361 YRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLR 420

Query: 421 KVHIWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVI 480
           KVHIWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPT        MTVEGLRNFVI
Sbjct: 421 KVHIWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVI 480

Query: 481 SQGPSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHK 540
           SQGPSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHK
Sbjct: 481 SQGPSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHK 540

Query: 541 KNPAVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGD 600
           KNPAVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGD
Sbjct: 541 KNPAVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGD 600

Query: 601 FKKTKHKVTWLANTDYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVK 660
           FKKTKHKVTWLANTDYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVK
Sbjct: 601 FKKTKHKVTWLANTDYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVK 660

Query: 661 DMKVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           DMKVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK
Sbjct: 661 DMKVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706

>NCAS0E00250 Chr5 (36306..38432) [2127 bp, 708 aa] {ON} Anc_3.569
          Length = 708

 Score = 1170 bits (3028), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/704 (78%), Positives = 622/704 (88%), Gaps = 1/704 (0%)

Query: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63
           LVINGKAPVVAYAELIA+RIVN    ++I++EFVD+K AAP  FNG + D F KI++ + 
Sbjct: 5   LVINGKAPVVAYAELIAARIVNETKPNSISIEFVDDKKAAPATFNGDNKDAFLKIVAQFS 64

Query: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123
           DVF +   E++  W+K+A E+LV+KNFQ+LS+SL +LDA LNLRTFILGGLK SAADI C
Sbjct: 65  DVFSNSKEEDITQWVKMASEELVIKNFQKLSESLGKLDAHLNLRTFILGGLKYSAADIAC 124

Query: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183
           WGALRSNGM GSIIKNKV VNVSRWYTLLE++P FG  HE+LTKS+Q +KK   AGKKKE
Sbjct: 125 WGALRSNGMCGSIIKNKVEVNVSRWYTLLEMDPIFGSVHEFLTKSLQELKKTANAGKKKE 184

Query: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243
            HKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILN+YFA AYKGKLIIRFDDTN
Sbjct: 185 THKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTN 244

Query: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303
           PSKE+ EFQD+ILEDLEL+GIKGD+IT+SSDYFQEMYD C+Q+IKEGKAYCDDT  EKMR
Sbjct: 245 PSKEKEEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCIQMIKEGKAYCDDTPTEKMR 304

Query: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363
           EERM+GI SA+RD SVEENL+IFTEEMKNGTE G KNCVRAKIDYKA NKTLRDPVIYRC
Sbjct: 305 EERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC 364

Query: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423
           NLTPHHRT   WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQY+WML+AL LRKVH
Sbjct: 365 NLTPHHRTGTTWKVYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLQALNLRKVH 424

Query: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQG 483
           IWDFARVNF+RTLLSKRKLQWMVD GLVSNWDDPRFPT        MTVEGLRNFV+SQG
Sbjct: 425 IWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQG 484

Query: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543
           PS+NVINLEWNLIWA NKK+IDPVAPRHTA+V+PV+I LEG+  P+TPK+E+KPKHKKNP
Sbjct: 485 PSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHLEGDDVPQTPKIEMKPKHKKNP 544

Query: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603
           AVGEKKVIY   I+IDK+DA +LE  EE+T+MDWGN+IIT KNADGSLV K +L GDFKK
Sbjct: 545 AVGEKKVIYFKDIVIDKDDADLLEANEEVTMMDWGNVIITQKNADGSLVGKLHLEGDFKK 604

Query: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662
           TKHK+TWLA+T D VPV++VDFDHLITKDKLEEDE+F DF+TP TEFHT A+ D+NVKDM
Sbjct: 605 TKHKLTWLADTPDVVPVDLVDFDHLITKDKLEEDESFEDFLTPVTEFHTDAIADLNVKDM 664

Query: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           KVGDIIQFERKGY RLD+  +  KPY+FFTIPDGKSVN+YGAKK
Sbjct: 665 KVGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>NDAI0I03250 Chr9 complement(762687..764816) [2130 bp, 709 aa] {ON}
           Anc_3.569 YGL245W
          Length = 709

 Score = 1167 bits (3020), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/704 (78%), Positives = 619/704 (87%), Gaps = 1/704 (0%)

Query: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63
           LVINGKAPVVAY +LIA+RI+N A   +I ++FVD+K +AP VFNGSSD TF KII  +P
Sbjct: 6   LVINGKAPVVAYGDLIAARIINDAKPTSIDIQFVDDKKSAPSVFNGSSDSTFLKIIEGFP 65

Query: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123
           ++F   + + VA W K+A E+LVVKNFQ+LS+SL +LDA LNLRTFILGGLK SAADI C
Sbjct: 66  EIFTESNKDAVAEWTKIANEELVVKNFQKLSESLGKLDAQLNLRTFILGGLKYSAADIAC 125

Query: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183
           WGALRSNGM GSI+KNKV VNVSRWY+LLE++P+FG  HE LTKS+Q +KK   +GKKKE
Sbjct: 126 WGALRSNGMCGSILKNKVDVNVSRWYSLLEMDPTFGSVHESLTKSLQELKKVSNSGKKKE 185

Query: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243
            HKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILN+YFA AYKGKLIIRFDDTN
Sbjct: 186 THKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTN 245

Query: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303
           PSKE+ EFQD+ILEDLEL+GIKGD+ITYSSDYFQ+MY+LCV++IKEGKAYCDDT  EKMR
Sbjct: 246 PSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQQMYELCVKMIKEGKAYCDDTPTEKMR 305

Query: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363
           EERM+GI SA+RD SVEENLRIF EEMKNGTE G KNCVRAKIDYKA NKTLRDPVIYRC
Sbjct: 306 EERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC 365

Query: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423
           NLTPHHRT   WKMYPTYDFCVPIVDS+EGVTHALRTIEYRDRNAQYDWML A+ LRKVH
Sbjct: 366 NLTPHHRTGTTWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYDWMLDAMNLRKVH 425

Query: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQG 483
           IWDFARVNF+RTLLSKRKLQWMVD GLVSNWDDPRFPT        MTVEGLRNFV+SQG
Sbjct: 426 IWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQG 485

Query: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543
           PS+NVINLEWNLIWA NKK+IDPVA RHTA+VDPV+I LEG+  P+TPK E+KPKHKKNP
Sbjct: 486 PSRNVINLEWNLIWAFNKKVIDPVAARHTAIVDPVKIHLEGDDVPQTPKTEMKPKHKKNP 545

Query: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603
           AVGEKKVIY   I+IDK DA ++E  EE+T+MDWGN+IIT KNADGS+V K +L GDFKK
Sbjct: 546 AVGEKKVIYYKDIVIDKADADLIEENEEVTMMDWGNVIITKKNADGSMVGKLHLDGDFKK 605

Query: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662
           TKHK+TWLA+T D VPV++VDFDHLI+KDKLEEDE+F DF+TP TEFHT A+ D+NVKDM
Sbjct: 606 TKHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPTTEFHTSAIADLNVKDM 665

Query: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           KVGDIIQFERKGY RLD+ A+  KPY+FFTIPDGKSVN+YGAKK
Sbjct: 666 KVGDIIQFERKGYYRLDAVAKDGKPYVFFTIPDGKSVNKYGAKK 709

>KAFR0J02890 Chr10 complement(549654..551774) [2121 bp, 706 aa] {ON}
           Anc_3.569 YGL245W
          Length = 706

 Score = 1164 bits (3012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 550/704 (78%), Positives = 620/704 (88%), Gaps = 3/704 (0%)

Query: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63
           LVINGKAPVVAY  LIA+R+VNAA  DAI +EFVD+K +AP  FNGSS+ +F KI++ +P
Sbjct: 5   LVINGKAPVVAYDSLIAARLVNAARPDAIKIEFVDDKKSAPATFNGSSEGSFNKIVAAFP 64

Query: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123
           D F   ++   + WI VA E+ +VKNFQ+L+QSLE+LDA LNLRTFI GGL+ SAADI  
Sbjct: 65  DAF--RNANVASEWINVASEEFIVKNFQKLAQSLEKLDAYLNLRTFISGGLEYSAADIAA 122

Query: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183
           WGALRSNGMVGSIIKNKVYVNVSRWY+LLE++P FG  HE+LTKS+Q +KK  +AGKKKE
Sbjct: 123 WGALRSNGMVGSIIKNKVYVNVSRWYSLLEMDPLFGTVHEFLTKSLQELKKNASAGKKKE 182

Query: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243
            HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGKLIIRFDDTN
Sbjct: 183 THKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTN 242

Query: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303
           PSKE+ EFQD+ILEDLEL+GIKGD++TYSSDYFQEMYDLCVQLIKEG AYCDDT  EKMR
Sbjct: 243 PSKEKTEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVQLIKEGGAYCDDTPTEKMR 302

Query: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363
           EERM+GI SA+RD +VEENLRIFTEEMKNGTE G KNCVRAKIDY A NKTLRDPVIYRC
Sbjct: 303 EERMDGIASARRDRTVEENLRIFTEEMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYRC 362

Query: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423
           NLTPHHRT   WKMYPTYDFCVPIVD++EGVTHALRTIEYRDRNAQY+WML AL LRKVH
Sbjct: 363 NLTPHHRTGATWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALHLRKVH 422

Query: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQG 483
           IWDFARVNF+RTLLSKRKLQWMVD  LVSNWDDPRFPT        MTVEGLRNFV+SQG
Sbjct: 423 IWDFARVNFVRTLLSKRKLQWMVDKHLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQG 482

Query: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543
           PS+NVINLEWN+IWA NKK+IDPVAPRHTAVV+PV+I L GE APETPK+E+KPKHKKNP
Sbjct: 483 PSRNVINLEWNIIWAFNKKVIDPVAPRHTAVVNPVKIHLTGEDAPETPKIEMKPKHKKNP 542

Query: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603
           AVGEKKVIY   I++DKEDA V+EV EE+TLMDWGNIIIT KNADGS+ AK +L GDFKK
Sbjct: 543 AVGEKKVIYYKDIVVDKEDADVIEVNEEVTLMDWGNIIITKKNADGSMEAKVHLEGDFKK 602

Query: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662
           T HK+TWLA+T D VPV++VDFDHLI+KDKLEEDE+F DF+TP+TEFHT A+ D+NVK+M
Sbjct: 603 TAHKLTWLADTEDVVPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVKEM 662

Query: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           KVGD+IQFERKGY RLDS  +  KPY+FFTIPDGKSVN+YGAKK
Sbjct: 663 KVGDVIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 706

>KNAG0I00220 Chr9 (26235..28358) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1152 bits (2979), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 542/704 (76%), Positives = 611/704 (86%), Gaps = 3/704 (0%)

Query: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63
           LVINGKAP+VAY  LIA+RI N+A   ++ +EFVD+KNAAP VFNG S+D  +KI + +P
Sbjct: 6   LVINGKAPIVAYGPLIAARIANSAKSSSVAIEFVDDKNAAPAVFNGDSEDVLSKIAAQFP 65

Query: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123
           ++F  E + +VA W+K A ++ VVKNF +L++SL +LDA LNLRTF+LGGLK S ADI C
Sbjct: 66  ELFAQEEAADVATWVKTANDEFVVKNFAKLAESLAKLDAHLNLRTFVLGGLKYSVADIAC 125

Query: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183
           WGALRSNGMVGSIIKNKVYVNVSRWYTL E+ P F  AHE+LTKSMQ +KKA TAGKKKE
Sbjct: 126 WGALRSNGMVGSIIKNKVYVNVSRWYTLFEMFPQFSNAHEFLTKSMQELKKASTAGKKKE 185

Query: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243
            HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGKLIIRFDDTN
Sbjct: 186 SHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTN 245

Query: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303
           PSKE+ EFQD+ILEDL L+GIKGD++TYSSDYFQ+MYD+C+QLIKEG AYCDDT  EKMR
Sbjct: 246 PSKEKEEFQDSILEDLSLLGIKGDRVTYSSDYFQQMYDMCIQLIKEGGAYCDDTPTEKMR 305

Query: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363
           EERM+GI SA+RD SVEENL+IFTEEMKNGTE G KNCVRAKIDY A NKTLRDPVIYRC
Sbjct: 306 EERMDGIASARRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYAAPNKTLRDPVIYRC 365

Query: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423
           NLTPHHRT   WK+YPTYDFCVPIVDS+EGVTHALRTIEYRDRN QYDWML AL LRKVH
Sbjct: 366 NLTPHHRTGDTWKVYPTYDFCVPIVDSVEGVTHALRTIEYRDRNVQYDWMLNALHLRKVH 425

Query: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQG 483
           IWDFARVNF+RTLLSKRKLQWMVD GLV NWDDPRFPT        MTVEGLRNFV+SQG
Sbjct: 426 IWDFARVNFVRTLLSKRKLQWMVDKGLVENWDDPRFPTVRGVRRRGMTVEGLRNFVLSQG 485

Query: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543
           PS+NVINLEWNLIWA NKK+IDPVAPRHTAVVDPV++ +  EGAPETPK E+KPKHKKNP
Sbjct: 486 PSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVDPVKLHI--EGAPETPKTEMKPKHKKNP 543

Query: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603
           AVGEKKVI+   ++IDKEDA+ LE  EE+TLMDWGN+IIT ++ DGSL  K +L GDFKK
Sbjct: 544 AVGEKKVIFYQNVVIDKEDAASLETDEEVTLMDWGNVIITKRHPDGSLEGKLHLEGDFKK 603

Query: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662
           TKHK+TWLA+T D VPV++VDFDHLI KD+LEE E+F DF+TPQTEF TKA+ D+NVK M
Sbjct: 604 TKHKLTWLADTEDVVPVDLVDFDHLINKDRLEEGESFEDFLTPQTEFETKAIADLNVKHM 663

Query: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           KVGDIIQFERKGY RLDS  +  KPYIFFTIPDGKSVNRYGAKK
Sbjct: 664 KVGDIIQFERKGYYRLDSLPKDGKPYIFFTIPDGKSVNRYGAKK 707

>TDEL0D06370 Chr4 complement(1143917..1146037) [2121 bp, 706 aa]
           {ON} Anc_3.569 YGL245W
          Length = 706

 Score = 1151 bits (2977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/707 (77%), Positives = 619/707 (87%), Gaps = 2/707 (0%)

Query: 1   MVNLVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIIS 60
           M  L+INGKAPVVAYAELIA+R+VN  + ++I VEFVD+K AAP V +G S+  F KII 
Sbjct: 1   MAKLIINGKAPVVAYAELIAARVVNTVNPESINVEFVDDKKAAPAVLDGESEGVFMKIIE 60

Query: 61  TYPDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAAD 120
            +P +F   +SEE+A W+K A    V+KNFQ+LS SLE+LDAVLNLRT+ILGGLK SAAD
Sbjct: 61  AFPKIFTEGTSEEIAAWVKTASSDYVIKNFQKLSGSLEKLDAVLNLRTYILGGLKYSAAD 120

Query: 121 IVCWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGK 180
           I CWGALRSNGMVGSIIKNKV VNVSRWYTLLE + +FGGAHE+LTKSMQ +KKA   GK
Sbjct: 121 IACWGALRSNGMVGSIIKNKVDVNVSRWYTLLETDLAFGGAHEFLTKSMQDLKKASNVGK 180

Query: 181 KKEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFD 240
           KKEGHKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LN+YFA  YKGKLIIRFD
Sbjct: 181 KKEGHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAKEYKGKLIIRFD 240

Query: 241 DTNPSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVE 300
           DTNPSKE+ EFQD+I+EDL+L+GI+GD++T+SSDYFQEMYDLCV++IKEGKAYCDDT  E
Sbjct: 241 DTNPSKEKEEFQDSIIEDLKLLGIEGDRLTFSSDYFQEMYDLCVKMIKEGKAYCDDTVTE 300

Query: 301 KMREERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVI 360
           KMREERM+GI SA+RD  VEENLRIFT+EMKNGTE G KNCVRAKIDY+AANKTLRDPVI
Sbjct: 301 KMREERMDGIASARRDRPVEENLRIFTKEMKNGTEEGLKNCVRAKIDYQAANKTLRDPVI 360

Query: 361 YRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLR 420
           YRCNLTPHHRT G  K YPTYDFCVP+VD+IEGVTHALRTIEYRDRNAQYDWML A+ LR
Sbjct: 361 YRCNLTPHHRT-GTTKTYPTYDFCVPVVDAIEGVTHALRTIEYRDRNAQYDWMLNAMNLR 419

Query: 421 KVHIWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVI 480
           KVHIWDFARVNF+RTLLSKRKLQWMVD  LVSNWDDPRFPT        MTVEGLRNFV+
Sbjct: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVL 479

Query: 481 SQGPSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHK 540
           SQGPS+NVINLEWNLIWA NKK+IDPVAPR TAVV+PV++ L+GE AP++PK E+KPKHK
Sbjct: 480 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRLTAVVNPVKLHLDGEDAPQSPKTEMKPKHK 539

Query: 541 KNPAVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGD 600
           KNP VGEKKVI+   ++IDK+DA VLE  EE+TLMDWGN+IIT KNADGSL  K NL GD
Sbjct: 540 KNPDVGEKKVIFYKDVVIDKDDADVLEDNEEVTLMDWGNVIITKKNADGSLEGKLNLDGD 599

Query: 601 FKKTKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNV 659
           FKKTKHK+TWLA+T D  PV++VDFDHLI+KDKLEEDE+F DF+TP+TEFHT A+ D+NV
Sbjct: 600 FKKTKHKLTWLADTEDVAPVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNV 659

Query: 660 KDMKVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           KD+KVGDIIQFERKGY RLD+ A+  KPY+FFTIPDGKSVNRYGAKK
Sbjct: 660 KDLKVGDIIQFERKGYYRLDALAKDGKPYVFFTIPDGKSVNRYGAKK 706

>Suva_7.16 Chr7 (33556..35682) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1148 bits (2969), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 540/704 (76%), Positives = 616/704 (87%), Gaps = 1/704 (0%)

Query: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63
           L INGKAP VAYAELIA+RIVNA   ++I VEFVD+K A     + +++D F KI   + 
Sbjct: 5   LTINGKAPAVAYAELIAARIVNALAPNSIAVEFVDDKKAPAAKLDDATEDVFNKITGKFA 64

Query: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123
            +F +   EEVA W+K+A+E+LVVKNF +LSQSLE LD  LNLRTFILGGLK SAAD+ C
Sbjct: 65  AIFDNGKKEEVAKWVKLAQEELVVKNFGKLSQSLETLDTQLNLRTFILGGLKYSAADVAC 124

