Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0E09548g3.568ON59259229890.0
TDEL0D063603.568ON58557621470.0
Kpol_507.93.568ON60360319540.0
NCAS0F039703.568ON59758818810.0
CAGL0C01969g3.568ON61962818720.0
NDAI0B062803.568ON60559518700.0
SAKL0F00770g3.568ON63661318510.0
KLTH0G00704g3.568ON61560418470.0
TBLA0E002103.568ON63163218460.0
Suva_12.93.568ON65966918420.0
Smik_7.3683.568ON65966718220.0
Kwal_47.192683.568ON61661117980.0
TPHA0A060103.568ON62361817630.0
KLLA0A00715g3.568ON59157617490.0
Ecym_25983.568ON60260817400.0
KNAG0D029603.568ON65163517360.0
AFR265C3.568ON59157817290.0
KAFR0J001703.568ON60761516980.0
YFR048W (RMD8)3.568ON66224811531e-150
Skud_6.1393.568ON66125111451e-149
Smik_4.2353.209ON4312574471e-48
Suva_4.2523.209ON4302504453e-48
YDL001W (RMD1)3.209ON4302414443e-48
Skud_4.2533.209ON4302504435e-48
SAKL0C11286g3.209ON4282504425e-48
NCAS0A101203.209ON4232414409e-48
TDEL0D041303.209ON4382504382e-47
TBLA0A001703.209ON5052534414e-47
Kwal_27.110013.209ON4082414302e-46
KAFR0F025003.209ON4662584333e-46
Ecym_52933.209ON4772534324e-46
AEL004W3.209ON4752534324e-46
KLTH0G16544g3.209ON4082414275e-46
Kpol_1045.583.209ON4472414295e-46
TPHA0P005503.209ON4462414296e-46
CAGL0M10483g3.209ON4322004279e-46
ZYRO0A04400g3.209ON4582484281e-45
KNAG0K014903.209ON4052424241e-45
NDAI0A073503.209ON5222674292e-45
KLLA0E17381g3.209ON4442224155e-44
Skud_4.5455.291ON4132571972e-15
YDR282C5.291ON4142601944e-15
Suva_2.4485.291ON4172611928e-15
Ecym_47435.291ON3662581774e-13
SAKL0G10582g5.291ON3832371767e-13
KLTH0G06622g5.291ON3922501759e-13
Kwal_23.56435.291ON3742421741e-12
KLLA0C11165g5.291ON3562341694e-12
Smik_4.5315.291ON4142501687e-12
AAL122C5.291ON3661751623e-11
TPHA0D017105.291ON3862081624e-11
Kpol_1033.65.291ON4032321624e-11
ZYRO0G16478g5.291ON4012441616e-11
CAGL0H01045g5.291ON3611641552e-10
KAFR0E015305.291ON3632331553e-10
TDEL0E033605.291ON4051691543e-10
ZYRO0G19426g8.157ON159431742.4
YDR120C (TRM1)8.274ON57097699.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0E09548g
         (592 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0E09548g Chr5 (760326..762104) [1779 bp, 592 aa] {ON} simila...  1155   0.0  
TDEL0D06360 Chr4 (1142081..1143838) [1758 bp, 585 aa] {ON} Anc_3...   831   0.0  
Kpol_507.9 s507 complement(53819..55630) [1812 bp, 603 aa] {ON} ...   757   0.0  
NCAS0F03970 Chr6 (796049..797842) [1794 bp, 597 aa] {ON} Anc_3.5...   729   0.0  
CAGL0C01969g Chr3 complement(206652..208511) [1860 bp, 619 aa] {...   725   0.0  
NDAI0B06280 Chr2 (1519871..1521688) [1818 bp, 605 aa] {ON} Anc_3...   724   0.0  
SAKL0F00770g Chr6 complement(66976..68886) [1911 bp, 636 aa] {ON...   717   0.0  
KLTH0G00704g Chr7 complement(47865..49712) [1848 bp, 615 aa] {ON...   716   0.0  
TBLA0E00210 Chr5 complement(29729..31624) [1896 bp, 631 aa] {ON}...   715   0.0  
Suva_12.9 Chr12 complement(11366..13345) [1980 bp, 659 aa] {ON} ...   714   0.0  
Smik_7.368 Chr7 (606969..608948) [1980 bp, 659 aa] {ON} YFR048W ...   706   0.0  
Kwal_47.19268 s47 (1163922..1165772) [1851 bp, 616 aa] {ON} YFR0...   697   0.0  
TPHA0A06010 Chr1 (1359051..1360922) [1872 bp, 623 aa] {ON} Anc_3...   683   0.0  
KLLA0A00715g Chr1 complement(69861..71636) [1776 bp, 591 aa] {ON...   678   0.0  
Ecym_2598 Chr2 (1162883..1164691) [1809 bp, 602 aa] {ON} similar...   674   0.0  
KNAG0D02960 Chr4 (533165..535120) [1956 bp, 651 aa] {ON} Anc_3.5...   673   0.0  
AFR265C Chr6 complement(910790..912565) [1776 bp, 591 aa] {ON} S...   670   0.0  
KAFR0J00170 Chr10 complement(27714..29537) [1824 bp, 607 aa] {ON...   658   0.0  
YFR048W Chr6 (246146..248134) [1989 bp, 662 aa] {ON}  RMD8Cytoso...   448   e-150
Skud_6.139 Chr6 (241140..243125) [1986 bp, 661 aa] {ON} YFR048W ...   445   e-149
Smik_4.235 Chr4 (427186..428481) [1296 bp, 431 aa] {ON} YDL001W ...   176   1e-48
Suva_4.252 Chr4 (445183..446475) [1293 bp, 430 aa] {ON} YDL001W ...   176   3e-48
YDL001W Chr4 (447984..449276) [1293 bp, 430 aa] {ON}  RMD1Cytopl...   175   3e-48
Skud_4.253 Chr4 (439498..440790) [1293 bp, 430 aa] {ON} YDL001W ...   175   5e-48
SAKL0C11286g Chr3 complement(1012631..1013917) [1287 bp, 428 aa]...   174   5e-48
NCAS0A10120 Chr1 (2022090..2023361) [1272 bp, 423 aa] {ON} Anc_3...   174   9e-48
TDEL0D04130 Chr4 (760040..761356) [1317 bp, 438 aa] {ON} Anc_3.2...   173   2e-47
TBLA0A00170 Chr1 (16781..18298) [1518 bp, 505 aa] {ON} Anc_3.209...   174   4e-47
Kwal_27.11001 s27 complement(593288..594514) [1227 bp, 408 aa] {...   170   2e-46
KAFR0F02500 Chr6 complement(484705..486105) [1401 bp, 466 aa] {O...   171   3e-46
Ecym_5293 Chr5 (595331..596764) [1434 bp, 477 aa] {ON} similar t...   171   4e-46
AEL004W Chr5 (630125..631552) [1428 bp, 475 aa] {ON} Syntenic ho...   171   4e-46
KLTH0G16544g Chr7 complement(1435479..1436705) [1227 bp, 408 aa]...   169   5e-46
Kpol_1045.58 s1045 (139327..140670) [1344 bp, 447 aa] {ON} (1393...   169   5e-46
TPHA0P00550 Chr16 complement(110346..111686) [1341 bp, 446 aa] {...   169   6e-46
CAGL0M10483g Chr13 complement(1049771..1051069) [1299 bp, 432 aa...   169   9e-46
ZYRO0A04400g Chr1 (359271..360647) [1377 bp, 458 aa] {ON} simila...   169   1e-45
KNAG0K01490 Chr11 (310336..311553) [1218 bp, 405 aa] {ON} Anc_3....   167   1e-45
NDAI0A07350 Chr1 complement(1671549..1673117) [1569 bp, 522 aa] ...   169   2e-45
KLLA0E17381g Chr5 complement(1540387..1541721) [1335 bp, 444 aa]...   164   5e-44
Skud_4.545 Chr4 complement(966078..967319) [1242 bp, 413 aa] {ON...    80   2e-15
YDR282C Chr4 complement(1023511..1024755) [1245 bp, 414 aa] {ON}...    79   4e-15
Suva_2.448 Chr2 complement(788042..789295) [1254 bp, 417 aa] {ON...    79   8e-15
Ecym_4743 Chr4 complement(1450271..1451371) [1101 bp, 366 aa] {O...    73   4e-13
SAKL0G10582g Chr7 (900403..901554) [1152 bp, 383 aa] {ON} simila...    72   7e-13
KLTH0G06622g Chr7 (527870..529048) [1179 bp, 392 aa] {ON} simila...    72   9e-13
Kwal_23.5643 s23 complement(1249364..1250488) [1125 bp, 374 aa] ...    72   1e-12
KLLA0C11165g Chr3 complement(957421..958491) [1071 bp, 356 aa] {...    70   4e-12
Smik_4.531 Chr4 complement(955033..956277) [1245 bp, 414 aa] {ON...    69   7e-12
AAL122C Chr1 complement(132431..133531) [1101 bp, 366 aa] {ON} S...    67   3e-11
TPHA0D01710 Chr4 complement(356399..357559) [1161 bp, 386 aa] {O...    67   4e-11
Kpol_1033.6 s1033 complement(11719..12930) [1212 bp, 403 aa] {ON...    67   4e-11
ZYRO0G16478g Chr7 complement(1349497..1350702) [1206 bp, 401 aa]...    67   6e-11
CAGL0H01045g Chr8 complement(98818..99903) [1086 bp, 361 aa] {ON...    64   2e-10
KAFR0E01530 Chr5 complement(309332..310423) [1092 bp, 363 aa] {O...    64   3e-10
TDEL0E03360 Chr5 (635665..636882) [1218 bp, 405 aa] {ON} Anc_5.2...    64   3e-10
ZYRO0G19426g Chr7 complement(1614527..1619311) [4785 bp, 1594 aa...    33   2.4  
YDR120C Chr4 complement(691549..693261) [1713 bp, 570 aa] {ON}  ...    31   9.7  

>ZYRO0E09548g Chr5 (760326..762104) [1779 bp, 592 aa] {ON} similar
           to uniprot|P43620 Saccharomyces cerevisiae YFR048W RMD8
           Cytosolic protein required for sporulation
          Length = 592

 Score = 1155 bits (2989), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 566/592 (95%), Positives = 566/592 (95%)

Query: 1   MAYKPTSRRKPGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSREDHVADR 60
           MAYKPTSRRKPGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSREDHVADR
Sbjct: 1   MAYKPTSRRKPGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSREDHVADR 60