Query: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183
           WGALRSNGM GSIIKNKV VNVSRWYTLLE++P FG AHE+LTKS+Q +KK    GKKKE
Sbjct: 125 WGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHEFLTKSLQEVKKNANVGKKKE 184

Query: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243
            HKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGK+IIRFDDTN
Sbjct: 185 THKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKMIIRFDDTN 244

Query: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303
           PSKE+ EFQD+ILEDLEL+GIKGD+ITYSSDYFQEMYD CVQ+IK+GKAYCDDT  EKMR
Sbjct: 245 PSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMR 304

Query: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363
           EERM+GI SA+RD SVEENLRIFTEEMKNGTE G KNCVRAKIDY+A NKTLRDPVIYRC
Sbjct: 305 EERMDGIASARRDRSVEENLRIFTEEMKNGTEVGLKNCVRAKIDYEALNKTLRDPVIYRC 364

Query: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423
           NLTPHHRT   WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQYDWML+ALRLRKVH
Sbjct: 365 NLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLQALRLRKVH 424

Query: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQG 483
           IWDFAR+NF+RTLLSKRKLQWMVD  LV NWDDPRFPT        MTVEGLRNFV+SQG
Sbjct: 425 IWDFARINFVRTLLSKRKLQWMVDKELVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQG 484

Query: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543
           PS+NVINLEWNLIWA NKK+IDP+APRHTAVV+PV+I LEG  AP+ PK+E+KPKHKKNP
Sbjct: 485 PSRNVINLEWNLIWAFNKKVIDPIAPRHTAVVNPVKIHLEGAEAPQEPKIEMKPKHKKNP 544

Query: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603
           AVGEKKVIY   I++DK+DA V++V EE+TLMDWGN++IT KNADGS+VAK +L GDFKK
Sbjct: 545 AVGEKKVIYYKDIVVDKDDADVIDVDEEVTLMDWGNVVITKKNADGSMVAKLHLEGDFKK 604

Query: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662
           TKHK+TWLA+T D VPV++VDFDHL+TKDKLEEDE+F DF+TP+TEFHT A+ D+NVKDM
Sbjct: 605 TKHKLTWLADTKDIVPVDLVDFDHLLTKDKLEEDESFEDFLTPETEFHTDAIADLNVKDM 664

Query: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           KVGDI+QFERKGY RLD+  +  KPY+FFTIPDGKSVN+YGAKK
Sbjct: 665 KVGDIVQFERKGYFRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>YGL245W Chr7 (39023..41149) [2127 bp, 708 aa] {ON}
           GUS1Glutamyl-tRNA synthetase (GluRS), forms a complex
           with methionyl-tRNA synthetase (Mes1p) and Arc1p;
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1142 bits (2953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 535/704 (75%), Positives = 615/704 (87%), Gaps = 1/704 (0%)

Query: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63
           L INGKAP+VAYAELIA+RIVNA   ++I ++ VD+K A     + +++D F KI S + 
Sbjct: 5   LTINGKAPIVAYAELIAARIVNALAPNSIAIKLVDDKKAPAAKLDDATEDVFNKITSKFA 64

Query: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123
            +F +   E+VA W+ +A+++LV+KNF +LSQSLE LD+ LNLRTFILGGLK SAAD+ C
Sbjct: 65  AIFDNGDKEQVAKWVNLAQKELVIKNFAKLSQSLETLDSQLNLRTFILGGLKYSAADVAC 124

Query: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183
           WGALRSNGM GSIIKNKV VNVSRWYTLLE++P FG AH++L+KS+  +KK+   GKKKE
Sbjct: 125 WGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLLELKKSANVGKKKE 184

Query: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243
            HKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGKLIIRFDDTN
Sbjct: 185 THKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTN 244

Query: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303
           PSKE+ EFQD+ILEDL+L+GIKGD+ITYSSDYFQEMYD CVQ+IK+GKAYCDDT  EKMR
Sbjct: 245 PSKEKEEFQDSILEDLDLLGIKGDRITYSSDYFQEMYDYCVQMIKDGKAYCDDTPTEKMR 304

Query: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363
           EERM+G+ SA+RD SVEENLRIFTEEMKNGTE G KNCVRAKIDYKA NKTLRDPVIYRC
Sbjct: 305 EERMDGVASARRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC 364

Query: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423
           NLTPHHRT   WK+YPTYDFCVPIVD+IEGVTHALRTIEYRDRNAQYDWML+ALRLRKVH
Sbjct: 365 NLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNAQYDWMLQALRLRKVH 424

Query: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQG 483
           IWDFAR+NF+RTLLSKRKLQWMVD  LV NWDDPRFPT        MTVEGLRNFV+SQG
Sbjct: 425 IWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQG 484

Query: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543
           PS+NVINLEWNLIWA NKK+IDP+APRHTA+V+PV+I LEG  AP+ PK+E+KPKHKKNP
Sbjct: 485 PSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGSEAPQEPKIEMKPKHKKNP 544

Query: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603
           AVGEKKVIY   I++DK+DA V+ V EE+TLMDWGN+IIT KN DGS+VAK NL GDFKK
Sbjct: 545 AVGEKKVIYYKDIVVDKDDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLNLEGDFKK 604

Query: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662
           TKHK+TWLA+T D VPV++VDFDHLITKD+LEEDE+F DF+TPQTEFHT A+ D+NVKDM
Sbjct: 605 TKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVKDM 664

Query: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           K+GDIIQFERKGY RLD+  +  KPY+FFTIPDGKSVN+YGAKK
Sbjct: 665 KIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Smik_7.16 Chr7 (33804..35930) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1140 bits (2950), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 533/704 (75%), Positives = 615/704 (87%), Gaps = 1/704 (0%)

Query: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63
           L INGKAP+VAYAELIA+RIVNA   ++I + FVD+K A   + + +++D F+KI   + 
Sbjct: 5   LTINGKAPIVAYAELIAARIVNALAPNSIAIVFVDDKKAPAAILDDATEDVFSKITGKFA 64

Query: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123
            +F +   E++A W+ +A+++LVVKNF +LSQSLE LD+ LNLRTFILGGLK SAAD+ C
Sbjct: 65  AIFDNGDKEQLAKWVDLAQKELVVKNFAKLSQSLEALDSQLNLRTFILGGLKYSAADVAC 124

Query: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183
           WGALRSNGM GSIIKNKV VNVSRWYTLLE++P FG AH++L+KS+Q +KK+   GKKKE
Sbjct: 125 WGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLSKSLQELKKSANVGKKKE 184

Query: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243
            HKANFEIDLP+AK+GEVVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGKLIIRFDDTN
Sbjct: 185 THKANFEIDLPEAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTN 244

Query: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303
           PSKE+ EFQD+ILEDL+L+GIKGDKITYSSDYFQEMYD C+Q+IK+GKAYCDDT  EKMR
Sbjct: 245 PSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMYDYCIQMIKDGKAYCDDTPTEKMR 304

Query: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363
           EERM+GI S++RD SVEENLRIFTEEMKNGTE G KNCVRAKIDYKA NKTLRDPVIYRC
Sbjct: 305 EERMDGIASSRRDRSVEENLRIFTEEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC 364

Query: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423
           NLTPHHRT   WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQYDWML+ALRLRKVH
Sbjct: 365 NLTPHHRTGSTWKIYPTYDFCVPIVDAVEGVTHALRTIEYRDRNAQYDWMLQALRLRKVH 424

Query: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQG 483
           IWDFAR+NF+RTLLSKRKLQWMVD  LV NWDDPRFPT        MTVEGLRNFV+SQG
Sbjct: 425 IWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQG 484

Query: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543
           PS+NVINLEWNLIWA NKKIIDP+APRHTA+V+PV+I LEG  AP+ PK E KPKHKKNP
Sbjct: 485 PSRNVINLEWNLIWAFNKKIIDPIAPRHTAIVNPVKIHLEGSEAPQEPKTETKPKHKKNP 544

Query: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603
           AVGEKKVIY   I++DK+DA V+ V EE+TLMDWGN+IIT KN DGS++AK NL GDFKK
Sbjct: 545 AVGEKKVIYYKDIVVDKDDADVINVDEEITLMDWGNVIITKKNEDGSMIAKLNLEGDFKK 604

Query: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662
           TKHK+TWLA+T D VPV++VDFDHLITKD+LEEDE+F DF+TPQTEFHT A+ D+NVKDM
Sbjct: 605 TKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVKDM 664

Query: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           K+GDIIQFERKGY RLD+  +  KPY+FFTIPDGKSVN+YGAKK
Sbjct: 665 KIGDIIQFERKGYYRLDALPKDGKPYVFFTIPDGKSVNKYGAKK 708

>Kpol_507.8 s507 (51597..53720) [2124 bp, 707 aa] {ON}
           (51597..53720) [2124 nt, 708 aa]
          Length = 707

 Score = 1137 bits (2940), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 543/704 (77%), Positives = 611/704 (86%), Gaps = 2/704 (0%)

Query: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63
           LVI GKAPVVAYAELIA+RIVN++  D+I +EFV++K A+P   NG S D  +KI++   
Sbjct: 5   LVIGGKAPVVAYAELIAARIVNSSKPDSIKIEFVEDKKASPATLNGDSVDVLSKIVTANS 64

Query: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123
           DVF  E +     WIK+A E+LVVKNFQQL++SLE+LDA LNLRT+I GGL  + ADI C
Sbjct: 65  DVFP-EGAANSTEWIKIASEELVVKNFQQLNKSLEKLDAHLNLRTYINGGLNFTVADIAC 123

Query: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183
           WGALRSNGMVGSIIKNKV VNVSRWYTLLE N  FGG HE+LTKS+Q +KKA TAGKKKE
Sbjct: 124 WGALRSNGMVGSIIKNKVNVNVSRWYTLLEENTLFGGVHEFLTKSLQELKKASTAGKKKE 183

Query: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243
            HKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGKLIIRFDDTN
Sbjct: 184 THKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTN 243

Query: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303
           PSKE +EFQD+ILEDLEL+GIKGD+IT+SSDYFQEMYD CVQLIK+GKAYCDDT  EKMR
Sbjct: 244 PSKENVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQLIKDGKAYCDDTPTEKMR 303

Query: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363
           +ERM GI S +RD SVEENL+IFTEEMKNGTE G KNCVRAKIDY+A NKTLRDPVI+RC
Sbjct: 304 DERMNGIASVRRDRSVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIFRC 363

Query: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423
           NLTPHHRT  QWKMYPTYDFCVPIVD++EGVTHALRTIEYRDRNAQY+WML AL+LRKVH
Sbjct: 364 NLTPHHRTGSQWKMYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVH 423

Query: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQG 483
           IWDFARVNF+RTLLSKRKLQWMVD  LVSNW+DPRFPT        MTVEGLRNFV+SQG
Sbjct: 424 IWDFARVNFVRTLLSKRKLQWMVDKNLVSNWEDPRFPTVRGVRRRGMTVEGLRNFVLSQG 483

Query: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543
           PS+NVINLEWNLIW+ NKK+IDPV PR TAVVDPV+I LEGE AP++ KVE+KPKH KNP
Sbjct: 484 PSRNVINLEWNLIWSFNKKVIDPVCPRLTAVVDPVKIHLEGEDAPQSAKVEMKPKHPKNP 543

Query: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603
            VGEKKV++   I+ID+EDA  +E GEE+TLM+WGN IIT KNADGSL AK +L GDFKK
Sbjct: 544 VVGEKKVVFYKDIVIDREDADSIEDGEEITLMNWGNAIITKKNADGSLNAKLHLEGDFKK 603

Query: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662
           TKHKVTWLA+T D V V++VDFDHLI+KDKLEEDE+F DF+TP+TEFHT A+ D+NVKDM
Sbjct: 604 TKHKVTWLADTEDVVKVDLVDFDHLISKDKLEEDESFEDFLTPETEFHTSAIADLNVKDM 663

Query: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           KVGDIIQFERKGY RLDS A   KPY+FFTIPDGKSVN+YGAKK
Sbjct: 664 KVGDIIQFERKGYYRLDSLAADGKPYVFFTIPDGKSVNKYGAKK 707

>CAGL0C01947g Chr3 (204411..206528) [2118 bp, 705 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245w
          Length = 705

 Score = 1132 bits (2928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 547/705 (77%), Positives = 620/705 (87%), Gaps = 6/705 (0%)

Query: 4   LVINGKAPVVAYAELIASRIVNAAHKDA-ITVEFVDEKNAAPVVFNGSSDDTFAKIISTY 62
           LVINGKAPVVAYAELIA+R+VN +  DA +TVEFVD+K +A   F+G SD+    I++ +
Sbjct: 5   LVINGKAPVVAYAELIAARLVNDSKSDASVTVEFVDDKKSAAATFDGKSDNALEAIVAKF 64

Query: 63  PDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIV 122
           P++ G  ++EE   WIK+A E+LV+KNFQ+L+QSLE+LDA LN RT+I GGLK  +ADI 
Sbjct: 65  PEILG--ANEESKPWIKLAAEELVIKNFQKLAQSLEKLDAQLNFRTYINGGLKFDSADIA 122

Query: 123 CWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKK 182
           CWGALRSNGMVGSIIKNKVYVNVSRWY LLE NPSFG +HE+LTKS+Q +KKA  AGKKK
Sbjct: 123 CWGALRSNGMVGSIIKNKVYVNVSRWYLLLESNPSFGQSHEFLTKSLQELKKAANAGKKK 182

Query: 183 EGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDT 242
           E HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGKLIIRFDDT
Sbjct: 183 ESHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDT 242

Query: 243 NPSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKM 302
           NPSKE+ EFQD+ILEDLEL+GIKGD+ITYSSDYFQEMY+LCV+LIKEGKAYCDDT  EKM
Sbjct: 243 NPSKEKTEFQDSILEDLELLGIKGDRITYSSDYFQEMYELCVKLIKEGKAYCDDTPTEKM 302

Query: 303 REERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYR 362
           REERM+GI SA+R+ SVEENL+IFTE+MKNGTE G KNCVRAKIDY A NKTLRDPVIYR
Sbjct: 303 REERMDGIASARRERSVEENLKIFTEDMKNGTEEGLKNCVRAKIDYAALNKTLRDPVIYR 362

Query: 363 CNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKV 422
           CNLTPHHRT  +WKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDW L  L LRKV
Sbjct: 363 CNLTPHHRTGSEWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWFLDNLNLRKV 422

Query: 423 HIWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQ 482
           HIWDFARVNF+RTLLSKRKLQWMVD  LVSNWDDPRFPT        MTVEGLRNFV+SQ
Sbjct: 423 HIWDFARVNFVRTLLSKRKLQWMVDKNLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQ 482

Query: 483 GPSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKN 542
           GPS+NVINLEWNLIWA NKK+IDPVAPRHTA+V+PV+I +  EGAPE+PK E+KPKHKKN
Sbjct: 483 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVNPVKIHI--EGAPESPKTEMKPKHKKN 540

Query: 543 PAVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFK 602
           PAVGEKKVIY   ++IDKEDA  +E  EE+TLMDWGNIIIT KNADGS+ AK +L GDFK
Sbjct: 541 PAVGEKKVIYYQNVVIDKEDADSIEDNEEVTLMDWGNIIITKKNADGSMEAKLHLEGDFK 600

Query: 603 KTKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKD 661
           KTKHK+TWLA+T D V V++VDFDHLI+KDKLEEDE+F DF+TPQTEFHT+A+ D+NVKD
Sbjct: 601 KTKHKLTWLADTDDSVKVDLVDFDHLISKDKLEEDESFEDFLTPQTEFHTEAIADLNVKD 660

Query: 662 MKVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           M VGDIIQFERKGY RLD++A+  KPY+FFTIPDGKSVN+YGAKK
Sbjct: 661 MIVGDIIQFERKGYYRLDAEAKDGKPYVFFTIPDGKSVNKYGAKK 705

>Skud_7.22 Chr7 (43191..45317) [2127 bp, 708 aa] {ON} YGL245W (REAL)
          Length = 708

 Score = 1127 bits (2916), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 529/704 (75%), Positives = 611/704 (86%), Gaps = 1/704 (0%)

Query: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63
           L +NGKAP VAYAELIA+RIVNA   ++I ++FVD+K A     + +++  F KI   + 
Sbjct: 5   LTVNGKAPSVAYAELIAARIVNALAPNSIAIQFVDDKKAPAAKLDDATEGVFNKITGKFA 64

Query: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123
            +F +   E+V+ W  +A ++LVVKNF +LSQSLE LD+ LN+RTFILGGLK SAAD+ C
Sbjct: 65  AIFDNGDKEQVSRWTDLAEKELVVKNFAKLSQSLETLDSQLNVRTFILGGLKYSAADVAC 124

Query: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183
           WGALRSNGM GSIIKNKV VNVSRWYTLLE++P FG AH++LTKS+Q +KK+   GKKKE
Sbjct: 125 WGALRSNGMCGSIIKNKVDVNVSRWYTLLEMDPIFGEAHDFLTKSLQELKKSANVGKKKE 184

Query: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243
            HKANFEIDLPDAK+G+VVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGKLIIRFDDTN
Sbjct: 185 THKANFEIDLPDAKVGQVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTN 244

Query: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303
           PSKE+ EFQD+ILEDL+L+GIKGDKITYSSDYFQEM+D CVQ+IK+GKAYCDDT  E+MR
Sbjct: 245 PSKEKEEFQDSILEDLDLLGIKGDKITYSSDYFQEMFDYCVQMIKDGKAYCDDTPTERMR 304

Query: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363
           EERM+GI SA+R+ SVEENLR+FTEEMKNGTE G KNCVRAKIDY+A NKTLRDPVIYRC
Sbjct: 305 EERMDGIASARRNRSVEENLRLFTEEMKNGTEEGLKNCVRAKIDYEALNKTLRDPVIYRC 364

Query: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423
           NLTPHHRT   WK+YPTYDFCVPIVD+IEGVTHALRTIEYRDRN QYDWML+ALRLRKVH
Sbjct: 365 NLTPHHRTGSTWKIYPTYDFCVPIVDAIEGVTHALRTIEYRDRNIQYDWMLQALRLRKVH 424

Query: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQG 483
           IWDFAR+NF+RTLLSKRKLQWMVD  LV NWDDPRFPT        MTVEGLRNFV+SQG
Sbjct: 425 IWDFARINFVRTLLSKRKLQWMVDKDLVGNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQG 484

Query: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543
           PS+NVINLEWNLIWA NKK+IDP+APRHTA+V+PV+I LEG  AP+ PKVE+KPKHKKNP
Sbjct: 485 PSRNVINLEWNLIWAFNKKVIDPIAPRHTAIVNPVKIHLEGTEAPQEPKVEMKPKHKKNP 544