Query: 61  NRLAPYPSNGSKSSSVRRRPSGRFSDISIDNILSDASDVPXXXXXXXXXXXXLDRFFPSG 120
           NRLAPYPSNGSKSSSVRRRPSGRFSDISIDNILSDASDVP            LDRFFPSG
Sbjct: 61  NRLAPYPSNGSKSSSVRRRPSGRFSDISIDNILSDASDVPSGRREERQSSSSLDRFFPSG 120

Query: 121 PLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAASLNATGKRSQG 180
           PLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAASLNATGKRSQG
Sbjct: 121 PLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAASLNATGKRSQG 180

Query: 181 RRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVYDECLYVAYTLPLLLGKDGFRVR 240
           RRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVYDECLYVAYTLPLLLGKDGFRVR
Sbjct: 181 RRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVYDECLYVAYTLPLLLGKDGFRVR 240

Query: 241 SNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNNFELDSNGNYDADITPDH 300
           SNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNNFELDSNGNYDADITPDH
Sbjct: 241 SNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNNFELDSNGNYDADITPDH 300

Query: 301 LPNAMGNQDTFNPSEPQFFAXXXXXXXXXXXXXXNFNFDSSSKNDDVGNDSDQHAEIFIF 360
           LPNAMGNQDTFNPSEPQFFA              NFNFDSSSKNDDVGNDSDQHAEIFIF
Sbjct: 301 LPNAMGNQDTFNPSEPQFFAEETPVEQERRERRENFNFDSSSKNDDVGNDSDQHAEIFIF 360

Query: 361 RYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHFDYDKDIERPRIFN 420
           RYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHFDYDKDIERPRIFN
Sbjct: 361 RYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHFDYDKDIERPRIFN 420

Query: 421 DIVTLRSGDHIIELTLSHAIAQSSKLSRFESRITPILTSATKLPKRLALFGTLGMKREQL 480
           DIVTLRSGDHIIELTLSHAIAQSSKLSRFESRITPILTSATKLPKRLALFGTLGMKREQL
Sbjct: 421 DIVTLRSGDHIIELTLSHAIAQSSKLSRFESRITPILTSATKLPKRLALFGTLGMKREQL 480

Query: 481 LKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKV 540
           LKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKV
Sbjct: 481 LKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKV 540

Query: 541 YLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRYVMIRNRLSG 592
           YLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRYVMIRNRLSG
Sbjct: 541 YLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRYVMIRNRLSG 592

>TDEL0D06360 Chr4 (1142081..1143838) [1758 bp, 585 aa] {ON}
           Anc_3.568 YFR048W
          Length = 585

 Score =  831 bits (2147), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/576 (71%), Positives = 470/576 (81%), Gaps = 13/576 (2%)

Query: 18  MSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSREDHVADRNRLAPYPSNGSKSSSV- 76
           + +++RSPSILVTDSRS+ KRMSAPFAGHAAGV+SR++       L    S+GS  + V 
Sbjct: 16  LPLARRSPSILVTDSRSSRKRMSAPFAGHAAGVRSRDE-------LPNMKSSGSFGNKVS 68

Query: 77  -RRRPSGRFSDISIDNILSDASDVPXXXXXXXXXXXXLDRFFPSGPLRPLSYTKMLNPLP 135
            +RR SGRFS+ISIDNILS+ SDVP             DR + S   R L+Y+KM+NPLP
Sbjct: 69  NKRRTSGRFSEISIDNILSEMSDVPSGRREERLSSSSADRHYASDKPRSLNYSKMINPLP 128

Query: 136 SRTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAASLNATGKRSQ-GRRGRKLSRITAYNV 194
           +RTSKTSQKLVLIPEE  GRESS   +  KR+  S+   G+ ++  ++  KL+RITAYNV
Sbjct: 129 ARTSKTSQKLVLIPEEADGRESSANAFSRKRSTTSMKGYGESARHAKKDEKLARITAYNV 188

Query: 195 AEGFNLEYMADFLKATHEVSPRVYDECLYVAYTLPLLLGKDGFRVRSNVSKKVLGGKTLI 254
           AEGFNL+ M+ FLK THEVSPR+YDECLYVAYTLPLLLGKDGFRV+SN+SKKV+GGKTLI
Sbjct: 189 AEGFNLKLMSKFLKCTHEVSPRMYDECLYVAYTLPLLLGKDGFRVKSNISKKVVGGKTLI 248

Query: 255 DKLIDNSEQRDHHYEYYSGVETIEDVDNNFELDSNG---NYDADITPDHLPNAMGNQDTF 311
           +KLID SEQRDHHYEYYSGVET+ED  N FELD        D +I P+HLPN  GN D+F
Sbjct: 249 EKLIDTSEQRDHHYEYYSGVETLEDARNAFELDPTAVLVENDPNIIPNHLPNPPGNLDSF 308

Query: 312 NPSEPQFFAXXXXXXXXXXXXXXNFNFDSSSKNDDVGNDSDQHAEIFIFRYGVIVFWNFT 371
           +PSEPQFFA               FN  +++K     +  DQHAEIFIFRYGVIVFWNFT
Sbjct: 309 DPSEPQFFAEETPTEQKLRERREQFNMPANNKRHGTTSSGDQHAEIFIFRYGVIVFWNFT 368

Query: 372 EIQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSGDHI 431
           EIQEKNILGDIAFAD+KNLVIRPLDE DIEREQFHFDYDKD ERPRIFNDIVTLRSGDHI
Sbjct: 369 EIQEKNILGDIAFADYKNLVIRPLDEQDIEREQFHFDYDKDTERPRIFNDIVTLRSGDHI 428

Query: 432 IELTLSHAIAQSSKLSRFESRITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLR 491
           IELTLSHAIAQSSKLSRFESRI+PILT+ TKLPKRLAL+GTLGMKREQLLKKSGKLFKLR
Sbjct: 429 IELTLSHAIAQSSKLSRFESRISPILTAVTKLPKRLALYGTLGMKREQLLKKSGKLFKLR 488

Query: 492 VDVNLSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDS 551
           VDVNLSSS+LDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQV+NDR KV+LEFFD+CVDS
Sbjct: 489 VDVNLSSSVLDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVLNDRCKVFLEFFDICVDS 548

Query: 552 VAERNMARVTWWFIFVIVLGVLFSVAEILVRYVMIR 587
           VA+RN+ARVTWWFI  I++GV+FS++EILVRY++I+
Sbjct: 549 VADRNIARVTWWFIIAIIVGVVFSLSEILVRYIIIQ 584

>Kpol_507.9 s507 complement(53819..55630) [1812 bp, 603 aa] {ON}
           complement(53819..55630) [1812 nt, 604 aa]
          Length = 603

 Score =  757 bits (1954), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/603 (64%), Positives = 454/603 (75%), Gaps = 16/603 (2%)

Query: 1   MAYKPTSRRKPGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSRED----- 55
           M+Y  +S    G   AT SMSKRSPSILVTDSRS   R+SAPFA HAAG +SRE      
Sbjct: 1   MSYN-SSNNASGAHLATSSMSKRSPSILVTDSRSNKNRLSAPFARHAAGARSRESLSSVP 59

Query: 56  -HVADRNRLAPY-PSNGSKSSSVRRRPS---GRFSDISIDNILSDASDVPXXXXXXXXXX 110
            +    +   PY  SN ++  SV R  S   GRFSDISIDNILSD+SDVP          
Sbjct: 60  SNSIGSSSYVPYLNSNKNQVRSVNRAASPQFGRFSDISIDNILSDSSDVPSGRREERRSS 119

Query: 111 XXLDRFFPSGPLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVA-GRESSTTGYGPKRAAA 169
              DRF     LR  +Y K L+ +P RTSKTS KLVLIPE     ++     +   R+++
Sbjct: 120 SSWDRFSIYDKLRTSNYGKGLSHIPPRTSKTSHKLVLIPENSEIPKDYMPNNFLRNRSSS 179

Query: 170 SLNATGKR-SQGRRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVYDECLYVAYTL 228
             N   ++  Q  R   L RITAYNVAEGFNL+ M+ FLK+THEVSPR Y ECLYVAYTL
Sbjct: 180 YKNLQSEQFQQHDRDEILPRITAYNVAEGFNLDLMSKFLKSTHEVSPRQYAECLYVAYTL 239

Query: 229 PLLLGKDGFRVRSNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNNFELDS 288
           PLL GKDG+R++SN+SKKV+GGKTLID+LID SEQRDHHYEYYSGVE +ED +NN+EL++
Sbjct: 240 PLLPGKDGYRIKSNISKKVVGGKTLIDELIDTSEQRDHHYEYYSGVEILEDANNNYELNA 299

Query: 289 ---NGNYDADITPDHLPNAMGNQDTFNPSEPQFFAXXXXXXXXXXXXXXNFNFDSSSKND 345
              +   +  + PDHLPN   N D+F+PSEPQFFA                  +S SK  
Sbjct: 300 TTPSQEPEVTVIPDHLPNPTNNSDSFDPSEPQFFAEETPIEQKLRERKEQIKMNSDSKPM 359

Query: 346 DVGNDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIEREQF 405
            +  D DQHAEIFIF YGVIVFWNFTE QEKNILGDIAF+++KNLVIR LDE DIE EQF
Sbjct: 360 SLIRDEDQHAEIFIFHYGVIVFWNFTEQQEKNILGDIAFSEYKNLVIRALDEQDIETEQF 419

Query: 406 HFDYDKDIERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRITPILTSATKLPK 465
           HF+YDK+ ERPRIFNDI+TLRSGDHIIELTLSHAIAQSSKLSRFESR+TPIL+S TKLP+
Sbjct: 420 HFEYDKENERPRIFNDIITLRSGDHIIELTLSHAIAQSSKLSRFESRVTPILSSITKLPR 479

Query: 466 RLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMREYL 525
           RLAL+GTLG+KREQLLK+SGKLFKLRVDVNLSSS+LDTPEFFWSFEPSLHPLY+AMREYL
Sbjct: 480 RLALYGTLGLKREQLLKRSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYVAMREYL 539

Query: 526 EIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRYVM 585
           EIDQRVQV+NDR KV+LEFFD+CVDSVAERNMARVTWWFI +I++ VLFS+AEIL+RY +
Sbjct: 540 EIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFIMMIIVSVLFSLAEILIRYNI 599

Query: 586 IRN 588
           I N
Sbjct: 600 IHN 602

>NCAS0F03970 Chr6 (796049..797842) [1794 bp, 597 aa] {ON} Anc_3.568
           YFR048W
          Length = 597