Query: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603
           AVGEKK+IY   I++D+EDA V+ V EE+TLMDWGN+IIT KN DGS+VAK +L GDFKK
Sbjct: 545 AVGEKKLIYYKDIVVDREDADVINVDEEVTLMDWGNVIITKKNDDGSMVAKLHLEGDFKK 604

Query: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662
           TKHK+TWLA+T D VPV++VDFDHLITKD+LEEDE+F DF+TPQTEFHT A+ D+NVKDM
Sbjct: 605 TKHKLTWLADTKDVVPVDLVDFDHLITKDRLEEDESFEDFLTPQTEFHTDAIADLNVKDM 664

Query: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           KVGDIIQFERKGY RLD+  +  KPY+FFTIPDGKSVNRYGAKK
Sbjct: 665 KVGDIIQFERKGYYRLDALPKNGKPYVFFTIPDGKSVNRYGAKK 708

>SAKL0F00748g Chr6 (64800..66923) [2124 bp, 707 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 707

 Score = 1120 bits (2897), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 539/705 (76%), Positives = 609/705 (86%), Gaps = 2/705 (0%)

Query: 3   NLVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTY 62
           NLVINGKAPVVAYAELIA+RIVNA+  DAI +EFVD+K AAP  FNG +D  F+KII+ Y
Sbjct: 4   NLVINGKAPVVAYAELIAARIVNASKADAIKIEFVDDKKAAPATFNGEADSAFSKIINAY 63

Query: 63  PDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIV 122
            DVF  E  +  + W K+A E+ ++KNFQ+LS SL +LD+ LNLRT+IL     + ADI 
Sbjct: 64  QDVFS-EGVQGSSEWSKLASEEFIIKNFQKLSGSLAKLDSRLNLRTYILDSFTATPADIA 122

Query: 123 CWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKK 182
           CWGALRSNGMVGSIIKNKVYVNVSRWYT+LEL+P F GAHE+LTKS+Q +KKA  + KKK
Sbjct: 123 CWGALRSNGMVGSIIKNKVYVNVSRWYTMLELDPLFSGAHEFLTKSLQELKKASNSNKKK 182

Query: 183 EGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDT 242
           E HKANFEI LPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGKLIIRFDDT
Sbjct: 183 ETHKANFEIGLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDT 242

Query: 243 NPSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKM 302
           NPSKE++EFQD+ILEDL+L+GIKGDKITYSSDYF+EMY LCVQLIKEGKAYCDDT  EKM
Sbjct: 243 NPSKEKVEFQDSILEDLDLLGIKGDKITYSSDYFEEMYQLCVQLIKEGKAYCDDTPTEKM 302

Query: 303 REERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYR 362
           REERM+GI SA+RD SVEENLRIF EEMKNGTE G KNCVRAKIDYKA NK LRDPVI+R
Sbjct: 303 REERMDGIASARRDRSVEENLRIFNEEMKNGTEEGLKNCVRAKIDYKALNKALRDPVIFR 362

Query: 363 CNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKV 422
           CNLTPHHRT   WKMYPTYDFCVPIVD+IEGVTHALRTIEYRDRN QY+WML AL LRKV
Sbjct: 363 CNLTPHHRTGTTWKMYPTYDFCVPIVDAIEGVTHALRTIEYRDRNPQYEWMLDALHLRKV 422

Query: 423 HIWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQ 482
           HIWDFARVNF+RTLLSKRKLQWMVD G VSNWDDPRFPT        MTVEGLRNFV+SQ
Sbjct: 423 HIWDFARVNFVRTLLSKRKLQWMVDKGCVSNWDDPRFPTVRGVRRRGMTVEGLRNFVLSQ 482

Query: 483 GPSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKN 542
           GPS+NVINLEWNLIWA NKK+IDPVAPRHTAVV PV++ LEG+  P+ PK+E+K KHKKN
Sbjct: 483 GPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVKPVKLHLEGDDVPQNPKIEMKLKHKKN 542

Query: 543 PAVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFK 602
           P VGEKKVIY   ++ID+EDA V+  GEELTLMDWGN+IIT KN+DGSLV K +L GDFK
Sbjct: 543 PDVGEKKVIYYKDVLIDQEDADVVSEGEELTLMDWGNVIITKKNSDGSLVGKLHLEGDFK 602

Query: 603 KTKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKD 661
           KTK K+TWLA+T D V V++VDFDHLI+KDKLEE +NF DF+TP+TEFHT A+ D+NVKD
Sbjct: 603 KTKLKLTWLADTEDKVDVDLVDFDHLISKDKLEEGDNFEDFLTPETEFHTPAIADLNVKD 662

Query: 662 MKVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           MKVGD+IQFERKGY RLDS A+  KPY+FFTIPDGK+VN+YGAKK
Sbjct: 663 MKVGDVIQFERKGYYRLDSLAKDGKPYVFFTIPDGKAVNKYGAKK 707

>Kwal_47.19272 s47 complement(1165848..1167962) [2115 bp, 704 aa]
           {ON} YGL245W - Protein required for cell viability
           [contig 344] FULL
          Length = 704

 Score = 1103 bits (2854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 524/709 (73%), Positives = 605/709 (85%), Gaps = 8/709 (1%)

Query: 1   MVNLVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIIS 60
           M  L +  KAPVVAY+ELIA+R+ NA     I ++FV++K A+P  F G+S+D    I+ 
Sbjct: 1   MAKLTLASKAPVVAYSELIAARLTNAVKPGTIEIDFVEDKKASPATFEGNSNDVLKTIVE 60

Query: 61  TYPDVF--GHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISA 118
           ++P+ F  G +  E+   W + A E+LVVKNFQ+LS SL++LDA LNLRTF+LGG   S 
Sbjct: 61  SFPEAFKGGFDGCEK---WSQFASEELVVKNFQKLSVSLDKLDAQLNLRTFLLGGTSYSP 117

Query: 119 ADIVCWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTA 178
           ADI CWG+LRSNGMVGSIIKN+VYVNVSRWYTLLE  P FG AHE+LTK++Q +KKA T 
Sbjct: 118 ADIACWGSLRSNGMVGSIIKNRVYVNVSRWYTLLEQVPEFGSAHEFLTKAVQELKKASTG 177

Query: 179 GKKKEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIR 238
            KKKE HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAAILN+YFA  YKGKLIIR
Sbjct: 178 NKKKETHKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIR 237

Query: 239 FDDTNPSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTD 298
           FDDTNPSKE+ EFQD+ILEDLEL+GIKGD++TYSSDYFQEMY+LCV++I+EGKAYCDDT 
Sbjct: 238 FDDTNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYELCVKMIEEGKAYCDDTA 297

Query: 299 VEKMREERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDP 358
            E+MREERM+GI SA+RD SVEENLRIFT EMKNGTE G KNCVRAKIDY+A NKTLRDP
Sbjct: 298 TERMREERMDGIASARRDRSVEENLRIFTHEMKNGTEEGLKNCVRAKIDYEAPNKTLRDP 357

Query: 359 VIYRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALR 418
           VIYRCNLTPHHRT   WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQYDWML AL 
Sbjct: 358 VIYRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYDWMLNALH 417

Query: 419 LRKVHIWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNF 478
           LRKVHIWDFARVNF+RTLLSKRKLQWMVD  LVSNWDDPRFPT        MTVEGLRNF
Sbjct: 418 LRKVHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNF 477

Query: 479 VISQGPSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPK 538
           V+SQGPS+NVINLEWNLIWA NKK+IDPVAPRHTAVV+PV+  +  +GAP+TP V++K K
Sbjct: 478 VLSQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAVVNPVKFHI--DGAPQTPDVQMKLK 535

Query: 539 HKKNPAVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLG 598
           HKKNPAVGEKKVIY   ++ID++DA ++E GEELTLMDWGN+I+T KNADGSL  K +L 
Sbjct: 536 HKKNPAVGEKKVIYYTDVLIDEDDAKLIEEGEELTLMDWGNVIVTKKNADGSLTGKLHLE 595

Query: 599 GDFKKTKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDV 657
           GDFKKTK KVTWLA+T D V V++VDFDHLI+KDKLEE E+F DF+TP+TEFH  A+ D+
Sbjct: 596 GDFKKTKLKVTWLADTSDKVNVDLVDFDHLISKDKLEEGEDFADFLTPKTEFHVPAIADL 655

Query: 658 NVKDMKVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           NVKDMK GDIIQFERKGY RLD+ A+GDKPY+FF+IPDGKSVN+YGAKK
Sbjct: 656 NVKDMKKGDIIQFERKGYYRLDAVADGDKPYVFFSIPDGKSVNKYGAKK 704

>AFR264W Chr6 (908580..910703) [2124 bp, 707 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL245W (GUS1)
          Length = 707

 Score = 1094 bits (2829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 512/704 (72%), Positives = 595/704 (84%), Gaps = 2/704 (0%)

Query: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63
           L+I  K+P VAYAELIA+R VN A +DA+ ++F + K AA   F+G S +   +++  YP
Sbjct: 5   LIIAAKSPAVAYAELIAARAVNEAKQDAVAIQFTEGKEAAAASFDGESQNALERMVEKYP 64

Query: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123
           DV G    EE A WI  AR  LVVK+F++LS SLE+LDA LNLRTF+LGG++ + AD+  
Sbjct: 65  DVLG-SVPEEAAWWIAYARTDLVVKDFKKLSGSLEKLDAHLNLRTFVLGGMQPTVADVAV 123

Query: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183
           WGALRSNG VGSIIKNKVYVNVSRWYT LEL P+FGGAHE+L KS++ +K A    KKKE
Sbjct: 124 WGALRSNGPVGSIIKNKVYVNVSRWYTTLELIPAFGGAHEFLAKSLKELKAAGNVNKKKE 183

Query: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243
            HKANFEIDLPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGKLIIRFDDTN
Sbjct: 184 THKANFEIDLPDAKIGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFDDTN 243

Query: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303
           PSKER+EFQD+ILEDLEL+GIKGD+IT+SSDYFQEMYD CVQ+IKEGKAYCDDT  E+MR
Sbjct: 244 PSKERVEFQDSILEDLELLGIKGDRITHSSDYFQEMYDYCVQMIKEGKAYCDDTPTERMR 303

Query: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363
           EERMEGI SA+R+ SVEENL+IFTEEMKNGTE G KNCVRAK DY A NKTL+DPV+YRC
Sbjct: 304 EERMEGIASARRERSVEENLKIFTEEMKNGTEEGLKNCVRAKRDYAALNKTLKDPVLYRC 363

Query: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423
           NLTPHHRT   WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQY+WML AL+LRKVH
Sbjct: 364 NLTPHHRTGTAWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYEWMLNALKLRKVH 423

Query: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQG 483
           IWDFARVNF+RTLLSKRKLQW+VD  +VSNWDDPRFPT        MT+EGLRNFV+SQG
Sbjct: 424 IWDFARVNFVRTLLSKRKLQWLVDKQVVSNWDDPRFPTVRGVRRRGMTIEGLRNFVLSQG 483

Query: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543
           PS+NVINLEWNLIWA NKK+IDP+APRHT V +PV++ L G   P+TP  E+KPKHKKNP
Sbjct: 484 PSRNVINLEWNLIWAFNKKVIDPIAPRHTVVTNPVKLHLNGADVPQTPLTEMKPKHKKNP 543

Query: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603
           AVGEKKVIY   ++I  EDA++L  GEE+TLMDWGN II  KN DGSL A  NL GDFKK
Sbjct: 544 AVGEKKVIYYKDVLIGAEDAAMLAAGEEVTLMDWGNAIIRGKNDDGSLTADLNLEGDFKK 603

Query: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662
           TK K+TWLA+T D VPV++VDFDHLI+KD+LEE++NF DF+TP+TEFHT A+ D+NVKDM
Sbjct: 604 TKFKLTWLADTSDTVPVDLVDFDHLISKDRLEEEDNFEDFLTPETEFHTTAIADLNVKDM 663

Query: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           KVGD+IQFER GY RLD+   GDKP++FFTIPDGK+VN+YGAKK
Sbjct: 664 KVGDVIQFERTGYYRLDTVGSGDKPFVFFTIPDGKAVNKYGAKK 707

>KLTH0G00682g Chr7 (45680..47794) [2115 bp, 704 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 704

 Score = 1093 bits (2826), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 530/707 (74%), Positives = 596/707 (84%), Gaps = 4/707 (0%)

Query: 1   MVNLVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIIS 60
           M  L+I  KAPVVAY+ELIA+R+VN+A  DAI +EFV++K ++P  F  S DD   +I+ 
Sbjct: 1   MAKLIIASKAPVVAYSELIAARLVNSAKTDAIEIEFVEDKKSSPATFEDSCDDVLKRIVQ 60

Query: 61  TYPDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAAD 120
           TYP+VF H   E    W K+A E+L VKNFQ+LS SL +LDA LN RTFILGG   SAAD
Sbjct: 61  TYPEVFKH-GFENCDEWAKLASEELTVKNFQKLSVSLAKLDACLNFRTFILGGTTFSAAD 119

Query: 121 IVCWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGK 180
           I CWG+LRSNGMVGSIIKNKVYVNVSRWYTLLE  P FG AHE+L K++Q +KKA T+ K
Sbjct: 120 IACWGSLRSNGMVGSIIKNKVYVNVSRWYTLLEQIPEFGSAHEFLVKTLQELKKASTSNK 179

Query: 181 KKEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFD 240
           KKE HKANFEIDL DAK+GEVVTRFPPEPSGYLHIGHAKAAILN+YFA  YKGKLIIRFD
Sbjct: 180 KKETHKANFEIDLQDAKVGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQEYKGKLIIRFD 239

Query: 241 DTNPSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVE 300
           DTNPSKE+ EFQD+ILEDLEL+GIKGD++TYSSDYFQEMYDLCV++I+EG AYCDDT  +
Sbjct: 240 DTNPSKEKEEFQDSILEDLELLGIKGDRVTYSSDYFQEMYDLCVKMIEEGNAYCDDTPTD 299

Query: 301 KMREERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVI 360
           KMREERM+G+ SA+RD SVEENLRIFT+EMKNGTE G KNCVRAKIDYKA NKTLRDPVI
Sbjct: 300 KMREERMDGLASARRDRSVEENLRIFTQEMKNGTEEGLKNCVRAKIDYKALNKTLRDPVI 359

Query: 361 YRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLR 420
           YRCNLTPHHRT   WK+YPTYDFCVPIVD++EGVTHALRTIEYRDRNAQY WML AL LR
Sbjct: 360 YRCNLTPHHRTGSTWKIYPTYDFCVPIVDALEGVTHALRTIEYRDRNAQYQWMLDALHLR 419

Query: 421 KVHIWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVI 480
           KVHIWDFARVNF+RTLLSKRKLQWMVD  LVSNWDDPRFPT        MTVEGLRNFV+
Sbjct: 420 KVHIWDFARVNFVRTLLSKRKLQWMVDKDLVSNWDDPRFPTVRGVRRRGMTVEGLRNFVL 479

Query: 481 SQGPSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHK 540
           SQGPS+NVINLEWNLIWA NKK+IDPVAPRHTA+V PV+  +  EGAP+TP V++K KHK
Sbjct: 480 SQGPSRNVINLEWNLIWAFNKKVIDPVAPRHTAIVKPVKFHV--EGAPQTPDVQIKLKHK 537

Query: 541 KNPAVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGD 600
           KNPAVGEKKVIY   I+ID++DA  +  GEELTLMDWGN I+T KNADGSL  K +L GD
Sbjct: 538 KNPAVGEKKVIYYADILIDQDDADAVTEGEELTLMDWGNAIVTKKNADGSLTGKLHLEGD 597

Query: 601 FKKTKHKVTWLA-NTDYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNV 659
           FKKTK K+TWLA   D V V++VDFDHLITKDKLEE E+F D++TPQTEFH  AV D+NV
Sbjct: 598 FKKTKLKLTWLADTDDKVDVDLVDFDHLITKDKLEEGEDFADYLTPQTEFHVSAVADLNV 657

Query: 660 KDMKVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           KDMK GDIIQFERKGY RLDS A  DKPY+FF IPDGKSVN+YGAKK
Sbjct: 658 KDMKKGDIIQFERKGYYRLDSFATADKPYVFFAIPDGKSVNKYGAKK 704

>TPHA0A06020 Chr1 complement(1361027..1363150) [2124 bp, 707 aa]
           {ON} Anc_3.569 YGL245W
          Length = 707

 Score = 1092 bits (2824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/706 (75%), Positives = 607/706 (85%), Gaps = 6/706 (0%)

Query: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63
           L+I GK+ VVAY+ELIA+RIVN+   D+IT+EFV++K AA    NG +DD  +KI+S   
Sbjct: 5   LIIGGKSSVVAYSELIAARIVNSVKPDSITIEFVEDKKAAAASLNGETDDVLSKIVSANA 64

Query: 64  DVF--GHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADI 121
           DVF  G   SEE   W+K+A  +LV+KNFQ+L+ SL++LDA LNLRTFI GGL  S ADI
Sbjct: 65  DVFPEGVTGSEE---WVKLAVSELVIKNFQKLATSLDKLDAHLNLRTFINGGLSYSIADI 121

Query: 122 VCWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKK 181
            CWGALRSNGMVGSIIKNKV VNVSRWYTL E NP FG A+E+LTKS+Q +KKA +AGKK
Sbjct: 122 ACWGALRSNGMVGSIIKNKVNVNVSRWYTLFESNPIFGEANEFLTKSLQELKKASSAGKK 181

Query: 182 KEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDD 241
           KE HKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILN+YFA AYKGKLIIRFDD
Sbjct: 182 KETHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFADAYKGKLIIRFDD 241

Query: 242 TNPSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEK 301
           TNPSKE++EFQ++ILEDL L+GIKGD+IT+SSDYFQEMYD C+QLIKEGKAYCDDT V+K
Sbjct: 242 TNPSKEKVEFQESILEDLALLGIKGDRITHSSDYFQEMYDYCIQLIKEGKAYCDDTPVDK 301

Query: 302 MREERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIY 361
           MREERM+GI SA+R+ SVEENL+IFTEEM+NGTE G +NCVRAKIDY+A NKTLRDPVIY
Sbjct: 302 MREERMDGIASARRNRSVEENLKIFTEEMQNGTEEGLQNCVRAKIDYEALNKTLRDPVIY 361

Query: 362 RCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRK 421
           RCNL PHHRT   WKMYPTYDFCVPIVDS+EGVTHALRTIEYRDRNAQY+WML A+ LRK
Sbjct: 362 RCNLNPHHRTGTAWKMYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLNAMNLRK 421