 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/588 (64%), Positives = 445/588 (75%), Gaps = 23/588 (3%)

Query: 17  TMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSREDHVADRNR----LAPYPSNGSK 72
           T  MSKRSPSILVTDSRS+  RMSAPFAGHAAG  ++       NR      PY S G  
Sbjct: 15  TTPMSKRSPSILVTDSRSSKHRMSAPFAGHAAGSLNQPKPF---NRGIPHHTPYSSTGIH 71

Query: 73  SSSVRRRPSGRFSDISIDNILSDASDVPXXXXXXXXXXXXLDRF-FPSGPLRPLSYTKML 131
           S  +R++ SGRF D+SIDNIL D+SDVP             +RF F S  LR   + + +
Sbjct: 72  SQ-LRKKSSGRFGDVSIDNILLDSSDVPSGRREERLSNSSQERFPFASDRLRSSYFKRSI 130

Query: 132 NPLPSRTSKTSQKLVLIPEE--VAGRESSTTGYGPKRAAASLNATGKRSQGRRGRKLSRI 189
           NPLPSRTSKTSQKLVLIPE+  +     S+     KR A +  +  +     +  KL+RI
Sbjct: 131 NPLPSRTSKTSQKLVLIPEDEPIGAEVGSSNVLDRKRHATTPRSPERYESSYKESKLARI 190

Query: 190 TAYNVAEGFNLEYMADFLKATHEVSPRVYDECLYVAYTLPLLLGKDGFRVRSNVSKKVLG 249
           TAYNVA+GFNL+ ++ FL  THEVSPR+YDECLY+AYTLPLL GK+GFR++SN+SKK +G
Sbjct: 191 TAYNVADGFNLKLLSKFLGDTHEVSPRMYDECLYIAYTLPLLPGKEGFRIKSNISKKTVG 250

Query: 250 GKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNNFELDSNG----NYDADITPDHLPNAM 305
           G+TLIDKLID SEQRDHHYEY+SGVET+ED  NN+ELDSN       D ++ P HLP   
Sbjct: 251 GQTLIDKLIDTSEQRDHHYEYFSGVETLEDAHNNYELDSNAIPIDTTDPNLIPSHLPIPT 310

Query: 306 GNQDTFNPSEPQFFAXXXXXXXXXXXXXXNFNFDSSSKNDDVG-----NDSDQHAEIFIF 360
            N D+FNPSEPQFFA                    + KN  +         DQHAE+FIF
Sbjct: 311 TNPDSFNPSEPQFFAEESHNDQELRKGDGRLK---NQKNKSINLATTIPSEDQHAELFIF 367

Query: 361 RYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHFDYDKDIERPRIFN 420
            YGVIVFWNFTE++EKN+LGDIAF+D+KNLVIRPLDE DIE EQFHF+YDKD ERPRIFN
Sbjct: 368 HYGVIVFWNFTEMEEKNLLGDIAFSDYKNLVIRPLDEQDIETEQFHFEYDKDTERPRIFN 427

Query: 421 DIVTLRSGDHIIELTLSHAIAQSSKLSRFESRITPILTSATKLPKRLALFGTLGMKREQL 480
           DI+TLRSGDH+IELTLSHAIAQSSKLSRFESRITPIL S TKLPKRLAL+GTLG++R+QL
Sbjct: 428 DILTLRSGDHMIELTLSHAIAQSSKLSRFESRITPILASVTKLPKRLALYGTLGLQRKQL 487

Query: 481 LKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKV 540
           LK+SGKLFKLRVDVNLSSS+LD+PEFFWS EPSLHPLYIAMREYLEIDQRVQV+NDR KV
Sbjct: 488 LKRSGKLFKLRVDVNLSSSVLDSPEFFWSSEPSLHPLYIAMREYLEIDQRVQVLNDRCKV 547

Query: 541 YLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRYVMIRN 588
           +LEFFD+CVDSVAERN+ARVTWWFI VI++GV+FS+ EI VRY++I +
Sbjct: 548 FLEFFDICVDSVAERNIARVTWWFIIVIIVGVIFSLTEIFVRYIIIHS 595

>CAGL0C01969g Chr3 complement(206652..208511) [1860 bp, 619 aa] {ON}
           similar to uniprot|P43620 Saccharomyces cerevisiae
           YFR048w
          Length = 619

 Score =  725 bits (1872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/628 (60%), Positives = 449/628 (71%), Gaps = 49/628 (7%)

Query: 1   MAYKPTSRRKPGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGVK--------- 51
           M+Y+ T   K G    T +MSKRSPSILVTD+R++  R SAPFAGHAAGV+         
Sbjct: 1   MSYRDTGMDKKG----TGTMSKRSPSILVTDARTSKNRRSAPFAGHAAGVRSASSSTGSG 56

Query: 52  ---------------------SREDHVADRNRLAPYP-----SNGSKSSSVRRRPSGRFS 85
                                SR  + A   R +        SN   SS  RRR SGRFS
Sbjct: 57  SSASAERGAELMKYVNGNLRGSRGQYAATGGRSSSNHGTGDLSNRGTSSPPRRRASGRFS 116

Query: 86  DISIDNILSDASDVPXXXXXXXXXXXXLDRFFPSGPLRPLSYTKMLNPLPSRTSKTSQKL 145
           +ISIDNILSD SDVP             DR      L P    KM+N LP RTSKTSQKL
Sbjct: 117 EISIDNILSDRSDVPSGRREERGSNSSFDRSMIYDRLHPQPIRKMINTLPIRTSKTSQKL 176

Query: 146 VLIPEEVAGRESSTTGYGPKRAAASL---NATGKRSQGRRGRKLSRITAYNVAEGFNLEY 202
           VLIPE+  G    T G   +R   +    N T +  +  R  +LSRITAYN+AEGFNL+ 
Sbjct: 177 VLIPED--GSVPPTRGALERREQPTFVKRNPTERIPKSSRDHRLSRITAYNLAEGFNLKL 234

Query: 203 MADFLKATHEVSPRVYDECLYVAYTLPLLLGKDGFRVRSNVSKKVLGGKTLIDKLIDNSE 262
           ++ FLK+THEV PR+YDECLY+AYTLPLL GKDGFR++SNVSKKV+GGKTLI+KLID SE
Sbjct: 235 LSKFLKSTHEVKPRLYDECLYIAYTLPLLPGKDGFRLKSNVSKKVVGGKTLIEKLIDTSE 294

Query: 263 QRDHHYEYYSGVETIEDVDNNFELDSNGNYDADITPDHLPNAMGNQDTFNPSEPQFFAXX 322
           QRDHHYEYYSGVET+ED +NN+ELD     + +    +   A    D+F+PSEPQ+FA  
Sbjct: 295 QRDHHYEYYSGVETLEDANNNYELDPTSVDNENNNNSNNNPA----DSFDPSEPQYFAEE 350

Query: 323 XXXXXXXXXXXXNFNFDSSSKNDDVGNDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDI 382
                       + + +  SK   V  D DQHAEIF+F YGVIVFWNFTE +EKN+LGDI
Sbjct: 351 TPKEQLERERSESLHINPGSKPIAVNADEDQHAEIFVFHYGVIVFWNFTEEEEKNLLGDI 410

Query: 383 AFADFKNLVIRPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSGDHIIELTLSHAIAQ 442
           AF+D+KNLVIRPLDE DIE EQFHF+YDKD ERPRIFNDI+TLRSGDHIIELTLSHAIAQ
Sbjct: 411 AFSDYKNLVIRPLDEQDIEIEQFHFEYDKDTERPRIFNDIITLRSGDHIIELTLSHAIAQ 470

Query: 443 SSKLSRFESRITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILD 502
           SSKLSRFESRI+PILT+ T+LPKRLAL+GTLG+KREQL+KKSGKLFKLRVDVNLSSS+LD
Sbjct: 471 SSKLSRFESRISPILTTVTRLPKRLALYGTLGLKREQLIKKSGKLFKLRVDVNLSSSVLD 530

Query: 503 TPEFFWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTW 562
           TPEFFWSFEPSLHPLY+AMREYLEIDQRVQV+NDR  V+LEFFD+CVDS+AERN+ RVTW
Sbjct: 531 TPEFFWSFEPSLHPLYVAMREYLEIDQRVQVLNDRCMVFLEFFDICVDSIAERNIVRVTW 590

Query: 563 WFIFVIVLGVLFSVAEILVRYVMIRNRL 590
           WF   IV+ V+FS+ E+ +RY++I NRL
Sbjct: 591 WFFVAIVITVIFSLIEVFIRYLII-NRL 617

>NDAI0B06280 Chr2 (1519871..1521688) [1818 bp, 605 aa] {ON}
           Anc_3.568
          Length = 605

 Score =  724 bits (1870), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/595 (63%), Positives = 438/595 (73%), Gaps = 29/595 (4%)

Query: 20  MSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSREDHVADRNRLAPYPSNGSKSSSVRRR 79
           M+KRSPSILVTDSR++  R+SAPFAGHAAGV +R++H   RN+   Y +  S +    R 
Sbjct: 15  MAKRSPSILVTDSRTSKNRLSAPFAGHAAGVLNRDEHRLPRNKSYRYNATNSNAELRGRH 74

Query: 80  PSG---RFSDISIDNILSDASDVPXXXXXXXXXXXXLDRFFPSGPL-------RPLSYTK 129
           PSG   RFSD+SIDNILSD+SDVP            L+R     PL       R     K
Sbjct: 75  PSGGGGRFSDVSIDNILSDSSDVPSGRREERLSNSSLER----SPLVTDRAHSRSQYQRK 130

Query: 130 MLNPLPSRTSKTSQKLVLIPEEVAG------RESSTTGYGPKRAAASLNATGKRSQGR-R 182
            +NPLPSRTSKTSQ+LVLIPEE         R + ++G   KR         +  Q   R
Sbjct: 131 TINPLPSRTSKTSQRLVLIPEEGDNVSKDDIRGNISSGLDRKRHTPIPKYNDEYYQPEPR 190

Query: 183 GRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVYDECLYVAYTLPLLLGKDGFRVRSN 242
             KL+RITAYNVAEGFNL  ++ FL+ THEVSPR+YDECLYVAYTLPLL GKDGFR++SN
Sbjct: 191 THKLARITAYNVAEGFNLSLLSKFLQDTHEVSPRMYDECLYVAYTLPLLPGKDGFRIKSN 250