Query: 422 VHIWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVIS 481
           VHIWDFARVNF+RTLLSKRKLQWMVD  LVSNWDDPRFPT        MT+EGLRNFVIS
Sbjct: 422 VHIWDFARVNFVRTLLSKRKLQWMVDKELVSNWDDPRFPTVRGVRRRGMTIEGLRNFVIS 481

Query: 482 QGPSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKK 541
           QGPS+NVINLEWNLIWA NKK+IDPVAPR T V++P++I L G  APETP+VE+KPKH K
Sbjct: 482 QGPSRNVINLEWNLIWAFNKKVIDPVAPRLTCVINPIKIHLSGADAPETPRVEMKPKHPK 541

Query: 542 NPAVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDF 601
           NPAVGEK+VI+S  I+IDK+DA V+E GEE+TLM+WGN II  KNADGS+ A  +L GDF
Sbjct: 542 NPAVGEKRVIFSKDIVIDKDDADVIEEGEEITLMNWGNAIIDKKNADGSIDATLHLEGDF 601

Query: 602 KKTKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVK 660
           KKTKHK+TWLA T D   V++VDFDHLITKDKLEEDE+F +F+TP TEFHT A+ DVNVK
Sbjct: 602 KKTKHKITWLAETEDVTKVDLVDFDHLITKDKLEEDESFENFLTPNTEFHTDAIADVNVK 661

Query: 661 DMKVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           DMKVGDIIQFERKGY RLD+  +  KPYIFFTIPDGK+VN+YGAKK
Sbjct: 662 DMKVGDIIQFERKGYYRLDALPKDGKPYIFFTIPDGKAVNKYGAKK 707

>KLLA0A00682g Chr1 (67685..69811) [2127 bp, 708 aa] {ON} highly
           similar to uniprot|P46655 Saccharomyces cerevisiae
           YGL245W GUS1 Glutamyl-tRNA synthetase (GluRS) forms a
           complex with methionyl-tRNA synthetase (Mes1p) and Arc1p
           complex formation increases the catalytic efficiency of
           both tRNA synthetases and ensures their correct
           localization to the cytoplasm
          Length = 708

 Score = 1083 bits (2801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 514/707 (72%), Positives = 594/707 (84%), Gaps = 3/707 (0%)

Query: 2   VNLVINGKAPVVAYAELIASRIVNAAHKD-AITVEFVDEKNAAPVVFNGSSDDTFAKIIS 60
            +L+I  KAPV+AY ELIA+R VNA+  D  I + FV++K AA   FNG ++D   K+ +
Sbjct: 3   ASLIIGAKAPVIAYPELIAARKVNASKGDNTIEISFVEDKKAAAASFNGETEDVLTKLSA 62

Query: 61  TYPDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAAD 120
            YPD+  +++S+  A WI+   +QLV+KNFQQL++SL +L+A LNLRT+IL  L+ S AD
Sbjct: 63  AYPDIL-NDNSDSSAEWIEFGAKQLVIKNFQQLAESLAKLNAHLNLRTYILNTLEPSLAD 121

Query: 121 IVCWGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGK 180
           I  WG LRSNGMVGSIIKNKVY+NVSRWY+  EL P FG AHE+LTKS+Q +KKA    K
Sbjct: 122 IAVWGYLRSNGMVGSIIKNKVYINVSRWYSTFELIPEFGQAHEFLTKSLQELKKASNVNK 181

Query: 181 KKEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFD 240
           KKE HKANFEI LPDAK+GEVVTRFPPEPSGYLHIGHAKAA+LN+YFA AYKGKLIIRFD
Sbjct: 182 KKETHKANFEIGLPDAKVGEVVTRFPPEPSGYLHIGHAKAALLNQYFAQAYKGKLIIRFD 241

Query: 241 DTNPSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVE 300
           DTNPSKE+ EFQD+ILEDLEL+GIKGD+ITYSSDYFQEMYD CVQ+IKEGKAYCDDT  E
Sbjct: 242 DTNPSKEKEEFQDSILEDLELLGIKGDRITYSSDYFQEMYDYCVQMIKEGKAYCDDTPTE 301

Query: 301 KMREERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVI 360
           +MREER EGIPS++R+ +VEENL+IFTEEMKNGTE G KNCVRAKIDY+A NK +RDPVI
Sbjct: 302 RMREERTEGIPSSRRERTVEENLKIFTEEMKNGTEEGLKNCVRAKIDYEALNKAMRDPVI 361

Query: 361 YRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLR 420
           YRCNLTPHHRT   WK+YPTYDFCVPIVDS+EGVTHALRTIEYRDRN QYDWML AL LR
Sbjct: 362 YRCNLTPHHRTGTAWKIYPTYDFCVPIVDSLEGVTHALRTIEYRDRNPQYDWMLNALHLR 421

Query: 421 KVHIWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVI 480
           KVHIWDFARVNF+RTLLSKRKLQW+VD  +VSNWDDPRFPT        MT+EGLRNFV+
Sbjct: 422 KVHIWDFARVNFVRTLLSKRKLQWLVDKDIVSNWDDPRFPTVRGVRRRGMTIEGLRNFVL 481

Query: 481 SQGPSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHK 540
           SQGPS+NVINLEWNLIW+ NKK+IDPVAPRHTA+V PV++ LEG+  P+TP VE+K KHK
Sbjct: 482 SQGPSRNVINLEWNLIWSFNKKVIDPVAPRHTAIVSPVKVHLEGDDVPQTPNVEMKLKHK 541

Query: 541 KNPAVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGD 600
           KNPA+GEKKVIY   I+ID+EDA +L  GEE+TLMDWGN IIT KN DGS  AK +L GD
Sbjct: 542 KNPAIGEKKVIYYKDIVIDEEDAKLLSEGEEVTLMDWGNAIITKKNDDGSFNAKLHLEGD 601

Query: 601 FKKTKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNV 659
           FK TK K+TWLA+T D V  ++VDFDHLI+KDKLEE ENF DF+TP+TEFHT A  D+NV
Sbjct: 602 FKTTKFKLTWLADTDDKVEADLVDFDHLISKDKLEEGENFEDFLTPKTEFHTTAYADLNV 661

Query: 660 KDMKVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           KDMKVGDIIQFERKGY RLDS  +  KPY+FFTIPDGKSVN+YGAKK
Sbjct: 662 KDMKVGDIIQFERKGYFRLDSLPKDGKPYVFFTIPDGKSVNKYGAKK 708

>TBLA0E00190 Chr5 (24885..27008) [2124 bp, 707 aa] {ON} Anc_3.569
           YGL245W
          Length = 707

 Score = 1077 bits (2786), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 521/704 (74%), Positives = 605/704 (85%), Gaps = 2/704 (0%)

Query: 4   LVINGKAPVVAYAELIASRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYP 63
           L+++GKA  VAY ELIA+RIVN +  +A+ + FV++K AAP   +GSSDD  AKI++  P
Sbjct: 5   LILSGKAQAVAYGELIAARIVNNSSANAVDISFVEDKKAAPATLDGSSDDVLAKIVALSP 64

Query: 64  DVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKISAADIVC 123
             F   S E+VAHW K+A+E+LVVKNFQQL+Q+LE LDA LNLR+F+LGGL  SAAD+  
Sbjct: 65  SSFASASKEDVAHWTKLAQEKLVVKNFQQLAQTLEILDAQLNLRSFVLGGLNFSAADVAV 124

Query: 124 WGALRSNGMVGSIIKNKVYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKE 183
           WGALRSNGMVGSIIKNKVYVNVSRWY+ LEL P+FG +HE+LTKS+Q +KKA  AGKKKE
Sbjct: 125 WGALRSNGMVGSIIKNKVYVNVSRWYSFLELEPAFGESHEFLTKSLQELKKAANAGKKKE 184

Query: 184 GHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTN 243
            HKANFEIDL DAKMGEVVTRFPPEPSGYLHIGHAKAAILN+YFA AYKGKLIIRFDDTN
Sbjct: 185 SHKANFEIDLQDAKMGEVVTRFPPEPSGYLHIGHAKAAILNQYFAQAYKGKLIIRFDDTN 244

Query: 244 PSKERMEFQDAILEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMR 303
           PSKE+ EF+++I+EDL L+GIKGD++T+SSDYFQEMYD C+Q+IKEGKAYCDDT  EKMR
Sbjct: 245 PSKEKEEFEESIIEDLALLGIKGDRVTHSSDYFQEMYDYCIQMIKEGKAYCDDTPTEKMR 304

Query: 304 EERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRC 363
           EERMEG PSA+R+ SVEENL+IFTE+M NGTE G KNCVRAKIDYKA NKTLRDPVIYRC
Sbjct: 305 EERMEGEPSARRNRSVEENLKIFTEDMTNGTEEGLKNCVRAKIDYKALNKTLRDPVIYRC 364

Query: 364 NLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423
           NLTPHH T  +WK+YPTYDFCVPIVDS+EGVTHALRTIEYRDRNAQY+WML AL+LR VH
Sbjct: 365 NLTPHHITGDKWKVYPTYDFCVPIVDSLEGVTHALRTIEYRDRNAQYEWMLDALKLRHVH 424

Query: 424 IWDFARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQG 483
           IWDFARVNF+RTLLSKRKLQWMVD GLVSNWDDPRFPT        M++EGLRNFV+SQG
Sbjct: 425 IWDFARVNFVRTLLSKRKLQWMVDKGLVSNWDDPRFPTVRGVRRRGMSIEGLRNFVLSQG 484

Query: 484 PSKNVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNP 543
           PS+NVINLEWNLIWA NKK+IDP APRHTAVV+P ++ LEG   P+T K+E+KPKHKKNP
Sbjct: 485 PSRNVINLEWNLIWAFNKKVIDPTAPRHTAVVNPFKVHLEGSEVPQTDKIEMKPKHKKNP 544

Query: 544 AVGEKKVIYSNKIIIDKEDASVLEVGEELTLMDWGNIIITSKNADGSLVAKTNLGGDFKK 603
            VGEKKV++S  IIIDKEDA VLE GEE TLMDWGN IIT K+A+ S+ AK +L GDFKK
Sbjct: 545 DVGEKKVVFSKNIIIDKEDADVLEEGEEFTLMDWGNAIITKKDAN-SITAKLHLEGDFKK 603

Query: 604 TKHKVTWLANT-DYVPVEMVDFDHLITKDKLEEDENFTDFITPQTEFHTKAVGDVNVKDM 662
           TKHK+TWLA+T D V V++VDFDHL+ KD++EE E+F DF+T +TEFHT A+ D+NVKDM
Sbjct: 604 TKHKITWLADTKDVVSVDLVDFDHLLNKDRIEEGESFEDFLTEKTEFHTSAIADLNVKDM 663

Query: 663 KVGDIIQFERKGYCRLDSKAEGDKPYIFFTIPDGKSVNRYGAKK 706
           K+GD IQFERKGY RLDS  +   PY+FFTIPDGK+VN+YGAKK
Sbjct: 664 KIGDFIQFERKGYYRLDSLPKNGNPYVFFTIPDGKAVNKYGAKK 707

>YOR168W Chr15 (649303..651732) [2430 bp, 809 aa] {ON}
           GLN4Glutamine tRNA synthetase, monomeric class I tRNA
           synthetase that catalyzes the specific glutaminylation
           of tRNA(Glu); N-terminal domain proposed to be involved
           in enzyme-tRNA interactions
          Length = 809

 Score =  238 bits (606), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 132/375 (35%), Positives = 210/375 (56%), Gaps = 11/375 (2%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A  + G   +RFDDTNP KE  E+ ++I   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 259 LELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPSAK- 314
           +  +G K  KITYSSDYF E+Y L   LIK GKAY   C   ++++ R  + +G P  + 
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYRLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 369

Query: 315 -----RDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLTPHH 369
                RD S+E+NL+ F  +M++G     +  +R K D  + +  + D + YR    PH 
Sbjct: 370 YACKHRDQSIEQNLQEF-RDMRDGKYKPGEAILRMKQDLNSPSPQMWDLIAYRVLNAPHP 428

Query: 370 RTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWDFAR 429
           RT  +W++YPTYDF   +VDS+E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 429 RTGTKWRIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 430 VNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSKNVI 489
           +N   T+LSKRK+  +VD   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 490 NLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNPAVGEKK 549
           N++     +  +K ++   PR   V+DPVE+ ++   + +  ++   P     P  GE+ 
Sbjct: 549 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVVVDNL-SDDYEELATIPYRPGTPEFGERT 607

Query: 550 VIYSNKIIIDKEDAS 564
           V ++NK  I++ D S
Sbjct: 608 VPFTNKFYIERSDFS 622

>Smik_15.348 Chr15 (605412..607844) [2433 bp, 810 aa] {ON} YOR168W
           (REAL)
          Length = 810

 Score =  233 bits (594), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 131/377 (34%), Positives = 207/377 (54%), Gaps = 15/377 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A  + G   +RFDDTNP KE  E+ ++I   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGTCYLRFDDTNPEKEAPEYFESIKRM 310

Query: 259 LELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPSAKR 315
           +  +G    KITYSSDYF E+Y L   LIK GK Y   C   ++++ R  + +G P  +R
Sbjct: 311 VSWLGFMPWKITYSSDYFDELYGLAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPGGQR 370

Query: 316 ------DLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLTPHH 369
                 D S+E NL+ F  +M++G     +  +R K D  + +  + D + YR    PH 
Sbjct: 371 FACKHRDQSIELNLQEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 429

Query: 370 RTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWDFAR 429
           RT  +WK+YPTYDF   +VDS+E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 430 VNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSKNVI 489
           +N   T+LSKRK+  +VD   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 490 NLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLE--GEGAPETPKVELKPKHKKNPAVGE 547
           N++     +  +K ++   PR   V+DPVE+ ++   +   E   +  +P     P  GE
Sbjct: 550 NIQVVRFESAVRKYLEDTTPRLMFVLDPVEVIVDNLSDDYEELATIPFRP---GTPEFGE 606

Query: 548 KKVIYSNKIIIDKEDAS 564
           + V ++N+  I++ D S
Sbjct: 607 RTVPFTNRFYIERSDFS 623

>TDEL0G04190 Chr7 (761363..763792) [2430 bp, 809 aa] {ON} Anc_6.51
           YOR168W
          Length = 809

 Score =  231 bits (590), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 134/377 (35%), Positives = 207/377 (54%), Gaps = 15/377 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A    G+  +RFDDTNP  E  E+ ++I   
Sbjct: 252 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNGGETYLRFDDTNPEAEAPEYFESIKRM 311

Query: 259 LELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPSAKR 315
           +  +G K  KITYSSDYF ++Y+L   LIK GK Y   C   +V+  R  + +G P  +R
Sbjct: 312 VSWLGFKPFKITYSSDYFDKLYELAEVLIKSGKGYVCHCTSEEVKAGRGIKEDGTPGGER 371

Query: 316 ------DLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLTPHH 369
                 D S+EE L  F  +M+NG     +  +R K D  + +  + D V YR    PH 
Sbjct: 372 FACKDRDRSIEETLDEF-RKMRNGFYKPGEATLRMKQDLSSPSPQMWDLVAYRVLNAPHP 430

Query: 370 RTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWDFAR 429
           RT  +WK+YPTYDF   +VDS E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 431 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPTQREYGR 490

Query: 430 VNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSKNVI 489
           +N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 491 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 550

Query: 490 NLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEG--EGAPETPKVELKPKHKKNPAVGE 547
           N++     +  +K ++   PR   V+DPVE+ L+   E   E  K+  +P    +P  GE
Sbjct: 551 NIQVVRFESAIRKYLEDSTPRLMFVLDPVEVVLDNLPEDYEELVKIPFRP---GSPEFGE 607

Query: 548 KKVIYSNKIIIDKEDAS 564
           ++V ++ +  I++ D S
Sbjct: 608 REVPFTKRFFIERSDFS 624

>Skud_15.332 Chr15 (598097..600526) [2430 bp, 809 aa] {ON} YOR168W
           (REAL)
          Length = 809

 Score =  230 bits (586), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 129/375 (34%), Positives = 206/375 (54%), Gaps = 11/375 (2%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A  + G   +RFDDTNP KE  E+ ++I   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYARYHNGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 259 LELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPSAKR 315
           +  +G K  KITYSSDYF E+Y L   LI  GK Y   C   ++++ R  + +G P  +R
Sbjct: 310 VSWLGFKPWKITYSSDYFDELYGLAEVLINNGKGYVCHCTGEEIKRSRGIKEDGTPGGER 369

Query: 316 ------DLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLTPHH 369
                 D S+E NL+ F  +M++G     +  +R K D  + +  + D + YR    PH 
Sbjct: 370 FACKHRDQSIELNLKEF-RDMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 370 RTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWDFAR 429
           RT  +WK+YPTYDF   +VDS+E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 430 VNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSKNVI 489
           +N   T+LSKRK+  +VD   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 490 NLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNPAVGEKK 549
           N++     +  +K ++   PR   V+DP+E+ ++     +  ++ + P        GE+ 
Sbjct: 549 NIQVIRFESAVRKYLEDTTPRLMFVLDPIEVVVDNL-PDDYEELAIIPFRPGTSEFGERT 607

Query: 550 VIYSNKIIIDKEDAS 564
           V ++NK  I++ D S
Sbjct: 608 VPFTNKFYIERSDFS 622

>ZYRO0C07018g Chr3 (528834..531245) [2412 bp, 803 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 803

 Score =  229 bits (583), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 141/419 (33%), Positives = 220/419 (52%), Gaps = 30/419 (7%)

Query: 173 KKAVTAGKKKEGHKANFEIDL----------PD-------AKMGEVVTRFPPEPSGYLHI 215
           KK  TAG K+      F  DL          P+       A  G V TRFPPEP+GYLHI
Sbjct: 206 KKDATAGPKRTMFSEGFLGDLHTVEDNPQNNPEHLVNHLKATHGLVHTRFPPEPNGYLHI 265

Query: 216 GHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLELMGIKGDKITYSSDY 275
           GH+KA ++N  +A  + G   +RFDDTNP  E  E+ ++I+  +  +G    KITYSSDY
Sbjct: 266 GHSKAIMVNFGYAKFHGGHCYLRFDDTNPEAEAPEYFESIIRMVNWLGFHPWKITYSSDY 325

Query: 276 FQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPSAKR------DLSVEENLRIF 326
           F ++Y+L  +LI +GK Y   C   +++  R  + +G P  +R        SVEENL  F
Sbjct: 326 FDQLYELAERLISKGKGYVCNCAAEEIKASRGIKPDGTPGGERHACKHRSRSVEENLTEF 385