Query: 243 VSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNNFELDSNG----NYDADITP 298
           VSKK +GG TLIDKLID SEQRDHHYEY+SGVET+ED +NN+EL+       N +    P
Sbjct: 251 VSKKFVGGMTLIDKLIDTSEQRDHHYEYFSGVETLEDANNNYELNPTSPPMENVENQPIP 310

Query: 299 DHLPNAMGNQDTFNPSEPQFFAXXXXXXXXXXXXXXNFNF---DSSSKNDDVGNDSDQHA 355
            HLP    N D FNPSEPQFFA                N    + +  +  V  + DQHA
Sbjct: 311 THLPVPPTNPDAFNPSEPQFFAEETPIEQKLREQNERLNIVPTNIAMNSSQVAANGDQHA 370

Query: 356 EIFIFRYGVIVFWNFTEIQEKNILGDIAFADFK-NLVIRPLDEHDIEREQFHFDYDKDIE 414
           EIF+F YGVIVFWNFTE+QEKN+LGDI F+ ++ NLVIRPLDE DIE EQFHF YDK+ E
Sbjct: 371 EIFVFHYGVIVFWNFTEVQEKNLLGDITFSYYRRNLVIRPLDEQDIETEQFHFGYDKNTE 430

Query: 415 RPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRITPILTSATKLPKRLALFGTLG 474
           RPRIFNDIVTLRSGDH+IELTLSHAIAQSSKLSRFESRI+P+LTS TKLPKRLAL+GTLG
Sbjct: 431 RPRIFNDIVTLRSGDHMIELTLSHAIAQSSKLSRFESRISPLLTSITKLPKRLALYGTLG 490

Query: 475 MKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVI 534
           +KR QLLKKSGKLFKLRVDVNLSSSILD+PEFFWS EPSL PLYIAMREYLEIDQRVQV+
Sbjct: 491 LKRSQLLKKSGKLFKLRVDVNLSSSILDSPEFFWSTEPSLSPLYIAMREYLEIDQRVQVL 550

Query: 535 NDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRYVMIRNR 589
           NDR  V+LEFFD+CVDSVAE+N+AR TWWF+  I++G+ FS++EI VRY++I NR
Sbjct: 551 NDRCIVFLEFFDICVDSVAEKNIARFTWWFVIAIIVGLFFSLSEIFVRYIIIHNR 605

>SAKL0F00770g Chr6 complement(66976..68886) [1911 bp, 636 aa] {ON}
           similar to uniprot|P43620 Saccharomyces cerevisiae
           YFR048W RMD8 Cytosolic protein required for sporulation
          Length = 636

 Score =  717 bits (1851), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/613 (60%), Positives = 439/613 (71%), Gaps = 47/613 (7%)

Query: 20  MSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSREDHVADRNRLAPYPS----NGSKSSS 75
           +S+RSPSILVTDSRS+  RMSAPFAGHAAG+K       +  + + Y      N   S S
Sbjct: 18  LSRRSPSILVTDSRSSKNRMSAPFAGHAAGLKGGRSDSGNGGQGSSYARGSTPNAKDSRS 77

Query: 76  VRR----------------------RPSGRFSDISIDNILSDASDVPXXXXXXXXXXXXL 113
            RR                      +  G+FSDIS+DNILSD SDVP             
Sbjct: 78  TRRLSFSISGDHSFSQQQALSKRSKKQHGKFSDISLDNILSDMSDVPSGRREERLSLPSY 137

Query: 114 DRFFPSGPLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAASLNA 173
           +     G  R   +TKM+NPLP RTSKTS+KLVLIP+E   +         + ++++ + 
Sbjct: 138 EHLSAHGRPRVRQHTKMINPLPPRTSKTSEKLVLIPDEQEKQNFLLQNDKRRSSSSARSY 197

Query: 174 TGKRSQGRRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVYDECLYVAYTLPLLLG 233
             K S+  R R LSRITAYNVA+G +L+ ++ FL+ TH+VSPR+YDECLYV Y LPLL G
Sbjct: 198 GEKMSKEHRDRILSRITAYNVADGLSLKLVSQFLRETHDVSPRLYDECLYVPYCLPLLPG 257

Query: 234 KDGFRVRSNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNNFELDSNGNYD 293
           KDGFR++SN+SKK +GGKTLID+LID SEQRDHHYEYYSGVET+ED+ NN+E+D  G  D
Sbjct: 258 KDGFRIKSNISKKTVGGKTLIDRLIDTSEQRDHHYEYYSGVETMEDMHNNYEIDEGGAND 317

Query: 294 AD-----ITPDHLPNAMGNQDTFNPSEPQFFAXXXXXXXXXXXXXXNFNFDSS------- 341
           AD       PDHLPN   +  +F+PSEPQ+FA              +    S+       
Sbjct: 318 ADRVDSTSVPDHLPNPSTSTASFDPSEPQYFAEETPLEQERREREEHLQIISTNSSTAPS 377

Query: 342 -------SKNDDVGNDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRP 394
                  +K+ D+     QHAEIFIF YGVIVFWNFTEIQEKNILGDIAFAD+K+LVIRP
Sbjct: 378 GKQPTKDTKSRDLSKQ--QHAEIFIFGYGVIVFWNFTEIQEKNILGDIAFADYKSLVIRP 435

Query: 395 LDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRIT 454
           LDE DIE EQFHF+YD D ERPRIFNDI+TLRSGDHII+LTLSHAIAQS+KLSRFESRI+
Sbjct: 436 LDEQDIETEQFHFEYDMDTERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFESRIS 495

Query: 455 PILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSL 514
           PIL + +KLPKRLAL GTLG+KREQLLKKSGKLFKLRVDVNLSSSILDTP+FFWS EPSL
Sbjct: 496 PILGTVSKLPKRLALHGTLGLKREQLLKKSGKLFKLRVDVNLSSSILDTPDFFWSLEPSL 555

Query: 515 HPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLF 574
           HPLY+AMREYLEIDQRVQV+NDR KV+LEFFD+CVDSVAERNMAR+TWWFI VI + VL 
Sbjct: 556 HPLYLAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLV 615

Query: 575 SVAEILVRYVMIR 587
           S+AEILVRY +I+
Sbjct: 616 SIAEILVRYFIIK 628

>KLTH0G00704g Chr7 complement(47865..49712) [1848 bp, 615 aa] {ON}
           similar to uniprot|P43620 Saccharomyces cerevisiae
           YFR048W RMD8 Cytosolic protein required for sporulation
          Length = 615

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 369/604 (61%), Positives = 441/604 (73%), Gaps = 32/604 (5%)

Query: 11  PGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGVK----SREDH-------VAD 59
           PG++    SMS+RSPSILVTD+RS+ KR+ APFAGHAAG++    +RE          + 
Sbjct: 11  PGRR---TSMSRRSPSILVTDARSSKKRIGAPFAGHAAGLRGGRAAREKSDTYQGFSASS 67

Query: 60  RNRLAPYPSNGSKSSSVRR-----RPSGRFSDISIDNILSDASDVPXXXXXXXXXXXXLD 114
           R  +    ++GS    +RR     R  G+FSDISIDNILSD SDVP             +
Sbjct: 68  RGSMRGNSASGSDLGPMRRSRAKLRQQGKFSDISIDNILSDVSDVPSGRREERLSISSHE 127

Query: 115 RFFPSGPLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAASLNAT 174
               +    P  YTK++NPLP RTSKTS+KLVLIPE+   + ++      +R     N  
Sbjct: 128 MAPFAHHSSPGQYTKLINPLPPRTSKTSKKLVLIPEDSDRKNNALQM--ERRRPLKYNRH 185

Query: 175 GKRSQGRRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVYDECLYVAYTLPLLLGK 234
               Q     ++SRITAYNVAEGF +   +DFL+ TH+VSPR+YDECLYV Y LPLL GK
Sbjct: 186 DPDGQENYDEEMSRITAYNVAEGFEMSSTSDFLRYTHDVSPRLYDECLYVPYCLPLLPGK 245

Query: 235 DGFRVRSNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNNFELDSNGNYDA 294
           DGFR++SNVSKK +GGKTLID+LID SEQRDHHYEYYSGVET+ED++NNFEL      D 
Sbjct: 246 DGFRIKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNFELSDTAGKDN 305

Query: 295 D-----ITPDHLPN-AMGNQDTFNPSEPQFFAXXXXXXXXXXXXXXNFN-----FDSSSK 343
           +      TPDHLPN +  N  +F+PSEPQFFA                N     +  S  
Sbjct: 306 ERNDSLPTPDHLPNNSSNNTASFDPSEPQFFAEEGRDTDQSKNISAVGNRSQNPYMESQS 365

Query: 344 NDDVGNDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIERE 403
            ++ G+   QHAEIFIF YGV+VFWNFTEIQEKNILGDIAFA+  N++IRPLDE DIE E
Sbjct: 366 LENYGSSKQQHAEIFIFSYGVVVFWNFTEIQEKNILGDIAFAEHDNMIIRPLDEQDIETE 425

Query: 404 QFHFDYDKDIERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRITPILTSATKL 463
           QFHF+YD ++ERPRIFNDIVTLRSGDHII+LTLSH+IAQS+KLSRFESRI+PIL + +KL
Sbjct: 426 QFHFEYDMNVERPRIFNDIVTLRSGDHIIKLTLSHSIAQSTKLSRFESRISPILGTVSKL 485

Query: 464 PKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMRE 523
           PKRLAL+GTLG+KREQLLKKSGKLFKLRVDVNLSSS+LDTPEFFWSFEPSLHPLY+AMRE
Sbjct: 486 PKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYLAMRE 545

Query: 524 YLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRY 583
           YLEIDQRVQV+NDR KV+LEFFD+CVDSVAERNMAR+TWWFI VI + VL S+ EI+VR 
Sbjct: 546 YLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSICEIIVRS 605

Query: 584 VMIR 587
            +IR
Sbjct: 606 FIIR 609

>TBLA0E00210 Chr5 complement(29729..31624) [1896 bp, 631 aa] {ON}
           Anc_3.568 YFR048W
          Length = 631

 Score =  715 bits (1846), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/632 (59%), Positives = 445/632 (70%), Gaps = 56/632 (8%)

Query: 4   KPTSRRKPGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSREDHVADRNRL 63
           KP+ + +  +Q     +SKRSPSILVTD RS   R SAPFAGHAA   S  + V  R  L
Sbjct: 5   KPSKKTEKIEQKK--PLSKRSPSILVTDYRSNRTRKSAPFAGHAADSNSNLEQV--RKNL 60

Query: 64  APYPSNGSKSS---------------------------------SVRRRPSGRFSDISID 90
           + Y S G KS+                                   RR   GRFSDISID
Sbjct: 61  SSY-SGGYKSTWNRNLSNNSSAANGNVFGNKPFKKSFASVNNGRKSRRGSQGRFSDISID 119

Query: 91  NILSDASDVPXXXXXXXXXXXXLDRF-FPSGPLRPLSY--TKMLNPLPSRTSKTSQKLVL 147
           NIL D S++P             +RF      LR   Y  +K + PLP RTSKTSQKLVL
Sbjct: 120 NILQDTSEIPSARREERSSGSSYERFSMFDDHLRSSYYNFSKTITPLPPRTSKTSQKLVL 179

Query: 148 IPEEVAGRESSTTGYGPKRAAASLNATGKRSQGRRGRK----LSRITAYNVAEGFNLEYM 203
           IPEE   R +S    G  R+ +SL A  +  + R G K    L R+TAY+++EG NL+ M
Sbjct: 180 IPEEPDSRSNSL---GRPRSTSSLRAYPRGDRSRYGIKAKARLPRLTAYHLSEGLNLKLM 236

Query: 204 ADFLKATHEVSPRVYDECLYVAYTLPLLLGKDGFRVRSNVSKKVLGGKTLIDKLIDNSEQ 263
           + FLK  HEVSPR+YDECLYVAYTLPLL GKDG+R++SN+SKKV+GGKTLIDK+ID SEQ
Sbjct: 237 SKFLKKYHEVSPRLYDECLYVAYTLPLLPGKDGYRIKSNISKKVIGGKTLIDKMIDASEQ 296

Query: 264 RDHHYEYYSGVETIEDVDNNFELDSN---GNYDADITPDHLPNAMGNQDTFNPSEPQFFA 320
           RDHHYEYYSGVE +ED +NN+EL +N    + D +  PDHLPN M N D FNPSEPQ+FA
Sbjct: 297 RDHHYEYYSGVEVLEDANNNYELSTNPVQADTDINNIPDHLPNTMANTDNFNPSEPQYFA 356

Query: 321 XXXXXXXXXXXXXXNFNFDSSSKND-----DVGNDSDQHAEIFIFRYGVIVFWNFTEIQE 375
                              ++S        ++     QHAEIFIFRYGVIVFWNFTE QE
Sbjct: 357 EETPSEQKLREQEEQLGLIANSTITTSSSSELITGKSQHAEIFIFRYGVIVFWNFTEAQE 416

Query: 376 KNILGDIAFADFKNLVIRPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSGDHIIELT 435
           KNILGDIAFAD+K+LVIRPLDE DIE E+FHF+YD D ERPRIFND++TLRSGDHII+LT
Sbjct: 417 KNILGDIAFADYKDLVIRPLDEQDIETEEFHFEYDADTERPRIFNDVITLRSGDHIIKLT 476

Query: 436 LSHAIAQSSKLSRFESRITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVN 495
           LSH+IAQSSKLSRFESR+ P+L S TKLPKRLAL+GTLG+ R+QLLKKSGKLFKLRVDVN
Sbjct: 477 LSHSIAQSSKLSRFESRLEPLLNSVTKLPKRLALYGTLGLTRQQLLKKSGKLFKLRVDVN 536

Query: 496 LSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAER 555
           LSSS+LDTPEFFW+FEPSLHPLY+AMREYLEID+RVQV+NDR  V LEFF++CVDSVAER
Sbjct: 537 LSSSVLDTPEFFWTFEPSLHPLYVAMREYLEIDERVQVVNDRCMVLLEFFNICVDSVAER 596

Query: 556 NMARVTWWFIFVIVLGVLFSVAEILVRYVMIR 587
           N+ARVTWWFI V++LGVLFS+ EIL+RY++I+
Sbjct: 597 NIARVTWWFIIVLILGVLFSLTEILIRYLIIQ 628

>Suva_12.9 Chr12 complement(11366..13345) [1980 bp, 659 aa] {ON}
           YFR048W (REAL)
          Length = 659

 Score =  714 bits (1842), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/669 (57%), Positives = 449/669 (67%), Gaps = 99/669 (14%)

Query: 1   MAYKPTSRRKPGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGV-KSREDHVAD 59
           M+YK  ++  PG+      M KRSPSILVTD+RS+  R+SAPFAGHAAG  KS E+   +
Sbjct: 1   MSYK-ANQPSPGE------MPKRSPSILVTDARSSRNRISAPFAGHAAGSRKSMENKSVE 53

Query: 60  RNRLAPYPSNGSKSSSV----------RRRPSGRFSDISIDNILSDASDVPXXXXXXXXX 109
           R       S G +SS+           RRR SGRFSDISIDNILSD S++P         
Sbjct: 54  R-------SQGIRSSNAGPSPMMPAHPRRRSSGRFSDISIDNILSDNSEIPSARREERLS 106

Query: 110 XXXLDRFFPSGPLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYG------ 163
               DR      L   S  KM+NPLP RTSKTSQKLVLIPEE    +     +       
Sbjct: 107 SSSSDRPRYYERLN--SRRKMINPLPPRTSKTSQKLVLIPEEDDLNQFRNMPHNALDRQR 164

Query: 164 PKRAAASLNATGKRSQGRRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVYDECLY 223
           PK  +   ++  +  +  R + ++RITAYNVA+GFNL  +  FL+ THEVSPR+YDECLY
Sbjct: 165 PKVGSTKSSSHDRMPRHLREKPMARITAYNVADGFNLNLLYRFLEDTHEVSPRLYDECLY 224

Query: 224 VAYTLPLLLGKDGFRVRSNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNN 283
           VAYTLPLL GK GFR++SN+SKK +GGKTLID LID SEQRDHHYEYYSGVET+ED +NN
Sbjct: 225 VAYTLPLLPGKGGFRIKSNISKKTVGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNN 284

Query: 284 FELDSNG-----NYDADITPDHLPNAMGNQDTFNPSEPQFFAXXXXXXXXXXXXXXNFNF 338
           +EL+++G     + D    PDHLPN +G QD+FNP EPQFFA                N 
Sbjct: 285 YELETSGGNNSTSQDTVTVPDHLPNPVGQQDSFNPMEPQFFAEETPLEQEKRERIERMNM 344

Query: 339 DSSSKND--------DVGNDSDQHAEIFI------------------------------- 359
               +ND         + +D D  A  ++                               
Sbjct: 345 LKKEENDTDDKGSGNTINDDDDNEAANYVAASTDQYRTPPSSASSAYTPSPPSSARRDSN 404

Query: 360 ----------------------FRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDE 397
                                 F YGVIVFWNFTEIQEKNILGDI FAD+KNL+IRPLDE
Sbjct: 405 RGYEMQKDNEHEGNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDE 464

Query: 398 HDIEREQFHFDYDKDIERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRITPIL 457
            DIE EQFHF+YD D ERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRI+PIL
Sbjct: 465 QDIETEQFHFEYDSDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPIL 524

Query: 458 TSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPL 517
            S TKLPKRLAL+GTLG+KREQLLKKSGKLFKLRVDVNLSS+ILDTPEFFWSFEPSLHPL
Sbjct: 525 ISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPL 584

Query: 518 YIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVA 577
           Y+AMREYLEIDQRVQV+NDR KV+LEFFD+CVDSVAERNMARVTWWFI VI+ GV+FS+A
Sbjct: 585 YVAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLA 644

Query: 578 EILVRYVMI 586
           EI VRY++I
Sbjct: 645 EIFVRYIII 653

>Smik_7.368 Chr7 (606969..608948) [1980 bp, 659 aa] {ON} YFR048W
           (REAL)
          Length = 659

 Score =  706 bits (1822), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/667 (57%), Positives = 451/667 (67%), Gaps = 85/667 (12%)

Query: 1   MAYKPTSRRKPGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGV-KSREDHVAD 59
           M+YK  ++  PG+      M KRSPSILVTD+R++  RMSAPFAGHAAG  KS E+    
Sbjct: 1   MSYK-ANQPSPGE------MPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKSMENKNLV 53

Query: 60  RNRLAPYPSNGSKS----SSVRRRPSGRFSDISIDNILSDASDVPXXXXXXXXXXXXLDR 115
           R++     + GS S    +  RRR SGRFSDISIDNILSD SD+P             DR
Sbjct: 54  RSQGVRSSNIGSSSLQNPTHPRRRSSGRFSDISIDNILSDNSDIPSARREERLSSSSNDR 113

Query: 116 FFPSGPLRPLSYTKMLNPLPSRTSKTSQKLVLIPEE--VAGRESSTTG----YGPKRAAA 169
             P    R  S  KM+NPLP RTSKTSQKLVLIPEE  ++  ++  T       P+  + 
Sbjct: 114 --PRNYERLSSRRKMINPLPPRTSKTSQKLVLIPEEDDLSHFQTMPTNALDRQRPRVGSM 171

Query: 170 SLNATGKRSQGRRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVYDECLYVAYTLP 229
             N+  +  +  R + ++RITAYNVA+GFNL  +  FL  THEVSPR+YDECLYVAYTLP
Sbjct: 172 KPNSFDRLPRHSRDKSMARITAYNVADGFNLNQLYKFLHETHEVSPRLYDECLYVAYTLP 231

Query: 230 LLLGKDGFRVRSNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNNFELDSN 289
           LL GK GFR++SN+SKK +GGKTLID LID SEQRDHHYEYYSGVET+ED +NN+EL++N
Sbjct: 232 LLPGKGGFRIKSNISKKTVGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNNYELEAN 291

Query: 290 G-----NYDADITPDHLPNAMGNQDTFNPSEPQFFAXXXXXXXXXXXXXXNFNF------ 338
           G     N D  I PDHLPN +G QD+FNP EPQFFA                N       
Sbjct: 292 GNNNSTNQDTTIVPDHLPNPVGQQDSFNPMEPQFFAEETPLEIEERERTERINMLKKEEK 351

Query: 339 ----DSSSKNDD------VGNDSDQHAEIFIF---------------------------- 360
                +  KND+      V +  D HA    F                            
Sbjct: 352 DIDGSNGEKNDESEPVSYVNDGKDHHAYSACFSPPASSASTQSALSSSRDDFNRVYEVHS 411

Query: 361 --------RYGVIVFWNF--------TEIQEKNILGDIAFADFKNLVIRPLDEHDIEREQ 404
                   R+  I  +++        TEIQEKNILGDI FA +K+L+IRPLDE DIE EQ
Sbjct: 412 DNGHDGNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFAGYKSLMIRPLDEQDIETEQ 471