Query: 327 TEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLTPHHRTKGQWKMYPTYDFCVP 386
             +MK+G     +  +R K D  + +  + D + YR    PH RT  +W++YPTYDF   
Sbjct: 386 -RKMKDGHYQPGEATLRMKQDLSSPSPQMWDLIAYRVLNAPHPRTGNKWRIYPTYDFTHC 444

Query: 387 IVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWDFARVNFMRTLLSKRKLQWMV 446
           +VDS E +TH+L T E+      Y+W+   + + +    ++ R+N   T+LSKRK+  +V
Sbjct: 445 LVDSFENITHSLCTTEFYLSRESYEWLCDQVDVFRPTQREYGRLNITGTVLSKRKIAKLV 504

Query: 447 DHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSKNVINLEWNLIWAVNKKIIDP 506
           D   V  WDDPR  T        +    + +F+ + G + +V N++     +  +K ++ 
Sbjct: 505 DEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSVTNIQLVRFESAIRKYLED 564

Query: 507 VAPRHTAVVDPVEITLEGEGAPET-PKVELKPKHKKNPAVGEKKVIYSNKIIIDKEDAS 564
             PR   ++DPVE+ +  +  P++   V   P     P  GE++V ++ ++ ID+ D S
Sbjct: 565 TTPRLMFILDPVEVVV--DNVPDSFEDVVSIPFRPGTPEFGEREVPFTKRVFIDRSDFS 621

>KNAG0M01100 Chr13 (194806..197205) [2400 bp, 799 aa] {ON} Anc_6.51
           YOR168W
          Length = 799

 Score =  229 bits (583), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 129/378 (34%), Positives = 207/378 (54%), Gaps = 11/378 (2%)

Query: 196 AKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAI 255
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A  + G   +RFDDTNP  E  E+ ++I
Sbjct: 246 ATAGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESI 305

Query: 256 LEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPS 312
              +  +G +  KITYSSDYF ++Y+L   LIK GK Y   C   ++ + R  + +G P 
Sbjct: 306 KRMVSWLGFEPWKITYSSDYFDKLYELAKVLIKNGKGYICHCTAEEIRRGRGIKEDGQPG 365

Query: 313 AKR------DLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLT 366
            +R      + S+E+NL  F E MK G     +  +R K D+ + +  + D + YR    
Sbjct: 366 GERFGCKHRENSIEKNLEEF-ENMKEGKYQPGEATLRMKQDFSSPSPQMWDLIAYRVLNA 424

Query: 367 PHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWD 426
           PH RT  +WK+YPTYDF   +VDS E +TH+L T E+      Y+W+   + + +    +
Sbjct: 425 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 484

Query: 427 FARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSK 486
           + R+N   T+LSKRK+  +V+  +V  WDDPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTILSKRKIAKLVEEKIVRGWDDPRLYTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 487 NVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNPAVG 546
           +V N++     +  +K ++   PR   V+DP+E+ ++         VE+ P    +   G
Sbjct: 545 SVTNIQAVRFESAIRKYLEETTPRLMFVLDPIEVVVDNLPEDHEELVEV-PYKAGSAEFG 603

Query: 547 EKKVIYSNKIIIDKEDAS 564
            + + ++N+  ID+ D S
Sbjct: 604 SRTLPFTNRFYIDRSDFS 621

>Suva_8.223 Chr8 (399431..401896) [2466 bp, 821 aa] {ON} YOR168W
           (REAL)
          Length = 821

 Score =  228 bits (582), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 129/375 (34%), Positives = 205/375 (54%), Gaps = 11/375 (2%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A  + G   +RFDDTNP KE  E+ ++I   
Sbjct: 250 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGTCYLRFDDTNPEKEAPEYFESIKRM 309

Query: 259 LELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPSAKR 315
           +  +G +  KITYSSDYF E+Y L   LI   K Y   C   ++++ R  + +G P  +R
Sbjct: 310 VSWLGFEPWKITYSSDYFDELYRLAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGER 369

Query: 316 ------DLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLTPHH 369
                 D  +E NL+ F   M++G     +  +R K D  + +  + D + YR    PH 
Sbjct: 370 FACKHRDQPIELNLQEF-RNMRDGKYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNAPHP 428

Query: 370 RTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWDFAR 429
           RT  +WK+YPTYDF   +VDS+E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 429 RTGTKWKIYPTYDFTHCLVDSMENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 488

Query: 430 VNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSKNVI 489
           +N   T+LSKRK+  +VD   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 489 LNITGTVLSKRKIAQLVDEKFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 548

Query: 490 NLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNPAVGEKK 549
           N++     +  +K ++   PR   V+DP+E+ ++   A +  ++   P     PA GE+ 
Sbjct: 549 NIQVVRFESAIRKYLEDTTPRLMFVLDPIEVVVDNL-ADDFEELATIPYRPGTPAFGERT 607

Query: 550 VIYSNKIIIDKEDAS 564
           V ++NK  I++ D S
Sbjct: 608 VPFTNKFYIERSDFS 622

>SAKL0E02134g Chr5 complement(162366..164771) [2406 bp, 801 aa] {ON}
           highly similar to uniprot|P13188 Saccharomyces
           cerevisiae YOR168W GLN4 Glutamine tRNA synthetase
           monomeric class I tRNA synthetase that catalyzes the
           specific glutaminylation of tRNA(Glu) N-terminal domain
           proposed to be involved in enzyme-tRNA interactions
          Length = 801

 Score =  227 bits (578), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 131/380 (34%), Positives = 208/380 (54%), Gaps = 15/380 (3%)

Query: 196 AKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAI 255
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A  + G   +RFDDTNP  E  E+ ++I
Sbjct: 243 ATDGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGVCYLRFDDTNPEAEAPEYFESI 302

Query: 256 LEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPS 312
              +  +G +  KITYSSDYF ++YDL   LIK GKAY   C   ++++ R  + +G P 
Sbjct: 303 KRMVSWLGFEPWKITYSSDYFDKLYDLAEVLIKNGKAYVCHCTAEEIKRGRGIKEDGTPG 362

Query: 313 AKR------DLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLT 366
            +R      D  +EENL  F  +M++G     +  +R K D  + +  + D + YR    
Sbjct: 363 GERVACVHRDRPIEENLEEF-RKMRDGVYKPGEAILRMKQDLSSPSPQMWDLIAYRVLNA 421

Query: 367 PHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWD 426
           PH RT  +WK+YPTYDF   +VDS E +TH+L T E+      Y+W+   + + +    +
Sbjct: 422 PHPRTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 481

Query: 427 FARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSK 486
           + R+N   T+LSKRK+  +V+ G+V  W+DPR  T        +    + +F+ + G + 
Sbjct: 482 YGRLNITGTVLSKRKIAKLVNEGIVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 541

Query: 487 NVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEG--EGAPETPKVELKPKHKKNPA 544
           +  N++     +  +K ++    R   V+DPVEI ++   E   E   +  +P     P 
Sbjct: 542 STTNIQVVRFESAIRKYLEDTTARLMFVLDPVEIVVDNLPEDYEEMVTIPYRP---GTPE 598

Query: 545 VGEKKVIYSNKIIIDKEDAS 564
            G++ V ++ K  I++ D S
Sbjct: 599 FGDRTVPFTKKFFIERSDFS 618

>NDAI0K02860 Chr11 (646106..648550) [2445 bp, 814 aa] {ON} Anc_6.51
           YOR168W
          Length = 814

 Score =  224 bits (570), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 127/375 (33%), Positives = 201/375 (53%), Gaps = 11/375 (2%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A  + G   +RFDDTNP  E  E+ ++I   
Sbjct: 255 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 314

Query: 259 LELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPSAKR 315
           +  +G    KITYSSDYF ++YDL   LI  GK Y   C   ++++ R  + +G P  +R
Sbjct: 315 VHWLGFTPWKITYSSDYFDKLYDLAELLINNGKGYICHCTAEEIKRGRGIKEDGTPGGER 374

Query: 316 ------DLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLTPHH 369
                 D  +EENL+ F   M++G     +  +R K D  + +  + D + YR     H 
Sbjct: 375 HACKHRDRPIEENLQEF-RNMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAAHP 433

Query: 370 RTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWDFAR 429
           RT  +WK+YPTYDF   +VDS E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 434 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 493

Query: 430 VNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSKNVI 489
           +N   T+LSKRK+  +VD   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 494 LNITGTVLSKRKIAKLVDEKFVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 553

Query: 490 NLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNPAVGEKK 549
           N++     +  +K ++   PR   ++DP+E+ ++         V + P     P  GE+ 
Sbjct: 554 NIQVVRFESAIRKYLEDTTPRLMFILDPIEVIVDNLSDDYEELVTI-PYRAGTPEFGERT 612

Query: 550 VIYSNKIIIDKEDAS 564
           V ++NK  I++ D S
Sbjct: 613 VPFTNKFFIERSDFS 627

>CAGL0L04532g Chr12 (524088..526475) [2388 bp, 795 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168w GLN4
          Length = 795

 Score =  223 bits (568), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 129/379 (34%), Positives = 207/379 (54%), Gaps = 13/379 (3%)

Query: 196 AKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAI 255
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A  + G   +RFDDTNP  E  E+ ++I
Sbjct: 238 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESI 297

Query: 256 LEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPS 312
              +  +G K  K+TYSSDYF ++Y+L   LIK GK Y   C   ++++ R  + +G P 
Sbjct: 298 KRMVSWLGFKPWKVTYSSDYFDKLYELAEVLIKNGKGYVCHCTAEEIKRGRGIKEDGTPG 357

Query: 313 AKR------DLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLT 366
            +R      D SVE+NL  F   M++G     +  +R K + ++ +  + D + YR    
Sbjct: 358 GERHACKHRDQSVEKNLEEF-RAMRDGKYKPGEAILRMKQNLESPSPQMWDLIAYRVLNA 416

Query: 367 PHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWD 426
           PH RT  +WK+YPTYDF   +VDS E +TH+L T E+      Y+W+   + + +    +
Sbjct: 417 PHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 476

Query: 427 FARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSK 486
           + R+N   T+LSKRK+  +VD   V  WDDPR  T        +    + +F+ + G + 
Sbjct: 477 YGRLNITGTVLSKRKIAKLVDEHFVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 536

Query: 487 NVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPET-PKVELKPKHKKNPAV 545
           +  N++     +  +K ++   PR   ++DP+E+ +  E  PE   ++   P        
Sbjct: 537 STTNIQVVRFESAIRKYLEDSTPRLMMILDPIEVVV--ENLPEDYEELVTIPYRAGTKEF 594

Query: 546 GEKKVIYSNKIIIDKEDAS 564
           G++ V ++NK  I++ D S
Sbjct: 595 GDRNVPFTNKFYIERADFS 613

>TBLA0G00450 Chr7 complement(90053..92479) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  222 bits (565), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 125/375 (33%), Positives = 201/375 (53%), Gaps = 11/375 (2%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A  + G   +RFDDTNP  E  E+ ++I   
Sbjct: 251 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYHDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 259 LELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPSA-- 313
           +  +G K  KITYSSDYF ++Y+L   LI   K Y   C   ++++ R  + +G P    
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEVLINNDKGYICHCTAEEIKRGRGIKEDGTPGGDR 370

Query: 314 ----KRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLTPHH 369
                R+  +EENL+ F   M++G     +  +R K D  + +  + D + YR    PH 
Sbjct: 371 FACVHRNRPIEENLKEF-RSMRDGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 370 RTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWDFAR 429
           RT  +WK+YPTYDF   +VDS E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 430 RTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 430 VNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSKNVI 489
           +N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEEKYVRGWDDPRLFTLEAIRRRGVPPGSILSFINTLGVTTSTT 549

Query: 490 NLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNPAVGEKK 549
           N++     +  +K ++   PR   ++DP+E+ ++         V + P     P  GE+ 
Sbjct: 550 NIQVTRFESAIRKYLEDSTPRLMFILDPIEVVVDNLADDYEELVSI-PYRPATPEFGERN 608

Query: 550 VIYSNKIIIDKEDAS 564
           V ++NK  I++ D S
Sbjct: 609 VPFTNKFYIERSDFS 623

>Kpol_1037.38 s1037 complement(93063..95489) [2427 bp, 808 aa] {ON}
           complement(93063..95489) [2427 nt, 809 aa]
          Length = 808

 Score =  222 bits (565), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 126/377 (33%), Positives = 204/377 (54%), Gaps = 15/377 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A  + G   +RFDDTNP  E  E+ ++I   
Sbjct: 251 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKYWDGVCYLRFDDTNPEAEAPEYFESIKRM 310

Query: 259 LELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPSAKR 315
           +  +G K  KITYSSDYF ++Y+L   LI+  + Y   C   ++++ R  + +G P  +R
Sbjct: 311 VSWLGFKPWKITYSSDYFDKLYELAEILIQNDRGYICHCTAEEIKRGRGIKEDGTPGGER 370

Query: 316 ------DLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLTPHH 369
                 D  VEE+L+ F   M++G     +  +R K D  + +  + D + YR    PH 
Sbjct: 371 SACKHRDRPVEESLKEF-RNMRDGVYQPGEATLRMKQDLTSPSPQMWDLIAYRVLNAPHP 429

Query: 370 RTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWDFAR 429
           RT  +WK+YPTYDF   +VDS E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 430 RTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 489

Query: 430 VNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSKNVI 489
           +N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 490 LNITGTVLSKRKIAKLVEGNYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 549

Query: 490 NLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEG--EGAPETPKVELKPKHKKNPAVGE 547
           N++     +  +K ++   PR   V+DP+E+ ++   E   E   +  +P     P  GE
Sbjct: 550 NIQVVRFESAVRKFLEDTTPRLMFVLDPIEVVVDNLPEDYEEIASIPYRP---GTPEFGE 606

Query: 548 KKVIYSNKIIIDKEDAS 564
           + V ++ K  I++ D S
Sbjct: 607 RNVPFTKKFYIERSDFS 623

>AGR259C Chr7 complement(1227063..1229459) [2397 bp, 798 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR168W
           (GLN4)
          Length = 798

 Score =  221 bits (564), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/380 (33%), Positives = 201/380 (52%), Gaps = 15/380 (3%)

Query: 196 AKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAI 255
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A  + G   +RFDDTNP  E  E+ ++I
Sbjct: 242 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHHGGVCYLRFDDTNPEAEAPEYFESI 301

Query: 256 LEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMREER--------- 306
              +  +G    KITYSSDYF ++Y+L   LIK GK Y      E++R  R         
Sbjct: 302 ERMVAWLGFSPWKITYSSDYFDQLYELAEVLIKNGKGYICHCTAEEIRRGRGIKEDGTPG 361

Query: 307 MEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLT 366
            E +P A R+  +EENL  F   M++G     +  +R K D  + +  + D V YR    
Sbjct: 362 GERLPCAHRERPIEENLAEF-RNMRDGKYAPGEAILRMKQDLSSPSPQMWDLVAYRVLNA 420

Query: 367 PHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWD 426
           PH RT  +W++YPTYDF   +VDS+E +TH+L T E+      Y+W+   + + +    +
Sbjct: 421 PHPRTGSKWRIYPTYDFTHCLVDSLENITHSLCTAEFYLSRESYEWLCDQVHVFRPAQRE 480

Query: 427 FARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSK 486
           + R+N   T+LSKRK+  +V    V  WDDPR  T        +    + +F+ + G + 
Sbjct: 481 YGRLNITGTVLSKRKIAKLVHEKYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 540

Query: 487 NVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEG--EGAPETPKVELKPKHKKNPA 544
           +  N++     +  +K ++    R   V+DP+E+ ++   E   E   +  +P     P 
Sbjct: 541 STTNIQVVRFESAIRKYLEDTTARLMFVLDPIEVIVDNLPEDYEELVSIPYRP---GTPE 597

Query: 545 VGEKKVIYSNKIIIDKEDAS 564
            GE+ V +S +  I++ D S
Sbjct: 598 FGERTVPFSKRFYIERSDFS 617

>Kwal_56.22559 s56 complement(179568..181970) [2403 bp, 800 aa] {ON}
           YOR168W (GLN4) - glutaminyl-tRNA synthetase [contig 185]
           FULL
          Length = 800

 Score =  221 bits (563), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 130/380 (34%), Positives = 206/380 (54%), Gaps = 15/380 (3%)

Query: 196 AKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAI 255
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A    G   +RFDDTNP  E  E+ ++I
Sbjct: 242 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESI 301

Query: 256 LEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPS 312
              +  +G K  KITYSSDYF ++Y+L   LI   KAY   C   ++++ R  + +G P 
Sbjct: 302 KNMVAWLGFKPWKITYSSDYFDKLYELAEVLISNSKAYVCHCSGEEIKRGRGIKEDGTPG 361

Query: 313 AKR------DLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLT 366
            +R        SVEENL  F  +M++G     +  +R K D ++ +  + D + YR    
Sbjct: 362 GERRACVHRSRSVEENLTEF-RKMRDGHYKPGEAILRMKQDLESPSPQMWDLIAYRVLNA 420

Query: 367 PHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWD 426
           PH RT  +WK+YPTYDF   +VDS E +TH+L T E+      Y+W+   + + +    +
Sbjct: 421 PHPRTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 480

Query: 427 FARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSK 486
           + R+N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + 
Sbjct: 481 YGRLNITGTVLSKRKIAKLVNEHYVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 540

Query: 487 NVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEG--EGAPETPKVELKPKHKKNPA 544
           +  N++     +  +K ++   PR   ++DPVE+ ++   +   E  K+  +P     P 
Sbjct: 541 STTNIQVVRFESAIRKYLEDNTPRLMMILDPVEVVVDNLPDDYEELVKIPYRP---GTPE 597

Query: 545 VGEKKVIYSNKIIIDKEDAS 564
            GE+ V ++ K  I++ D S
Sbjct: 598 FGERSVPFTKKFYIERSDFS 617

>KLTH0C10340g Chr3 (857898..860300) [2403 bp, 800 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 800

 Score =  221 bits (562), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 130/377 (34%), Positives = 206/377 (54%), Gaps = 15/377 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A    G   +RFDDTNP  E  E+ ++I   
Sbjct: 245 GKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKHNDGVCYLRFDDTNPEAEAPEYFESIKSM 304

Query: 259 LELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPSAKR 315
           +  +G K  KITYSSDYF ++Y+L  +LI  GKAY   C   ++++ R  + +G P  +R
Sbjct: 305 VSWLGFKPWKITYSSDYFDKLYELAEKLITNGKAYVCHCTAEEIKRGRGIKEDGTPGGER 364