Query: 405 FHFDYDKDIERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRITPILTSATKLP 464
           FHF+YD+D ERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRI+PIL S TKLP
Sbjct: 472 FHFEYDRDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKLP 531

Query: 465 KRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMREY 524
           KRLAL+GTLG+KREQLLKKSGKLFKLRVDVNLSS+ILDTPEFFWSFEPSLHPLY+AMREY
Sbjct: 532 KRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMREY 591

Query: 525 LEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRYV 584
           LEIDQRVQV+NDR KV+LEFFD+CVDSVAERNMARVTWWFI VI+ GV+FS+ EI VRYV
Sbjct: 592 LEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRYV 651

Query: 585 MIRNRLS 591
           +I   +S
Sbjct: 652 IIHRHIS 658

>Kwal_47.19268 s47 (1163922..1165772) [1851 bp, 616 aa] {ON} YFR048W
           - Hypothetical ORF [contig 344] FULL
          Length = 616

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/611 (60%), Positives = 438/611 (71%), Gaps = 45/611 (7%)

Query: 11  PGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGVK----SREDHVADRNRLAPY 66
           PG++     MS+RSPSILVTD+RS   R  APFAGHAAG++    S+E   A   R A  
Sbjct: 11  PGRRTV---MSRRSPSILVTDARSNRNRNGAPFAGHAAGLQGGRSSKEGKDALSQRTAHV 67

Query: 67  PSNGS---------------KSSSVRRRPSGRFSDISIDNILSDASDVPXXXXXX----X 107
                               + S  + R  G+FSDIS+DNILSD SDVP           
Sbjct: 68  SRTSMRRSSSSGSSSDLMPLRRSKAKLRQQGKFSDISVDNILSDISDVPSGRREERLSTS 127

Query: 108 XXXXXLDRFFPSGPLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYGPKRA 167
                  RF      R   YTK++NPLPSRTSKTS+KLVLIPEE+  +         +R 
Sbjct: 128 SQEWSSSRFG-----RSAQYTKLINPLPSRTSKTSKKLVLIPEELDRKNGFVQM---ERR 179

Query: 168 AASLNATGKRSQGRRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVYDECLYVAYT 227
               N     ++     +LSRITAYNVAEGF+L+ ++ FL+ TH+VSPR+YDECLYV Y 
Sbjct: 180 WPRKNKNDFENRENPSEELSRITAYNVAEGFDLDLVSKFLRNTHDVSPRLYDECLYVPYC 239

Query: 228 LPLLLGKDGFRVRSNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNNFELD 287
           LPLL GKDGFR++SNVSKK +GGKTLID+LID SEQRDHHYEYYSGVET+ED++NN+EL+
Sbjct: 240 LPLLPGKDGFRLKSNVSKKTIGGKTLIDRLIDKSEQRDHHYEYYSGVETVEDMNNNYELN 299

Query: 288 SNGNYDAD-----ITPDHLPNAMG-NQDTFNPSEPQFFAXXXXXXXXXXXXXXN--FNFD 339
              N D D      TPDHLP+ +  N  +F+PSEPQFFA                  +  
Sbjct: 300 EVTNKDPDRNDVVPTPDHLPSVINSNTASFDPSEPQFFAEGAWGEHPAESSNDRPPHSRT 359

Query: 340 SSSKN---DDVGNDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLD 396
           SS +N   D   +   +HAEIFIFRYGV+VFWNFTEIQEKNILGDIAFAD+ NLVIRPLD
Sbjct: 360 SSPENNSLDGYESSKQRHAEIFIFRYGVVVFWNFTEIQEKNILGDIAFADYDNLVIRPLD 419

Query: 397 EHDIEREQFHFDYDKDIERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRITPI 456
           E DIE E FHFDYD ++ERPRIFNDI+TLRSGDHII+LTLSH+IAQS+KLSRFESRI+PI
Sbjct: 420 EQDIETEHFHFDYDMEVERPRIFNDIITLRSGDHIIKLTLSHSIAQSTKLSRFESRISPI 479

Query: 457 LTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHP 516
           L + +KLPKRLAL+GTLG+KREQLLKKSGKLFKLRVDVNLSSS+LDTPEFFWSFEPSLHP
Sbjct: 480 LGTVSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHP 539

Query: 517 LYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSV 576
           LY+AMREYLEIDQR QV+NDR KV+LEFFD+CVDSVAERNMAR+TWWFI VI + VL S+
Sbjct: 540 LYLAMREYLEIDQRAQVLNDRCKVFLEFFDICVDSVAERNMARITWWFIAVIFVSVLVSI 599

Query: 577 AEILVRYVMIR 587
            EI+VR  ++R
Sbjct: 600 GEIVVRSFIVR 610

>TPHA0A06010 Chr1 (1359051..1360922) [1872 bp, 623 aa] {ON}
           Anc_3.568 YFR048W
          Length = 623

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/618 (58%), Positives = 435/618 (70%), Gaps = 41/618 (6%)

Query: 7   SRRKPGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSREDHV----ADRNR 62
           S R  G ++A+ S SKRSPSILVTDSRS   R++APFA HAAG++ R  +     AD  +
Sbjct: 12  STRYTGTRNASSSFSKRSPSILVTDSRSNRNRINAPFARHAAGLRDRNSNFVGPSADSRK 71

Query: 63  LAPYPSNG--------------SKSSSVRRRPSGRFSDISIDNILSDASDVPXXXXXXXX 108
            +   SNG              +K   V R   GRFS IS+DNILSD+SDVP        
Sbjct: 72  NS---SNGVFASPKSHQKLHMNNKHDQVLR---GRFSGISVDNILSDSSDVPSGRREERR 125

Query: 109 XXXXLDRFFPSGPLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYGPKRAA 168
                DR       +     K LN LPSRTSKTSQKLVLIPE++ G E S+     ++  
Sbjct: 126 SSSSWDRLSVYEKFKAYPNQKKLNHLPSRTSKTSQKLVLIPEDIPGSEYSSPLSNLRQKP 185

Query: 169 AS-------LNATGK------RSQGRRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSP 215
            S       +N+T        R   +    L R+TAYN+A+  NL+ ++ FLK THEVS 
Sbjct: 186 VSSPIKQSRINSTDYYDSSKIRPHNQNYDDLPRLTAYNIADALNLKSISKFLKETHEVSS 245

Query: 216 RVYDECLYVAYTLPLLLGKDGFRVRSNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVE 275
           R+Y+ECLYVAYTLPLL GKDGFR++SN+SKKV+GGKTLID+LID SEQRDHHYEYYSG+E
Sbjct: 246 RLYNECLYVAYTLPLLSGKDGFRIKSNISKKVIGGKTLIDELIDTSEQRDHHYEYYSGIE 305

Query: 276 TIEDVDNNFELDSNG---NYDADITPDHLPNAMGNQDTFNPSEPQFFAXXXXXXXXXXXX 332
             ED  NN+EL++NG     D  + PDHLP+   + D FNP +PQ+FA            
Sbjct: 306 NPEDASNNYELEANGIPAENDVTVIPDHLPSVTNSTDAFNPGDPQYFAEETPSEKKLREK 365

Query: 333 XXNFNFDSS-SKNDDVGNDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLV 391
                 +   +K   +  D DQHAEIFIF YGVIVFWNF EIQEKNILGD+AFAD KNL+
Sbjct: 366 KEEIQINQKVNKAISLLTDEDQHAEIFIFHYGVIVFWNFQEIQEKNILGDVAFADSKNLL 425

Query: 392 IRPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFES 451
            RPL E DIE EQFHF YD+  ERP IFND +TLRSGDHI++LTLSHAIAQSSKLSRFES
Sbjct: 426 TRPLSEEDIEIEQFHFAYDRHTERPSIFNDTITLRSGDHIMKLTLSHAIAQSSKLSRFES 485

Query: 452 RITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFE 511
           R+TPIL S TKLPKRLAL+GTLG+KREQLLK+SGKLFKLRVDVNLSSS+LDTPEFFWS E
Sbjct: 486 RVTPILHSITKLPKRLALYGTLGLKREQLLKRSGKLFKLRVDVNLSSSVLDTPEFFWSLE 545

Query: 512 PSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLG 571
           PSLHPLYIAMREYLEIDQRVQV+NDR  V+LEFFD+CVDSVAER++ RVTWWF+FVI++ 
Sbjct: 546 PSLHPLYIAMREYLEIDQRVQVLNDRCMVFLEFFDICVDSVAERSIVRVTWWFVFVIIIC 605

Query: 572 VLFSVAEILVRYVMIRNR 589
           V+FS+ EI +RY++I  +
Sbjct: 606 VIFSLIEIFIRYILINKK 623

>KLLA0A00715g Chr1 complement(69861..71636) [1776 bp, 591 aa] {ON}
           weakly similar to uniprot|P43620 Saccharomyces
           cerevisiae YFR048W RMD8 Cytosolic protein required for
           sporulation
          Length = 591

 Score =  678 bits (1749), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/576 (61%), Positives = 415/576 (72%), Gaps = 28/576 (4%)

Query: 27  ILVTDSRSAGKRMSAPFAGHAAGVKSREDHVADRNRLAPYPSNGSKSSSVRRRP------ 80
           ILVTD+RS   R SAPFAGHAAG+  R      R+  +      SK S VRRR       
Sbjct: 24  ILVTDARSNKNRPSAPFAGHAAGM--RNVSSVPRSAASSGGKTDSKGSRVRRRGYDMHGD 81

Query: 81  ----SGRFSDISIDNILSDASDVPXXXXXXXXXXXXLDRFFPSGPLRPLSYTKMLNPLPS 136
               S RFSD+S+DN+L D SDVP             D  FP    R    TKM+NPLP+
Sbjct: 82  KKSISSRFSDVSMDNLLLDVSDVPSGRRQERLSTSSYD-MFPRNRQRGTHITKMINPLPT 140

Query: 137 RTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAASLNA-TGKRSQGRRGRKLSRITAYNVA 195
           RTSKTSQKLVLIP+E    +S       KRA  +  A +  +++  +   L RITAYNVA
Sbjct: 141 RTSKTSQKLVLIPDE--AHDSRNINQFRKRANKTQRAKSSSKTKMDKEVDLPRITAYNVA 198