Query: 316 DL------SVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLTPHH 369
                   SVEENL  F  +M++G     +  +R K D ++ +  + D + YR     H 
Sbjct: 365 HACVHRGRSVEENLAEF-RKMRDGAYKPGEATLRMKQDLESPSPQMWDLIAYRVLNASHP 423

Query: 370 RTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWDFAR 429
           RT  +WK+YPTYDF   +VDS E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 424 RTGDKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 483

Query: 430 VNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSKNVI 489
           +N   T+LSKRK+  +V+   V  W+DPR  T        +    + +F+ + G + +  
Sbjct: 484 LNITGTILSKRKIAKLVNEHYVRGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSTT 543

Query: 490 NLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEG--EGAPETPKVELKPKHKKNPAVGE 547
           N++     +  +K ++   PR   V+DPVE+ ++   E   E   V  +P     P  GE
Sbjct: 544 NIQVVRFESAIRKYLEDNTPRLMMVLDPVEVVVDNLPEDYEELVTVPYRP---GTPEFGE 600

Query: 548 KKVIYSNKIIIDKEDAS 564
           ++V ++ K  I++ D S
Sbjct: 601 RQVPFTGKFYIERSDFS 617

>TPHA0J00550 Chr10 complement(123101..125527) [2427 bp, 808 aa] {ON}
           Anc_6.51 YOR168W
          Length = 808

 Score =  220 bits (561), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 123/378 (32%), Positives = 204/378 (53%), Gaps = 11/378 (2%)

Query: 196 AKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAI 255
           A  G V TRFPPEP+GYLHIGH+KA ++N  +A  + G   +RFDDTNP  E  E+ ++I
Sbjct: 248 ATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYWNGVCYLRFDDTNPEAEAPEYFESI 307

Query: 256 LEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPS 312
              +  +G K  K+TYSSDYF ++Y+L   LIK  K Y   C   ++++ R  + +G P 
Sbjct: 308 QRMVSWLGFKPWKVTYSSDYFDKLYELAEVLIKNDKGYICHCTAEEIKRGRGIKEDGTPG 367

Query: 313 AKR------DLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLT 366
            +R      D  +EE+L+ F   M+ G     +  +R K D  + +  + D + YR   +
Sbjct: 368 GERSACKHRDRPIEESLQEF-RNMREGKYQPGEAILRMKQDLTSPSPQMWDLIAYRVLNS 426

Query: 367 PHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWD 426
           PH RT  +WK+YPTYDF   +VDS E ++H+L T E+      Y+W+   + + +    +
Sbjct: 427 PHPRTGDKWKIYPTYDFTHCLVDSFENISHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 486

Query: 427 FARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSK 486
           + R+N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + 
Sbjct: 487 YGRLNITGTVLSKRKIAKLVEGSYVRGWDDPRLYTLEAIRRRGIPPGAILSFINTLGVTT 546

Query: 487 NVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNPAVG 546
           +  N++     +  +K ++   PR   ++DP+E+ +E         V + P    +   G
Sbjct: 547 STTNIQVARFESAIRKFLEDTTPRLMFILDPIEVIVENLSENYEELVTI-PYRAGSAEFG 605

Query: 547 EKKVIYSNKIIIDKEDAS 564
           +++V ++N+  I++ D S
Sbjct: 606 DRQVPFTNRFYIERSDFS 623

>KAFR0G02610 Chr7 (538902..541286) [2385 bp, 794 aa] {ON} Anc_6.51
           YOR168W
          Length = 794

 Score =  219 bits (559), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 129/373 (34%), Positives = 206/373 (55%), Gaps = 14/373 (3%)

Query: 199 GEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILED 258
           G+V TRFPPEP+GYLHIGH+KA ++N  +A  + GK  +RFDDTNP  E  E+ ++I   
Sbjct: 247 GKVHTRFPPEPNGYLHIGHSKAIMVNFGYAKHFGGKCYLRFDDTNPEAEAPEYFESIKRM 306

Query: 259 LELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPS--- 312
           +  +G K  KITYSSDYF ++YDL   LIK  K Y   C   ++++ R  + +G P    
Sbjct: 307 VSWLGFKPWKITYSSDYFDKLYDLAEFLIKSDKGYICHCTAEEIKRGRGIKEDGTPGGER 366

Query: 313 ---AKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLTPHH 369
              A R   +EE+L  F  +MK+G     K  +R K D ++ N  + D + YR    PH 
Sbjct: 367 SACAHRSRPIEESLAEF-RKMKDGFYEPGKAILRMKQDLQSPNPQMWDLIAYRVLNAPHP 425

Query: 370 RTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWDFAR 429
           RT  +W++YPTYDF   +VDS E +TH+L T E+      Y+W+   + + +    ++ R
Sbjct: 426 RTGDKWRIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQREYGR 485

Query: 430 VNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSKNVI 489
           +N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + +  
Sbjct: 486 LNITGTILSKRKIAKLVELHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTTSDT 545

Query: 490 NLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNPAVGEKK 549
           N++        +K ++   PR   ++DP+EI ++   A +  ++   P  KK    G++ 
Sbjct: 546 NIQVARFETAVRKYLEETTPRLMFILDPIEIIVDNL-AEDYEEIVSIPYSKK---FGDRT 601

Query: 550 VIYSNKIIIDKED 562
           V ++ +I I+++D
Sbjct: 602 VPFTKRIYIERKD 614

>NCAS0F00240 Chr6 complement(37406..39841) [2436 bp, 811 aa] {ON}
           Anc_6.51 YOR168W
          Length = 811

 Score =  219 bits (557), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 128/379 (33%), Positives = 202/379 (53%), Gaps = 13/379 (3%)

Query: 196 AKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAI 255
           A  G+V TRFPPEP+GYLHIGH+KA ++N  +A    G  I+RFDDTNP  E  E+ ++I
Sbjct: 251 ATGGKVRTRFPPEPNGYLHIGHSKAIMVNFGYAKYNDGVCILRFDDTNPEAEAPEYFESI 310

Query: 256 LEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPS 312
              +  +G    KITYSSDYF ++YDL   LI   + Y   C   ++++ R  + +G P 
Sbjct: 311 KRMVSWLGFVPWKITYSSDYFDKLYDLAEVLINNDRGYICHCTAEEIKRGRGIKEDGTPG 370

Query: 313 AKRDL------SVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLT 366
            +R        S+E NL+ F   M++G     +  +R K D  + +  + D + YR    
Sbjct: 371 GERSACVHRSNSIETNLKEF-RNMRDGVYKPGEATLRMKQDLTSPSPQMWDLIAYRVLNA 429

Query: 367 PHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWD 426
           PH RT  +WK+YPTYDF   +VDS E +TH+L T E+R     Y+W+   + + +    +
Sbjct: 430 PHPRTGTKWKIYPTYDFTHCLVDSFENITHSLCTTEFRLSRESYEWLCDQVHVFRPAQRE 489

Query: 427 FARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSK 486
           + R+N   T+LSKRK+  +VD   V  WDDPR  T        +    + +F+ + G + 
Sbjct: 490 YGRLNITGTVLSKRKIAKLVDEHHVRGWDDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 549

Query: 487 NVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELK-PKHKKNPAV 545
           +  N++        +K ++   PR   ++DP+EI +  +  PE  +  L  P     P  
Sbjct: 550 STTNIQVARFENSIRKYLEDSTPRLMFILDPIEIVV--DNLPEDYEEILSIPYRAGTPEF 607

Query: 546 GEKKVIYSNKIIIDKEDAS 564
           G++ V ++ +  I++ D S
Sbjct: 608 GDRTVPFTKRFYIERSDFS 626

>Ecym_3135 Chr3 (250906..253320) [2415 bp, 804 aa] {ON} similar to
           Ashbya gossypii AGR259C
          Length = 804

 Score =  213 bits (543), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 124/380 (32%), Positives = 201/380 (52%), Gaps = 15/380 (3%)

Query: 196 AKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAI 255
           A  G V TRFPPEP+GYLHIGH+KA ++N  +A  + G   +RFDDTNP  E  E+ ++I
Sbjct: 248 ATGGRVQTRFPPEPNGYLHIGHSKAIMVNFGYAKYHNGICYLRFDDTNPEAEAPEYFESI 307

Query: 256 LEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPS 312
              +  +G K  KITYSSDYF ++YDL   LI+  K Y   C   ++++ R  + +G P 
Sbjct: 308 ERMVTWLGFKPWKITYSSDYFDQLYDLAEVLIQNNKGYVCHCTGEEIKRGRGIKEDGTPG 367

Query: 313 AKR------DLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLT 366
            +R      + S+ ENL  F  +M++G     +  +R K D  + +  + D + YR    
Sbjct: 368 GERKSCSHRERSITENLAAF-RKMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDA 426

Query: 367 PHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWD 426
           PH RT  +WK+YPTYDF   +VDS E +TH+L T E+      Y+W+   + + +    +
Sbjct: 427 PHPRTGSKWKIYPTYDFTHCLVDSFENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 486

Query: 427 FARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSK 486
           + R+N   T+LSKRK+  +V+   V  WDDPR  T        +    + +F+ + G + 
Sbjct: 487 YGRLNITGTVLSKRKIARLVNEKYVRGWDDPRLFTLEAIRRRGIPPGAILSFINTLGVTT 546

Query: 487 NVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEG--EGAPETPKVELKPKHKKNPA 544
              N++     +  +K ++    R   ++DP+E+ +    E   E   +  +P     P 
Sbjct: 547 TTTNIQVVRFESAIRKYLEDTTARLMFLLDPIEVVVNNLPEDYQELVTIPYRP---GTPE 603

Query: 545 VGEKKVIYSNKIIIDKEDAS 564
            G++ V ++ +  I++ D S
Sbjct: 604 FGDRTVPFTKRFYIERTDFS 623

>KLLA0F20449g Chr6 (1898253..1900667) [2415 bp, 804 aa] {ON} highly
           similar to uniprot|P13188 Saccharomyces cerevisiae
           YOR168W GLN4 Glutamine tRNA synthetase monomeric class I
           tRNA synthetase that catalyzes the specific
           glutaminylation of tRNA(Glu) N-terminal domain proposed
           to be involved in enzyme-tRNA interactions
          Length = 804

 Score =  211 bits (537), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 128/378 (33%), Positives = 203/378 (53%), Gaps = 11/378 (2%)

Query: 196 AKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAI 255
           A  G+V TRFPPEP+GYLHIGH+KA ++N  FA  + G   +RFDDTNP  E  E+ ++I
Sbjct: 246 ATGGKVHTRFPPEPNGYLHIGHSKAIMVNFGFAKYHNGVCYLRFDDTNPEAEAPEYFESI 305

Query: 256 LEDLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPS 312
              +  +G K  K TYSSDYF E+Y L   LIK GKAY   C   ++++ R  + +G P 
Sbjct: 306 KSMVSWLGFKPWKTTYSSDYFDELYQLAETLIKNGKAYVCHCSAEEIKRGRGIKEDGTPG 365

Query: 313 AKRDLSV------EENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLT 366
            +R   V      EE+L  F  +M++G     +  +R K D  + +  + D + YR    
Sbjct: 366 GERKACVSRERPIEESLTEF-RKMRDGFYKPGEAILRMKQDLNSPSPQMWDLIAYRVLDA 424

Query: 367 PHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIWD 426
           PH RT  +WK+YPTYDF   +VDS+E +TH+L T E+      Y+W+   + + +    +
Sbjct: 425 PHPRTGDKWKIYPTYDFTHCLVDSLENITHSLCTTEFYLSRESYEWLCDQVHVFRPAQRE 484

Query: 427 FARVNFMRTLLSKRKLQWMVDHGLVSNWDDPRFPTXXXXXXXXMTVEGLRNFVISQGPSK 486
           + R+N   T+LSKRK+  +V  G VS W+DPR  T        +    + +F+ + G + 
Sbjct: 485 YGRLNITGTVLSKRKIAKLVTGGYVSGWNDPRLFTLEAIRRRGVPPGAILSFINTLGVTT 544

Query: 487 NVINLEWNLIWAVNKKIIDPVAPRHTAVVDPVEITLEGEGAPETPKVELKPKHKKNPAVG 546
           +  N++     +  +K ++   PR   ++DPVE+ ++           + P     P  G
Sbjct: 545 STTNIQVVRFESAIRKYLEDTTPRLMFILDPVEVVVDNVDEDFVELCNI-PYRPNTPEFG 603

Query: 547 EKKVIYSNKIIIDKEDAS 564
           ++ V ++ +  I++ D S
Sbjct: 604 DRTVPFTKRFYIERSDFS 621

>KNAG0L00620 Chr12 complement(92148..93701) [1554 bp, 517 aa] {ON}
           Anc_7.100 YOL033W
          Length = 517

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 99/232 (42%), Gaps = 26/232 (11%)

Query: 198 MGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILE 257
           +  VVTRF P P+G LH+G  + A+ N   A    GK I+R +DT+  +   E +  IL+
Sbjct: 38  VAPVVTRFAPSPTGLLHLGSLRTALYNYLLAKNTGGKFILRLEDTDRKRYHAEAEQNILD 97

Query: 258 DLELMGIKGDKITY-SSDYFQE-MYD-LCVQLIKEGKAYCDDTDVEKMREERMEGIPSAK 314
            L+   IK D   Y  SD  +E +Y     QL+K G AY      E++   R EG     
Sbjct: 98  TLDWCHIKWDGPMYRQSDRAREGLYTRYAEQLVKGGFAYKCFCSKERLNNLREEGYDRHC 157

Query: 315 RDLSVEE---------NLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNL 365
             LS +E          +R    E+ +  +      VR  I  +       DPV+ + + 
Sbjct: 158 THLSDQEVNAFQGTPYVIRFKAPEVYDAVDDLLHGSVR--IQPRRDRHGFDDPVLLKSD- 214

Query: 366 TPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKAL 417
                       +PTY     + D + GVTH +R  E+     ++  M KA 
Sbjct: 215 -----------RFPTYHLANVVDDHLMGVTHVIRGEEWLPSTPKHIAMYKAF 255

>NDAI0A08460 Chr1 (1951121..1952710) [1590 bp, 529 aa] {ON}
           Anc_7.100 YOL033W
          Length = 529

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 69/267 (25%), Positives = 113/267 (42%), Gaps = 45/267 (16%)

Query: 202 VTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLEL 261
           +TRF P P+G LH+G  + A+ N   A +  GK I+R +DT+ S+   E    I E L+ 
Sbjct: 43  ITRFAPSPTGLLHLGSLRTALYNYLLARSTNGKFILRLEDTDQSRIHPEAISNIYETLKW 102

Query: 262 MGIKGDK-ITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREE--RMEGIPSAKR 315
            GI  D+     SD     +     L+  G AY   C    +E++R +       PS  R
Sbjct: 103 CGINYDEGFIKQSDRLPIYHKYIKILLDSGAAYHCFCTKDRLEQLRRKNSNTPNSPSYDR 162

Query: 316 DLS------VEENLRI---FTEEMKNGTEFGQ-KNCVRAKIDYKAANKT----LRDPVIY 361
           +        VE NL     +T  +K+   +    + +  ++D +   K       DP++ 
Sbjct: 163 NCYHLDTEIVESNLTANLPYTIRLKSPDRYPPFTDLLHGQVDIQLNQKERGVWFDDPILI 222

Query: 362 RCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRK 421
           + +             YPTY F   + D + G+TH +R  E+           K + L +
Sbjct: 223 KSD------------GYPTYHFANVVDDHLMGITHVIRGEEWLPSTP------KHVALYQ 264

Query: 422 VHIWD---FARVNFMRTL----LSKRK 441
           +  WD   F  +  + ++    LSKRK
Sbjct: 265 LFGWDMPKFIHIPLLTSIDDKKLSKRK 291

>NCAS0I00560 Chr9 complement(89020..90603) [1584 bp, 527 aa] {ON}
           Anc_7.100 YOL033W
          Length = 527

 Score = 64.7 bits (156), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 58/217 (26%), Positives = 96/217 (44%), Gaps = 22/217 (10%)

Query: 201 VVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLE 260
           V+TRF P P+G LH+G  + A+ N   A    GK I+R +DT+ ++   E    I + L+
Sbjct: 46  VITRFAPSPTGLLHLGSLRTALYNYLLAKNTNGKFILRLEDTDQTRLHPEALKNIFDTLK 105

Query: 261 LMGIKGDKITYSSDYFQEMYDLCV-QLIKEGKAY---CDDTDVEKMREERMEGIPSAKRD 316
              ++ D+          +Y   + +L+K G AY   C    +E++R   M     A   
Sbjct: 106 WCNMEYDEGPIEQSQRLPIYQEYIKKLLKSGHAYYCFCSRERLEQLRTGNM-----APGS 160

Query: 317 LSVEENLRIFTEE-MKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLTPHHRTKGQW 375
           LS +       EE +K   + G    +R K   +     + D +    N+ P++R +G W
Sbjct: 161 LSYDRKCIHLDEETIKVNLDKGIPYTIRMKSPERYP--LIHDLLHGELNIQPNNR-EGMW 217

Query: 376 ---------KMYPTYDFCVPIVDSIEGVTHALRTIEY 403
                      +PTY F   + D +  VTH +R  E+
Sbjct: 218 FDDPILIKSDGFPTYHFANVVDDHLMKVTHVIRGEEW 254

>CAGL0F01133g Chr6 complement(114888..116486) [1599 bp, 532 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033w MSE1
          Length = 532

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 97/219 (44%), Gaps = 22/219 (10%)

Query: 201 VVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLE 260
            VTRF P P+G LH+G  + A+ N   A    GK I+R +DT+ S+ +    D I   L+
Sbjct: 46  AVTRFAPSPTGMLHLGSLRTALYNYLLAKKTGGKFILRIEDTDRSRLKDGAMDNIYNSLK 105

Query: 261 LMGIKGDKITYSSDYFQEMYDLCV-QLIKEGKAY---CDDTDVEKMREERMEGIPSAKRD 316
              +K D+  Y      ++Y   +  LI+ G+AY   C    ++ +R+  +  +P    +
Sbjct: 106 WCNLKWDEGPYLQSERTDIYRKHINHLIETGRAYRCFCTKERLDDLRQSALRLVPPT--N 163

Query: 317 LSVEENLRIFTE-EMKNGTEFGQKNCVRAKIDYKAANK--TLRDPVIYRCNLTPHHRTKG 373
           +S + +    +E E+K+  + G    VR    +KA  K     D +  + +L P      
Sbjct: 164 VSYDRHCAHLSEGEIKSKLDQGIPFTVR----FKAPEKYPPFEDLLHGKIDLQPQQNPSD 219

Query: 374 ---------QWKMYPTYDFCVPIVDSIEGVTHALRTIEY 403
                    +   YPTY     I D    ++H +R  E+
Sbjct: 220 IRYDDPILMKSDNYPTYHLANVIDDHDMKISHVIRGEEW 258

>TPHA0L00590 Chr12 complement(100345..102021) [1677 bp, 558 aa] {ON}
           Anc_7.100 YOL033W
          Length = 558

 Score = 60.5 bits (145), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 64/278 (23%), Positives = 117/278 (42%), Gaps = 54/278 (19%)

Query: 201 VVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLE 260
           V TRF P P+G++H+G  + A+ N   A +  G+ ++R +DT+  +     ++ I E L+
Sbjct: 46  VRTRFAPSPTGFMHLGSLRTALYNYLLAKSTGGQFLLRLEDTDQKRLVEGAEEDIYETLK 105

Query: 261 LMGIKGDK-ITYSSDYF--------QEMYDLCVQLIKEG----KAYCDDTDVEKMRE--E 305
             GI+ D+    +S+ +         ++Y   ++++ E     K +C    +++M+E  +
Sbjct: 106 WCGIEYDEGPNVNSEAYGPFRQSERTKIYAKHIKVLLENGDAYKCFCTKERLDEMKESAQ 165

Query: 306 RMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAK-------------------I 346
           ++    SA  D      L +  EE+K          +R K                   I
Sbjct: 166 KLNPPSSASYDRHC---LHLNEEEIKQKELLNSPYTIRLKSPEKYPEFEDLLHGKLSIQI 222

Query: 347 DYKAANKTLRDPVIYRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDR 406
            Y    KT  DP++ + +              PTY F   + D +  +TH +R  E+   
Sbjct: 223 QYNPHKKTYDDPILIKSD------------GLPTYHFANVVDDHLMKITHVIRGEEWLPS 270

Query: 407 NAQYDWMLKAL---RLRKVHIWDFARVNFMRTLLSKRK 441
             ++  M  AL     + +HI     +N  +  LSKRK
Sbjct: 271 TPKHISMYNALGWQAPKYIHIPLLTSINDKK--LSKRK 306

>Suva_15.134 Chr15 (235964..237571) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 83/365 (22%), Positives = 138/365 (37%), Gaps = 56/365 (15%)

Query: 201 VVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLE 260
           V TRF P P+G+LH+G  + A+ N   A   KG+ ++R +DT+  +     ++ I E L+
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTKGQFLLRLEDTDQKRLVPGAEENIYEVLK 104

Query: 261 LMGIKGDKITYSSDYFQEMYDLCVQ-LIKEGKAY---CDDTDVEKMREERMEGIPSAKRD 316
              I  D+        + +YD  V+ L+  G AY   C    +  +R   ME  P     
Sbjct: 105 WCKISYDETPVKQSERKSVYDKYVKILLSSGMAYRCFCSKERLNDLRRSAMELKPP---- 160

Query: 317 LSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANK--TLRDPVIYRCNLTPHHRTKGQ 374
            S+    R      K   E      +   + +K+  +  T  D +    NL P      +
Sbjct: 161 -SMASYDRCCAHLAKEEIESKLAQDMPFTVRFKSPEQYPTFTDVLHGEINLQPQVNYNDR 219

Query: 375 W---------KMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIW 425
                        PTY     + D + G+TH +R  E+     ++  +  A        W
Sbjct: 220 RYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------W 273

Query: 426 D---FARVNFMRTL----LSKRK--------------LQWMVDHGLVSNWDDPRFPTXXX 464
           D   F  +  + T+    LSKRK               + +V+   +  W  PR      
Sbjct: 274 DYPKFIHIPLLTTVGDKKLSKRKGDMSISSLKNQGILPEALVNFCALFGWSPPR--DLAS 331

Query: 465 XXXXXMTVEGLRNFVISQGPSKNVINLEWNLIWAVNK-----KIIDPVAPRHTAVVDPVE 519
                 ++E L       G +K    ++   +W  NK     +I DPV  +   +VD + 
Sbjct: 332 KKHECFSMEDLEKLFNLNGLTKGNAKVDDKKLWFFNKHFLQERISDPVMLKE--LVDGIM 389

Query: 520 ITLEG 524
            +LE 
Sbjct: 390 PSLES 394

>YOL033W Chr15 (263475..265085) [1611 bp, 536 aa] {ON}
           MSE1Mitochondrial glutamyl-tRNA synthetase, predicted to
           be palmitoylated
          Length = 536

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 88/367 (23%), Positives = 143/367 (38%), Gaps = 60/367 (16%)

Query: 201 VVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLE 260
           V TRF P P+G+LH+G  + A+ N   A    G+ ++R +DT+  +     ++ I E L+
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIEGAEENIYEILK 104

Query: 261 LMGIKGDKITYSSDYFQEMYDLCVQ-LIKEGKAY---CDDTDVEKMREERMEGIPS--AK 314
              I  D+        + +YD  V+ L+  GKAY   C    +  +R   ME  P   A 
Sbjct: 105 WCNINYDETPIKQSERKLIYDKYVKILLSSGKAYRCFCSKERLNDLRHSAMELKPPSMAS 164

Query: 315 RDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLTPHHRTKGQ 374
            D        +  EE+K+    G    VR K   +    T  D +  + NL P  +    
Sbjct: 165 YDRCCAH---LGEEEIKSKLAQGIPFTVRFKSPERYP--TFTDLLHGQINLQP--QVNFN 217

Query: 375 WKMY-----------PTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVH 423
            K Y           PTY     + D + G+TH +R  E+     ++  +  A       
Sbjct: 218 DKRYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG----- 272

Query: 424 IW---DFARVNFMRTL----LSKR---------KLQWMVDHGLVS-----NWDDPRFPTX 462
            W    F  +  + T+    LSKR         K Q ++   L++      W  PR    
Sbjct: 273 -WACPKFIHIPLLTTVGDKKLSKRKGDMSISDLKRQGVLPEALINFCALFGWSPPR--DL 329

Query: 463 XXXXXXXMTVEGLRNFVISQGPSKNVINLEWNLIWAVN-----KKIIDPVAPRHTAVVDP 517
                   ++E L       G +K    ++   +W  N     K+I++P   R   +VD 
Sbjct: 330 ASKKHECFSMEELETIFNLNGLTKGNAKVDDKKLWFFNKHFLQKRILNPSTLRE--LVDD 387

Query: 518 VEITLEG 524
           +  +LE 
Sbjct: 388 IMPSLES 394

>KAFR0D01320 Chr4 complement(262226..263770) [1545 bp, 514 aa] {ON}
           Anc_7.100 YOL033W
          Length = 514

 Score = 59.7 bits (143), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 96/238 (40%), Gaps = 41/238 (17%)

Query: 200 EVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDL 259
            VVTRF P P+G LHIG  + A+ N   A +  GK I+R +DT+ ++ +   +  I + L
Sbjct: 39  RVVTRFAPSPTGLLHIGSLRTALYNFLLARSTNGKFILRIEDTDRTRLKSGAEQDICDIL 98

Query: 260 ELMGIKGD-KITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMREERMEGIPSAKRDLS 318
               +K D      SD      +   +L++ G AY      +++   R  G       LS
Sbjct: 99  NWCNLKYDVGPIRQSDRIPIYEEYANKLLETGAAYRCFCTKDRLSTMRAHGYDRHCLHLS 158

Query: 319 VEENLRIFT-------------------EEMKNGTEFGQKNCVRAKIDYKAANKTLRDPV 359
             +  R+F                    ++M +GT   Q+   R   D         DP+
Sbjct: 159 DNDVRRLFDAGHTRPVLRLKSPNKYDSFQDMLHGTVNIQERKDRVGFD---------DPI 209

Query: 360 IYRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKAL 417
           + + +             +PTY F   + D +  VTH +R  E+     ++  + KAL
Sbjct: 210 LMKSD------------GFPTYHFANVVDDHLMEVTHVIRGDEWLPSTPKHIALYKAL 255

>Skud_15.122 Chr15 (222353..223951) [1599 bp, 532 aa] {ON} YOL033W
           (REAL)
          Length = 532

 Score = 57.8 bits (138), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 75/323 (23%), Positives = 126/323 (39%), Gaps = 50/323 (15%)

Query: 141 VYVNVSRWYTLLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKEGHKANFEIDLPDAKMGE 200
           + + + R +  L L P+ G     L KS+      ++   K++ H ++            
Sbjct: 2   ILLRIPRRFYCLSLKPTKGVGPSSLNKSL------LSRKTKEDIHPSS-----------P 44

Query: 201 VVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLE 260
           V TRF P P+G+LH+G  + A+ N   A    G+ ++R +DT+  +     ++ I + L+
Sbjct: 45  VRTRFAPSPTGFLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLIPGAEENIYDVLK 104

Query: 261 LMGIKGDKITYSSDYFQEMYDLCVQ-LIKEGKAY---CDDTDVEKMREERMEGIPS--AK 314
              I  D+        + +YD  V+ L+  G AY   C    + ++R   ME  P   A 
Sbjct: 105 WCKINYDETAVKQSERKPIYDKYVKILLSSGMAYRCFCSKERLNELRRSAMELKPPSMAS 164

Query: 315 RDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLTPHHRTKGQ 374
            D        +  EE+ +    G    VR K   K       D +    NL P      +
Sbjct: 165 YDRCCS---YLGEEEVNSKLSQGMPFTVRFKSPEKYP--LFADLLHGEINLQPQVNFNDR 219

Query: 375 W---------KMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRKVHIW 425
                        PTY     + D + G+TH +R  E+     ++  +  A        W
Sbjct: 220 RYDDLILVKSDKLPTYHLANVVDDHLMGITHVIRGEEWLPSTPKHIALYNAFG------W 273

Query: 426 D---FARVNFMRTL----LSKRK 441
           D   F  +  + T+    LSKRK
Sbjct: 274 DCPKFIHIPLLTTVGDKKLSKRK 296

>Ecym_2626 Chr2 (1212098..1213819) [1722 bp, 573 aa] {ON} similar to
           Ashbya gossypii AEL338C
          Length = 573

 Score = 57.4 bits (137), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 72/315 (22%), Positives = 134/315 (42%), Gaps = 42/315 (13%)

Query: 168 SMQGIKKAVTAGKKKEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYF 227
           S+QG KKA   GK     +   +   P        TRF P P+G+LH+G  + A+ N   
Sbjct: 30  SLQGHKKAALHGKINLLLRHPIQDRHPKK---PARTRFAPSPTGFLHLGSLRTALFNYLL 86

Query: 228 AHAYKGKLIIRFDDTNPSKERMEFQDAILEDLELMGIKGDK-----ITY----SSDYFQE 278
           A    G+ ++R +DT+ ++     +  + +  + +GI+ D+      TY     SD  + 
Sbjct: 87  AKKTGGQFLLRLEDTDRTRLVPGSEQNLYDSFKWLGIQYDEGPGVNETYGPYRQSDRTEI 146

Query: 279 MYDLCVQLIKEGKAY---CDDTDVEKMREERMEGIPSAKRDLSVEENL-RIFTEEMKNGT 334
                 QLI  G AY   C    ++ +R+  M   P    +++ + +  ++  E++++  
Sbjct: 147 YKKYSDQLISTGHAYRCFCSKERLKGLRDSAMALKPPT--NVTYDRHCAKLSKEDIRSKI 204

Query: 335 EFGQKNCVRAKID--YKAANKTLRDPVIYRCNLTPHH---------RTKGQWKMYPTYDF 383
           + G    +R K    Y+     L + +  +  + P           ++ G     PTY F
Sbjct: 205 KMGVPYTIRLKSPEIYEPFEDLLHNEINLQPQINPIDVRYDDPILIKSSG----LPTYHF 260

Query: 384 CVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKALRLRK---VHIWDFARVNFMRTLLSKR 440
              I D +  +TH +R  E+     ++  + KA        +H+   A  N  +  LSKR
Sbjct: 261 AHVIDDHLMEITHVIRGQEWLPATPKHIVLYKAFGWNPPQFIHLPLLASTNNKK--LSKR 318

Query: 441 K----LQWMVDHGLV 451
           K    +Q + + G++
Sbjct: 319 KGDTNIQQLREKGIL 333

>KLLA0F07975g Chr6 complement(746708..748336) [1629 bp, 542 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 542

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 61/275 (22%), Positives = 112/275 (40%), Gaps = 49/275 (17%)

Query: 201 VVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLE 260
           V TRF P P+G+LH+G  + A+ N   A    G+ ++R +DT+  +     + ++ + L+
Sbjct: 51  VRTRFAPSPTGFLHMGSLRTALYNYLLAKNTGGEFLLRLEDTDQKRLVPGAEQSLYDALK 110

Query: 261 LMGIKGD------------KITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMREERME 308
              IK D            + +  +  +QE  +  V+     K +C    ++ +RE   +
Sbjct: 111 WCNIKYDEGPGVNEIYGPYRQSDRTKIYQEYINTLVEKGDAYKCFCSKERLDALRESAQK 170

Query: 309 GIP----------SAKRDLSVEENLRI---FTEEMKNGTEFGQ-KNCVRAKIDYKAANKT 354
             P          S   D  VE NL+    FT   K+  ++   ++ +  K+D +     
Sbjct: 171 LQPPTTVSYDRHCSKLSDQEVEANLKAGIPFTVRFKSPDKYPPFEDLLHGKLDIQPQVNP 230

Query: 355 L----RDPVIYRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQY 410
           L     DP++ + +              PTY F   I D +  +TH +R  E+     ++
Sbjct: 231 LDIRYDDPILMKSD------------NLPTYHFANVIDDHLMKITHVIRGEEWLPSTPKH 278

Query: 411 DWMLKALRLRKVHIWDFARVNFMRTL----LSKRK 441
             + +A      H   +  +  + T     LSKRK
Sbjct: 279 TALYEAYGWTPPH---YVHIPLLTTTSDKKLSKRK 310

>Kpol_1044.12 s1044 complement(21668..23278) [1611 bp, 536 aa] {ON}
           complement(21668..23278) [1611 nt, 537 aa]
          Length = 536

 Score = 55.5 bits (132), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 100/227 (44%), Gaps = 23/227 (10%)

Query: 198 MGEVVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILE 257
           +  V TRF P P+G+LH+G  + A+ N   A    G+ ++R +DT+  +   + ++ I E
Sbjct: 38  ISPVRTRFAPSPTGFLHLGSLRTALYNYLLAKNTGGQFLLRLEDTDRKRLVKDAEENIYE 97

Query: 258 DLELMGIKGDKITYSSD-----YFQ----EMYDLCV-QLIKEGKAY---CDDTDVEKMRE 304
            L+  GI  D+   S +     Y Q    ++Y   + +L+  G AY   C    ++ +R+
Sbjct: 98  SLKWCGIDYDEGPNSQNQQFGPYRQSDRTKIYQKYIDKLLDNGHAYRCFCPKERLDSLRD 157

Query: 305 ERMEGIPSAKRDLSVEEN-LRIFTEEMKNGTEFGQKNCVRAKID--YKAANKTLRDPVIY 361
              +  P     +S + N L +  +E++N    G    VR K    Y   +  L   +  
Sbjct: 158 SAQKLQPPTT--VSYDRNCLHLNHDEIQNNINNGVSYTVRMKSPEIYPPFDDLLHGHINI 215

Query: 362 RCNLTPHHRTKGQWKM-----YPTYDFCVPIVDSIEGVTHALRTIEY 403
           +  +  + R      +      PTY F   I D +  +TH +R  E+
Sbjct: 216 QPQINSNDRRYDDPILMKSDNLPTYHFANVIDDHLMKITHVIRGEEW 262

>TBLA0E02180 Chr5 complement(532174..533769) [1596 bp, 531 aa] {ON}
           Anc_7.100 YOL033W
          Length = 531

 Score = 55.1 bits (131), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 61/278 (21%), Positives = 117/278 (42%), Gaps = 54/278 (19%)

Query: 201 VVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLE 260
           V TRF P P+G LH+G  + A+ N   A    G+ I+R +DT+  +     ++ I   L+
Sbjct: 44  VRTRFAPSPTGSLHLGSLRTALYNYLLARNTGGQFILRIEDTDQKRLVKGAEENIYSSLK 103

Query: 261 LMGIKGD-------------KITYSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMRE 304
            +G++ D             K +  S  +Q+  +   +L+  GKAY   C    +  ++E
Sbjct: 104 WLGLQFDEGPNGINGPYGPYKQSERSSIYQKYIN---ELLDNGKAYRCFCSKERLTGLKE 160

Query: 305 --ERMEGIPSAKRDL--------SVEENL--------RIFTEEMKNGTEFGQKNCVRAKI 346
             ++++   +A  D          +EENL        R+ + ++    E      +  + 
Sbjct: 161 SAQKLKPPTTASYDRKCTNLTKSQIEENLKNKVPYTVRLLSPDLYPAFEDLLHGKLNIQP 220

Query: 347 DYKAANKTLRDPVIYRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDR 406
            Y + ++   DPV+ + +              PTY F   + D +  ++H +R  E+   
Sbjct: 221 QYNSIDRRFDDPVLMKSD------------NLPTYHFANVVDDHLMKISHVIRGEEWLPS 268

Query: 407 NAQYDWMLKALRLRK---VHIWDFARVNFMRTLLSKRK 441
             ++  + +A   +    +HI     +N  +  LSKRK
Sbjct: 269 TPKHIAIYEAFGWKPPKYIHIPLLTTLNDKK--LSKRK 304

>TDEL0H03500 Chr8 (582143..583747) [1605 bp, 534 aa] {ON} Anc_7.100
           YOL033W
          Length = 534

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 104/237 (43%), Gaps = 21/237 (8%)

Query: 201 VVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLE 260
           V TRF P P+G LHIG  + A+ N   A   +G+ ++R +DT+ ++     ++ I + L+
Sbjct: 41  VRTRFAPSPTGMLHIGSLRTALYNYLLAKNTRGQFLLRLEDTDQNRLIQGAEENIYDSLK 100

Query: 261 LMGIKGDKITYSSD-----YFQ----EMYDLCVQ-LIKEGKAY---CDDTDVEKMRE--E 305
             GI+ D+    +D     Y Q    E+Y   V  L+K G AY   C    ++ +RE  +
Sbjct: 101 WCGIEYDEGPGVNDEKFGPYRQSERTEIYQQHVDGLLKSGHAYRCFCSKERLDGLRESAK 160