Query: 196 EGFNLEYMADFLKATHEVSPRVYDECLYVAYTLPLLLGKDGFRVRSNVSKKVLGGKTLID 255
           EGFNL   + F+K TH+V PR+YDECLYV YTLPLL GKDGFR++SN+SKK  GGK++ID
Sbjct: 199 EGFNLSLTSTFMKQTHDVLPRLYDECLYVPYTLPLLPGKDGFRIKSNISKKTQGGKSIID 258

Query: 256 KLIDNSEQRDHHYEYYSGVETIEDVDNNFELDSNG---NYDADITPDHLPNAMGNQD-TF 311
            LID SE+RDHHYEY+SGVET+EDV+NN+ELD  G   N +A+ TPDHLPN   N   +F
Sbjct: 259 YLIDTSERRDHHYEYFSGVETLEDVNNNYELDEGGVTNNLNAENTPDHLPNPPVNTSVSF 318

Query: 312 NPSEPQFFAXXXXXXXXXXXXXXNFNFDSSSKNDDVGNDSDQHAEIFIFRYGVIVFWNFT 371
           +PSEPQ+FA               FN      N        QHAEIFIF YGV+VFWNFT
Sbjct: 319 DPSEPQYFAEENNAEAELEA----FN----EINGKTSLFQQQHAEIFIFSYGVVVFWNFT 370

Query: 372 EIQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSGDHI 431
           EIQEKNILGDI+F+ +KN+V++PLDE DIE E FHF+YD D ERPRIFNDIVTLRSGDH+
Sbjct: 371 EIQEKNILGDISFSSYKNMVLKPLDEQDIEIESFHFEYDMDTERPRIFNDIVTLRSGDHL 430

Query: 432 IELTLSHAIAQSSKLSRFESRITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLR 491
             LTLSHAIAQS KLSRFE+RI PI  S +KLPKRLAL+GTLG+KREQLLKKSGKLFKLR
Sbjct: 431 TALTLSHAIAQSVKLSRFEARIVPIFGSVSKLPKRLALYGTLGLKREQLLKKSGKLFKLR 490

Query: 492 VDVNLSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDS 551
           VDVNLSSS+LDTPEFFWSFEPSLH LY AMREYLEID RVQV+NDR KV+LEFFD+CVDS
Sbjct: 491 VDVNLSSSVLDTPEFFWSFEPSLHSLYQAMREYLEIDPRVQVLNDRCKVFLEFFDICVDS 550

Query: 552 VAERNMARVTWWFIFVIVLGVLFSVAEILVRYVMIR 587
           +AERNMAR+TWWFI +I + VL S+ EILVRY +I+
Sbjct: 551 IAERNMARITWWFITIIFISVLISIVEILVRYFIIK 586

>Ecym_2598 Chr2 (1162883..1164691) [1809 bp, 602 aa] {ON} similar to
           Ashbya gossypii AFR265C
          Length = 602

 Score =  674 bits (1740), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/608 (59%), Positives = 432/608 (71%), Gaps = 61/608 (10%)

Query: 20  MSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSREDHVADRNRLAPYPSNGSKSSSV--- 76
           MS+RSPSILVTDSRS  KR SAPFAG+A    +R D V +         +G + +S+   
Sbjct: 14  MSRRSPSILVTDSRSTKKRPSAPFAGNA---NTRRDKVGNIFPTVIENHSGKRIASLSGR 70

Query: 77  --------RRRPSGRFSDISIDNILSDASDVPXXXXXXXXXXXXLDRFFPSGPLRPLSYT 128
                   RR   G+FSD+S+D+ILS+ SDVP             D       LRPL Y 
Sbjct: 71  DYIPKHSTRRARQGKFSDVSMDSILSEMSDVPSGRREERLSSSSYDS---YDRLRPLQYN 127

Query: 129 KMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAASLNATGKRSQGRRGRKLSR 188
           KM+NPLPSRTSKTS+K VLIPEE  G +    G+  KR+  + ++ G   + R    L  
Sbjct: 128 KMINPLPSRTSKTSEKFVLIPEE--GSKKFAQGFN-KRSIYNADSDGIFKEAR-SHGLPS 183

Query: 189 ITAYNVAEGFNLEYMADFLKATHEVSPRVYDECLYVAYTLPLLLGKDGFRVRSNVSKKVL 248
           + AYNVAEGFNL+  + FLK TH+VSPR YDECLYV Y LPLL GK+GFR+RSN+SK+ +
Sbjct: 184 LMAYNVAEGFNLKLASKFLKETHDVSPRRYDECLYVPYCLPLLPGKNGFRLRSNISKQTI 243

Query: 249 GGKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNNFELDSNGN-YDAD--ITPDHLPNAM 305
           GGKTL+D+LID SEQRDHHYEYYSGVET+ED+ NNFE+    N  DA+   +PDHL + +
Sbjct: 244 GGKTLMDRLIDTSEQRDHHYEYYSGVETVEDMRNNFEISEISNSRDAEGLRSPDHL-SGI 302

Query: 306 GNQDTFNPSEPQFFAXXXXXXXXXXXXXXNFNFDSSSKNDDVGND--------------- 350
            N + FNP EPQ+FA                N DSSS+   +GN                
Sbjct: 303 SNSEAFNPGEPQYFAEEMSMEA---------NSDSSSEL-ALGNKIFKSKPADQHHQQQQ 352

Query: 351 -----------SDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHD 399
                        QHAEIFIF YGV+VFWNFTEIQEKNILGDIAF+D KN+VIRPLDE D
Sbjct: 353 QQQQQQQQQQQQQQHAEIFIFNYGVVVFWNFTEIQEKNILGDIAFSDMKNMVIRPLDEQD 412

Query: 400 IEREQFHFDYDKDIERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRITPILTS 459
           IE EQFHF+YD + ERPRIFNDI+TLRSGDHII+LTLSHAIAQS+KLSRFE RI+PIL +
Sbjct: 413 IEIEQFHFEYDMETERPRIFNDIITLRSGDHIIKLTLSHAIAQSTKLSRFEKRISPILGT 472

Query: 460 ATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYI 519
            +KLPKRLAL+GTLG+KREQLLKKSGKLFKLRVDVNLSSS+LDTPEFFWSFEPSLHPLY 
Sbjct: 473 VSKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYT 532

Query: 520 AMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEI 579
           AMREYLEID RVQV+N+R KV+LEFFD+CV+S+AER+MAR+TWW + VI L VL S+AEI
Sbjct: 533 AMREYLEIDTRVQVLNERCKVFLEFFDICVNSIAERDMARITWWLVTVIFLSVLVSIAEI 592

Query: 580 LVRYVMIR 587
           LVRY +IR
Sbjct: 593 LVRYFIIR 600

>KNAG0D02960 Chr4 (533165..535120) [1956 bp, 651 aa] {ON} Anc_3.568
           YFR048W
          Length = 651

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/635 (57%), Positives = 433/635 (68%), Gaps = 65/635 (10%)

Query: 20  MSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSREDHVADRNRL---------------- 63
           ++KRSPSILVTDSRS+  R SAPFAGHAA       H + + +                 
Sbjct: 16  LAKRSPSILVTDSRSSQSRSSAPFAGHAASGSMANYHKSKQLQQQKSVRGGGVGSGSSAG 75

Query: 64  -----APYPSNGSKSSS----VRRRPSGRFSDISIDNILSDASDVPXXXXXXXXXXXXLD 114
                A  PS  S +S+     R+RPSGRFS++S+DNIL + S VP             D
Sbjct: 76  NYGSGARGPSGNSLNSAPGARARKRPSGRFSNVSMDNILHNDSAVPSGRREQRGSTSSWD 135

Query: 115 RFFPSGPLRPL-SYTKMLNPLPSRTSKTSQKLVLIPEE---VAGRESSTTGYG--PKRAA 168
           RF  +  L    SY KM+NPLPSRTSK SQKLVLIPE+    A   +ST G G  P R +
Sbjct: 136 RFPVTEILHASNSYRKMINPLPSRTSKISQKLVLIPEDDTVNAENGTSTKGSGNPPLRKS 195

Query: 169 ----------------ASLNATGKRSQGRRGRKLSRITAYNVAEGFNLEYMADFLKATHE 212
                            +LN     S       LSR+TAYN+AEGF+L  +  FL+ THE
Sbjct: 196 RNIGPVLDRKRHSTRMTNLNEFDNESYRFNSGNLSRLTAYNIAEGFDLTMLHRFLQNTHE 255

Query: 213 VSPRVYDECLYVAYTLPLLLGKDGFRVRSNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYS 272
           V PR+YD+CLYV Y LPLL GKDGFR++SNVSKK +GG TLIDKLID SE+RDHHYEYYS
Sbjct: 256 VHPRLYDDCLYVPYVLPLLPGKDGFRIKSNVSKKAVGGGTLIDKLIDTSERRDHHYEYYS 315

Query: 273 GVETIEDVDNNFELDSNGNY-----DADITPDHLPNAMG--NQDTFNPSEPQFFAXXXXX 325
           GVET+ED +NN+EL++ G +     D  + PDHLP      N D F+P EPQFFA     
Sbjct: 316 GVETLEDANNNYELEATGGHTNEMSDVSVIPDHLPQPTAGINPDAFDPREPQFFAEETPV 375

Query: 326 XXXXXXXXXNFNFDSSSKND-----------DVGNDSDQHAEIFIFRYGVIVFWNFTEIQ 374
                      +  S    +            V  DS  HAE+FIF YGVIVFWNFTE Q
Sbjct: 376 EQELRQREEMKSITSDEGTNKRSSRERNLERKVSEDSTDHAELFIFHYGVIVFWNFTEEQ 435

Query: 375 EKNILGDIAFADFKNLVIRPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSGDHIIEL 434
           EKN+LGDI FAD K+L+IRP+DE DIE E+FHF+YD D ERPRIFNDIVTLRSGDHI+++
Sbjct: 436 EKNLLGDITFADDKDLMIRPIDEQDIETEEFHFEYDMDTERPRIFNDIVTLRSGDHIVKM 495

Query: 435 TLSHAIAQSSKLSRFESRITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDV 494
           TLS+AIAQSSKLSRFESRITP+L++  KLPKRLAL GTLG++REQLLKKSGKLFKLRVDV
Sbjct: 496 TLSYAIAQSSKLSRFESRITPLLSAVMKLPKRLALHGTLGLRREQLLKKSGKLFKLRVDV 555

Query: 495 NLSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAE 554
           NLSSSILDTP+FFWS EPSLHPLYIAMREYLEID+RVQV+NDR KV+LEFFD+CVDSVAE
Sbjct: 556 NLSSSILDTPDFFWSIEPSLHPLYIAMREYLEIDKRVQVVNDRCKVFLEFFDICVDSVAE 615