Query: 306 RMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNL 365
           R++   +   D   E   +   EE +   +      ++A   Y A +  L   V  +  +
Sbjct: 161 RLKPPTTVTYDRKCESLSQGEIEE-RLAQQIPHTIRLKAPERYPAFHDLLHGTVDIQPQV 219

Query: 366 TPHHRTKGQWKM-----YPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKAL 417
             + R      +      PTY F   I D +  +TH +R  E+     ++  + +A 
Sbjct: 220 NVNDRRYDDPILIKSDNLPTYHFANVIDDHLMKITHVIRGEEWLPSTQKHIALYRAF 276

>AEL338C Chr5 complement(12870..14471) [1602 bp, 533 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL033W
           (MSE1)
          Length = 533

 Score = 53.5 bits (127), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 51/236 (21%), Positives = 94/236 (39%), Gaps = 24/236 (10%)

Query: 203 TRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLELM 262
           TRF P P+GYLH+G  + A+ N   A    G+ ++R +DT+  +   + +  I + L+ +
Sbjct: 45  TRFAPSPTGYLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVSDAEQNIYDTLQWL 104

Query: 263 GIKGDK--------ITYSSDYFQEMYDLCV-QLIKEGKAY---CDDTDVEKMREERMEGI 310
           GI+ D+          Y       +Y     +L+  G AY   C    +E +R   M   
Sbjct: 105 GIQFDEGPGVNEVYGPYRQSDRSAIYKAHADKLLASGHAYRCFCSKERLENLRTSAMALQ 164

Query: 311 PSAKRDLSVEENLRIFTEEMKNGTEFGQKNCVRAKIDYKAANKTLRDPVIYRCNLTPHHR 370
           P    ++S +      ++E  +  +  Q      +    A  +   D +  R +L P   
Sbjct: 165 PPT--NVSYDRECANLSQEHIDH-KLDQNVPFTLRFKSPAVYEPFEDLLHGRVDLQPQTN 221

Query: 371 TKG---------QWKMYPTYDFCVPIVDSIEGVTHALRTIEYRDRNAQYDWMLKAL 417
                       +    PTY F   + D +  +TH +R  E+     ++  + +A 
Sbjct: 222 PNDIRYDDPVLMKSDGLPTYHFANVVDDHLMKITHVIRGEEWLPSTPKHISLYRAF 277

>Smik_15.132 Chr15 (229667..231274) [1608 bp, 535 aa] {ON} YOL033W
           (REAL)
          Length = 535

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 4/117 (3%)

Query: 201 VVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLE 260
           V TRF P P+G LH+G  + A+ N   A    G+ ++R +DT+  +     +  I + L 
Sbjct: 45  VRTRFAPSPTGLLHLGSLRTALYNYLLARNTNGQFLLRLEDTDQKRLVPGAEKDIYDVLN 104

Query: 261 LMGIKGDKITYSSDYFQEMYDLCVQ-LIKEGKAY---CDDTDVEKMREERMEGIPSA 313
              I+ D+        + +YD  V+ L+  G AY   C    +  +R   ME  P +
Sbjct: 105 WCKIEYDETVVRQSERKLVYDKYVKILLSSGMAYRCFCSKERLNDLRHSAMELKPPS 161

>KLTH0D02794g Chr4 complement(270516..272156) [1641 bp, 546 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 546

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 54/232 (23%), Positives = 93/232 (40%), Gaps = 43/232 (18%)

Query: 203 TRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLELM 262
           TRF P P+G LHIG  + A+ N   A +  G  ++R +DT+ ++     +  I E L   
Sbjct: 47  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGSFLLRLEDTDQNRLVPGAEKNIYESLSWC 106

Query: 263 GIKGDKIT----------YSSDYFQEMYDLCVQLIKEGKAY---CDDTDVEKMREERMEG 309
           GI  D+              SD  +       +L+  G AY   C    ++ +RE   + 
Sbjct: 107 GIHYDEGPGVNDKKNGPFRQSDRTEIYQQYTNKLLDSGHAYRCFCTKERLDGLRESAQKL 166

Query: 310 IP----SAKRDLS------VEENLR---IFTEEMKNGTEFGQ-KNCVRAKIDYKAA---- 351
            P    S  R  S      + E L     FT  +K+   +   ++ +  K+D +      
Sbjct: 167 QPPTTASYDRHCSHLSEGEIREKLDQKVPFTIRLKSPERYPPFEDLLHGKLDMQPQVNPN 226

Query: 352 NKTLRDPVIYRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEY 403
           ++   DP++ + +              PTY F   + D +  +TH +R  E+
Sbjct: 227 DRRYDDPILVKSD------------ALPTYHFANVVDDHLMDITHVVRGEEW 266

>SAKL0B09548g Chr2 (809247..810911) [1665 bp, 554 aa] {ON} similar
           to uniprot|P48525 Saccharomyces cerevisiae YOL033W MSE1
           Mitochondrial glutamyl-tRNA synthetase encoded by a
           nuclear gene
          Length = 554

 Score = 49.3 bits (116), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 61/130 (46%), Gaps = 21/130 (16%)

Query: 201 VVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLE 260
           V TRF P P+G LH+G  + A+ N   A +  G+ ++R +DT+  +     +  I + L+
Sbjct: 61  VRTRFAPSPTGLLHMGSLRTALYNYLLARSTGGQFLLRLEDTDQKRLVPGAEQNIYDSLK 120

Query: 261 LMGIKGDK---------ITYSSDYFQEMYDLCV-QLIKEGKAY---CDDTDVEKMREERM 307
             G++ D+           Y      E+Y   + QL+  G AY   C         +ER+
Sbjct: 121 WCGVEYDEGPGVNEDKFGPYRQSDRTEIYQHYIKQLLNSGHAYRCFCS--------KERL 172

Query: 308 EGIPSAKRDL 317
           +G+ S+ + L
Sbjct: 173 DGLRSSAQQL 182

>Kwal_26.7202 s26 complement(261450..263153) [1704 bp, 567 aa] {ON}
           YOL033W (MSE1) - Mitochondrial glutamyl-tRNA synthetase
           [contig 47] FULL
          Length = 567

 Score = 48.9 bits (115), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/236 (20%), Positives = 94/236 (39%), Gaps = 51/236 (21%)

Query: 203 TRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLELM 262
           TRF P P+G LHIG  + A+ N   A +  G+ ++R +DT+  +     +++I E L+  
Sbjct: 54  TRFAPSPTGLLHIGSLRTALYNYLLAKSTGGEFLLRLEDTDQKRLVPGAEESIYESLKWC 113

Query: 263 GI-----------------KGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDTDVEKMREE 305
           G+                 + D+      Y  ++ DL V      + +C    ++ +R+ 
Sbjct: 114 GLSFDEGPGVNDAEFGPFRQSDRTKIYQSYINKLLDLGVAY----RCFCPKERLDNLRDS 169

Query: 306 RMEGIP----SAKRDLSVEENLRI---------FTEEMKNGTEFGQ-KNCVRAKIDYKAA 351
             +  P    S  R  +     +I         FT  +K+  ++   ++ +   ID +  
Sbjct: 170 AQKLQPPTTVSYDRHCAHHSTEKIQEQLDQKIPFTVRLKSPQKYPPFEDLLHGSIDMQPQ 229

Query: 352 ----NKTLRDPVIYRCNLTPHHRTKGQWKMYPTYDFCVPIVDSIEGVTHALRTIEY 403
               +    DP++ + +              PTY F   + D +  +TH +R  E+
Sbjct: 230 VNPNDMRYDDPILMKSD------------GLPTYHFANVVDDHLMKITHVVRGEEW 273

>ZYRO0D05808g Chr4 complement(493474..495075) [1602 bp, 533 aa] {ON}
           similar to uniprot|P48525 Saccharomyces cerevisiae
           YOL033W MSE1 Mitochondrial glutamyl-tRNA synthetase
           encoded by a nuclear gene
          Length = 533

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 53/116 (45%), Gaps = 12/116 (10%)

Query: 201 VVTRFPPEPSGYLHIGHAKAAILNEYFAHAYKGKLIIRFDDTNPSKERMEFQDAILEDLE 260
           V TRF P P+G LH+G  + A+ N   A    G+ I+R +DT+ S+     ++ I + L 
Sbjct: 40  VRTRFAPSPTGLLHMGSLRTALYNYLLAKNTGGQFILRLEDTDQSRLVEGAEENIYDSLR 99

Query: 261 LMGIKGDK--------ITYSSDYFQEMYDLCV-QLIKEGKAY---CDDTDVEKMRE 304
              +  D+          Y      E+Y   +  L++ G AY   C    +E +RE
Sbjct: 100 WCKLHYDEGPMVGGPFGPYRQSERTEIYRSYIGTLLESGHAYRCFCPKERLEDLRE 155

>TDEL0A03660 Chr1 (652837..654486) [1650 bp, 549 aa] {ON} Anc_5.502
           YOR161C
          Length = 549

 Score = 36.6 bits (83), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 4/68 (5%)

Query: 10  APVVAYAELIASRIVNAAH---KDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYPDVF 66
           AP++A++ LIA +I N A+   +   +  FV   N  P VF+ S  + F +I   YPDV 
Sbjct: 483 APLIAFSFLIAMQISNIANETIRSGTSTFFVALGND-PEVFHASYPERFDEIFRAYPDVL 541

Query: 67  GHESSEEV 74
              S ++V
Sbjct: 542 KKLSHQDV 549

>Smik_12.469 Chr12 complement(820772..823459) [2688 bp, 895 aa] {ON}
           YLR382C (REAL)
          Length = 895

 Score = 35.8 bits (81), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 20/66 (30%), Positives = 34/66 (51%), Gaps = 3/66 (4%)

Query: 171 GIKKAVTAGKK--KEGHKANFEIDLPDAKMGEVVTRFPPEPSGYLHIGHAKAAILNEYFA 228
            +KK +  GKK  ++  +   E D P      ++ +FP  PSG LHIGH +  ++++   
Sbjct: 20  AVKKLIAIGKKWKQKTIRGPIEHDTPKKGSKYILCQFP-YPSGALHIGHLRVYVISDSLN 78

Query: 229 HAYKGK 234
             YK +
Sbjct: 79  RFYKQR 84

>Skud_7.170 Chr7 (311782..312915) [1134 bp, 377 aa] {ON} YGL105W
           (REAL)
          Length = 377

 Score = 35.0 bits (79), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 7/64 (10%)

Query: 58  IISTYPDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKIS 117
           IIS YP  F  E S + A W  V +         Q+   L++L+ VL   TFI+  L  +
Sbjct: 12  IISKYPVSFSKEQSAQAAQWESVLKS-------GQIQPHLDQLNLVLRDNTFIVSTLYPT 64

Query: 118 AADI 121
           + D+
Sbjct: 65  STDV 68

>YGL105W Chr7 (307437..308567) [1131 bp, 376 aa] {ON}  ARC1Protein
           that binds tRNA and methionyl- and glutamyl-tRNA
           synthetases (Mes1p and Gus1p), delivering tRNA to them,
           stimulating catalysis, and ensuring their localization
           to the cytoplasm; also binds quadruplex nucleic acids
          Length = 376

 Score = 35.0 bits (79), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 7/64 (10%)

Query: 58  IISTYPDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKIS 117
           IIS YP  F  E S + A W  V +         Q+   L++L+ VL   TFI+  L  +
Sbjct: 12  IISKYPVSFTKEQSAQAAQWESVLKS-------GQIQPHLDQLNLVLRDNTFIVSTLYPT 64

Query: 118 AADI 121
           + D+
Sbjct: 65  STDV 68

>Smik_7.169 Chr7 (302749..303879) [1131 bp, 376 aa] {ON} YGL105W
           (REAL)
          Length = 376

 Score = 34.7 bits (78), Expect = 0.75,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 7/64 (10%)

Query: 58  IISTYPDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKIS 117
           IIS YP  F  E S + A W  V +         Q+   L++L+ VL   TFI+  L  +
Sbjct: 12  IISKYPVSFTKEQSAQAAQWESVLKS-------GQIQPHLDQLNLVLRDNTFIVSTLYPT 64

Query: 118 AADI 121
           + D+
Sbjct: 65  STDV 68

>Suva_7.162 Chr7 (302203..303339) [1137 bp, 378 aa] {ON} YGL105W
           (REAL)
          Length = 378

 Score = 34.3 bits (77), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 31/64 (48%), Gaps = 7/64 (10%)

Query: 58  IISTYPDVFGHESSEEVAHWIKVAREQLVVKNFQQLSQSLERLDAVLNLRTFILGGLKIS 117
           IIS YP  F  E S + A W  V +         Q+   L++L+ VL   TFI+  L  +
Sbjct: 12  IISKYPVSFTKEQSAQAAQWESVLKS-------GQVQPHLDQLNLVLRDNTFIVSTLYPT 64

Query: 118 AADI 121
           + D+
Sbjct: 65  STDV 68

>SAKL0G04180g Chr7 (343513..345135) [1623 bp, 540 aa] {ON} similar
           to uniprot|Q12412 Saccharomyces cerevisiae YOR161C PNS1
          Length = 540

 Score = 33.9 bits (76), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/69 (34%), Positives = 34/69 (49%), Gaps = 4/69 (5%)

Query: 9   KAPVVAYAELIA---SRIVNAAHKDAITVEFVDEKNAAPVVFNGSSDDTFAKIISTYPDV 65
            AP++A++ +IA   S IVN   +      FV   N  P +F+ S  D F +I   YPDV
Sbjct: 473 NAPLMAFSFVIALQISNIVNETIRSGTATFFVALGND-PEIFHVSYPDRFDEIFRAYPDV 531

Query: 66  FGHESSEEV 74
               S + V
Sbjct: 532 LNKLSHQNV 540

>TPHA0B02310 Chr2 (527211..529943) [2733 bp, 910 aa] {ON} Anc_4.236
           YLR382C
          Length = 910

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 37/82 (45%), Gaps = 20/82 (24%)

Query: 151 LLELNPSFGGAHEYLTKSMQGIKKAVTAGKKKEGHKANFEIDLPDAKMGEVVTRFPPEPS 210
           L+E+N  +  AHE    +M+GI       KKK                  +++ FP  PS
Sbjct: 44  LVEINKKW--AHEVTLNAMEGISNGKQMMKKKY-----------------ILSMFP-YPS 83

Query: 211 GYLHIGHAKAAILNEYFAHAYK 232
           G LH+GH +  ++++     YK
Sbjct: 84  GMLHLGHLRVYVISDVLNRFYK 105

>NCAS0H02440 Chr8 (484622..486295) [1674 bp, 557 aa] {ON} Anc_5.502
           YOR161C
          Length = 557

 Score = 33.1 bits (74), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%), Gaps = 2/68 (2%)

Query: 9   KAPVVAYAELIASRIVNAAHKD--AITVEFVDEKNAAPVVFNGSSDDTFAKIISTYPDVF 66
            AP++A++ +IA +I N A++   + T  F       P VF  S  D F ++   YP V 
Sbjct: 490 NAPLMAFSFVIALQICNIANETIRSGTATFFVALGNDPEVFQASYPDRFDEVFRNYPQVL 549

Query: 67  GHESSEEV 74
              S + V
Sbjct: 550 NKLSHQTV 557

>NDAI0C01210 Chr3 complement(241458..243131) [1674 bp, 557 aa] {ON}
           Anc_5.502 YOR161C
          Length = 557

 Score = 32.7 bits (73), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 22/67 (32%), Positives = 34/67 (50%), Gaps = 2/67 (2%)

Query: 10  APVVAYAELIASRIVNAAHKD--AITVEFVDEKNAAPVVFNGSSDDTFAKIISTYPDVFG 67
           AP++A++ +IA +I N A++   + T  F       P VF  S  D F +I   YP V  
Sbjct: 491 APLIAFSFVIALQICNIANETIRSGTATFFVALGNDPEVFQVSYPDKFDEIFRNYPQVLE 550

Query: 68  HESSEEV 74
             S ++V
Sbjct: 551 KLSHQDV 557

>TBLA0I02880 Chr9 complement(680214..682892) [2679 bp, 892 aa] {ON}
           Anc_4.236 YLR382C
          Length = 892

 Score = 33.1 bits (74), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 42/181 (23%), Positives = 76/181 (41%), Gaps = 32/181 (17%)

Query: 207 PEPSGYLHIGHAKAAILNEYFAHAYK--GKLIIR---FD-------------DTNPS--- 245
           P PSG LH+GH +  ++++  +  YK  G  +I    +D             D NPS   
Sbjct: 66  PYPSGVLHLGHLRVYVISDSLSRFYKQRGYDVIHPMGWDAFGLPAENAAIDRDCNPSTWT 125

Query: 246 -------KERMEFQDAILE-DLELMGIKGDKITYSSDYFQEMYDLCVQLIKEGKAYCDDT 297
                  KE+M+   A  + D EL     D   ++   F E+Y   +   KE +   D  
Sbjct: 126 YDNIAKMKEQMKNMLANFDWDRELTTCSKDYYKFTQMIFLELYKHGLAYHKEAEINWDPV 185

Query: 298 DVEKMREERMEGIPSAKRDLSVEENLRIFTEEMKNGTEFGQK--NCVRAKIDYKAANKTL 355
           D   +  E+++    + R  ++ E  ++  +     T+FG    N ++   D+ A  K++
Sbjct: 186 DKTVLANEQVDSTGHSWRSGALVEK-KMLKQWFLGITKFGHALMNDLKYLDDWPAKVKSM 244

Query: 356 R 356
           +
Sbjct: 245 Q 245

>ZYRO0G00990g Chr7 complement(74957..81352) [6396 bp, 2131 aa] {ON}
           similar to uniprot|P34756 Saccharomyces cerevisiae
           YFR019W FAB1 1-phosphatidylinositol-3-phosphate 5-kinase
           vacuolar membrane kinase that generates
           phosphatidylinositol (3 5)P2 which is involved in
           vacuolar sorting and homeostasis
          Length = 2131

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 29/53 (54%), Gaps = 6/53 (11%)

Query: 115 KISAADI-VCWGALRSNGMVGSI----IKNKVYVNVSRWYTLLE-LNPSFGGA 161
           K++ ADI +    L +N  +G      +K  +Y NVS+ YT L   NPSFGG 
Sbjct: 859 KLTEADIAISVDKLAANVKMGECEEFEVKTYIYGNVSKTYTFLRGCNPSFGGT 911

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,735,284
Number of extensions: 3528552
Number of successful extensions: 9849
Number of sequences better than 10.0: 75
Number of HSP's gapped: 10048
Number of HSP's successfully gapped: 75
Length of query: 706
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 589
Effective length of database: 40,065,477
Effective search space: 23598565953
Effective search space used: 23598565953
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)