Query: 555 RNMARVTWWFIFVIVLGVLFSVAEILVRYVMIRNR 589
           RNMARVTWWF+ VI++GVLFS+ EI +RY +I  R
Sbjct: 616 RNMARVTWWFVVVIIIGVLFSLTEITIRYNIIHGR 650

>AFR265C Chr6 complement(910790..912565) [1776 bp, 591 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFR048W
           (RMD8)
          Length = 591

 Score =  670 bits (1729), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/578 (61%), Positives = 413/578 (71%), Gaps = 32/578 (5%)

Query: 20  MSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSRE--------DHVADRNRLAPYPSNG- 70
           MS+RSPSILVTD+RS  KR SAPFAG+A   + +         ++ A R R+ P      
Sbjct: 20  MSRRSPSILVTDARSTKKRSSAPFAGNANTRRDKTGGSMPTVIENRAGR-RMGPMGGREF 78

Query: 71  -SKSSSVRRRPSGRFSDISIDNILSDASDVPXXXXXXXXXXXXLDRFFPSGPLRPLSYTK 129
             K+ S R R  G+FS++S+DNILS+ SDVP             +        RP  Y K
Sbjct: 79  MPKAGSGRTR-QGKFSEVSMDNILSEMSDVPSGRRQERLSSSSFEY-----ERRPAHYNK 132

Query: 130 MLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAASLNATGKRSQGRRGRKLSRI 189
            + PLPSRTSKTS+K VLIP+E   R +   G+  + A+   +          G  L  I
Sbjct: 133 TIRPLPSRTSKTSEKFVLIPDENVKRFAQ--GFHKRSASRVFSELSYGEHNTAG--LPSI 188

Query: 190 TAYNVAEGFNLEYMADFLKATHEVSPRVYDECLYVAYTLPLLLGKDGFRVRSNVSKKVLG 249
           TAYNVAEGFNL   + FLK TH VS R YDECLYV Y LPLL GKDGFR+RSNVSKK++G
Sbjct: 189 TAYNVAEGFNLNLASQFLKETHNVSIRRYDECLYVPYCLPLLPGKDGFRIRSNVSKKMVG 248

Query: 250 GKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNNFELDSNGNY---DADITPDHLPNAMG 306
           GKTLID+LID SEQRDHHYEYYSGVET+ED+ NNFE++ NGN    D     DHL     
Sbjct: 249 GKTLIDRLIDTSEQRDHHYEYYSGVETVEDMHNNFEINENGNGRDPDGLRNADHLAPLSS 308

Query: 307 NQDTFNPSEPQFFAXXXXXXXXXXXXXXNFNFDSSSKNDDVGN--DSDQHAEIFIFRYGV 364
           N  +F+PSEPQFFA                  DSSS+  +     D+ QHAEIFIF YGV
Sbjct: 309 NMQSFDPSEPQFFAEELSEIGLHPIQ------DSSSEQHEREKVLDAQQHAEIFIFNYGV 362

Query: 365 IVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHFDYDKDIERPRIFNDIVT 424
           IVFWNFTE++EKNILGDIAF+  KN+V RPLDE DIE EQFHF+YD D ERPRIFNDI+T
Sbjct: 363 IVFWNFTELEEKNILGDIAFSGMKNMVTRPLDEQDIEIEQFHFEYDMDTERPRIFNDIIT 422

Query: 425 LRSGDHIIELTLSHAIAQSSKLSRFESRITPILTSATKLPKRLALFGTLGMKREQLLKKS 484
           LRSGDHII+LTLSHAIAQS+KLSRFE RITPIL + +KLPKRLAL+GTLG+KREQLLKKS
Sbjct: 423 LRSGDHIIKLTLSHAIAQSTKLSRFEKRITPILGTVSKLPKRLALYGTLGLKREQLLKKS 482

Query: 485 GKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKVYLEF 544
           GKLFKLRVDVNLSSS+LDTPEFFWSFEPSLHPLY AMREYLEID RVQV+NDR KV+LEF
Sbjct: 483 GKLFKLRVDVNLSSSVLDTPEFFWSFEPSLHPLYTAMREYLEIDPRVQVLNDRCKVFLEF 542

Query: 545 FDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVR 582
           FD+CV+S+AE++MAR+TWW + VI + VL S AEIL R
Sbjct: 543 FDICVNSIAEKDMARITWWLVIVIFISVLVSTAEILAR 580

>KAFR0J00170 Chr10 complement(27714..29537) [1824 bp, 607 aa] {ON}
           Anc_3.568 YFR048W
          Length = 607

 Score =  658 bits (1698), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/615 (58%), Positives = 440/615 (71%), Gaps = 36/615 (5%)

Query: 1   MAYKPTSRRKPGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAA-GVKSRED---- 55
           M+Y P  + + G      SM KRSPSILVTDSRS+  RMSAPFAGHAA G  S  D    
Sbjct: 1   MSYSPNRQNRNGSS-TQPSMPKRSPSILVTDSRSSKNRMSAPFAGHAAFGTNSSVDPRTG 59

Query: 56  -----HVADRNRLAPYPSNGSKSSSVRRRPSGRFSDISIDNILSDASDVPXXXXXXXXXX 110
                   D N    Y      ++ +RR+P G+FSDIS+DNIL+D S+VP          
Sbjct: 60  RPPQGAFNDGNSTKMYRPKVINNTRIRRQP-GKFSDISLDNILADNSEVPSGRREERRSN 118

Query: 111 XXLDRFFPSGPLRPLSYT---KMLNPLPSRTSKTSQKLVLIPEE--VAGRESS---TTGY 162
              DRF P G  R  + +   KM+NPLP+RTSK SQKLVLIPEE    GR+++      +
Sbjct: 119 SSWDRF-PIGNERLHASSLKKKMMNPLPTRTSKISQKLVLIPEEELQKGRKANFLKEQSH 177

Query: 163 GPKRAAASLNATGKRSQGRRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVYDECL 222
             + +  ++    K++       L R+TAYN+AEGFNL+ +++FL+ TH+VSPR+YD+CL
Sbjct: 178 TKRPSLGNIEYNFKKTVN----NLPRLTAYNIAEGFNLKVLSNFLEETHDVSPRLYDDCL 233

Query: 223 YVAYTLPLLLGKDGFRVRSNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVE----TIE 278
           YV Y LPLL G+DGFRV+SN+SK+++GGKTLID+LID SEQRDHHYE++SGVE    +  
Sbjct: 234 YVPYILPLLPGRDGFRVKSNISKRIVGGKTLIDRLIDTSEQRDHHYEFFSGVEDEVNSGP 293

Query: 279 DVDNNF--ELDSNGNYDADITP-DHLPNAMGNQDTFNPSEPQFFAXXXXXXXXXXXXXXN 335
           D  NN   +L+ N     ++ P D L     NQD F+PSEPQFFA              N
Sbjct: 294 DTRNNPHDKLNVNQVNTEELGPTDMLSINAVNQDVFDPSEPQFFAEDSATQTMDTSNVEN 353

Query: 336 FNFDSSSKNDDVGNDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAF-ADFKNLVIRP 394
            +  SS + +    + DQHAEIFIF YGVIVFWNFTE+QEKN+L DI+F  D K LV++P
Sbjct: 354 SSLTSSRQAN--LEEEDQHAEIFIFHYGVIVFWNFTEMQEKNVLADISFFEDTKRLVLKP 411

Query: 395 LDEHDIEREQFHFDYDKDI-ERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRI 453
           LDE DIE E+FHF+Y+KD  ERPRIFNDI+TLRS DH+I+LTLS+AIAQSSKLSRFESRI
Sbjct: 412 LDEQDIETEEFHFEYNKDNNERPRIFNDIITLRSHDHMIKLTLSYAIAQSSKLSRFESRI 471

Query: 454 TPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPS 513
           +P+ T+  KLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSS+ILDTP FFWS EPS
Sbjct: 472 SPLFTAVIKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSNILDTPGFFWSIEPS 531

Query: 514 LHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVL 573
           LHPLY+AMREYLEID+RVQV+NDR KV+LEFFD+CVDSVAE+N+ARVT WF+ VI++GVL
Sbjct: 532 LHPLYVAMREYLEIDKRVQVVNDRCKVFLEFFDICVDSVAEKNIARVTLWFLVVIIVGVL 591

Query: 574 FSVAEILVRYVMIRN 588
           FS  EI+VRY +I N
Sbjct: 592 FSFTEIVVRYNIIHN 606

>YFR048W Chr6 (246146..248134) [1989 bp, 662 aa] {ON}  RMD8Cytosolic
           protein required for sporulation
          Length = 662

 Score =  448 bits (1153), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 211/248 (85%), Positives = 228/248 (91%), Gaps = 2/248 (0%)

Query: 344 NDDVGNDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIERE 403
           ND  GND  +HAEIFIF YGVIVFWNFTEIQEKNILGDI FAD+KNL+IRPLDE DIE E
Sbjct: 416 NDHEGND--RHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYKNLMIRPLDEQDIETE 473

Query: 404 QFHFDYDKDIERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRITPILTSATKL 463
           QFHF+YD+D ERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRI+PIL S TKL
Sbjct: 474 QFHFEYDRDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISPILISVTKL 533

Query: 464 PKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMRE 523
           PKRLAL+GTLG+KREQLLKKSGKLFKLRVDVNLSS+ILDTPEFFWSFEPSLHPLY+AMRE
Sbjct: 534 PKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLHPLYVAMRE 593

Query: 524 YLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRY 583
           YLEIDQRVQV+NDR KV+LEFFD+CVDSVAERNMARVTWWFI VI+ GV+FS+ EI VRY
Sbjct: 594 YLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFSLTEIFVRY 653

Query: 584 VMIRNRLS 591
           V+I    S
Sbjct: 654 VIIHRHTS 661

 Score =  317 bits (813), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 180/342 (52%), Positives = 220/342 (64%), Gaps = 37/342 (10%)

Query: 1   MAYKPTSRRKPGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGVKSREDHVADR 60
           M+YK  ++  PG+      M KRSPSILVTD+R++  RMSAPFAGHAAG +   ++    
Sbjct: 1   MSYK-ANQPSPGE------MPKRSPSILVTDARTSKNRMSAPFAGHAAGSRKNMENAGVT 53

Query: 61  NRLAPYPSNGSKSSSV-----------RRRPSGRFSDISIDNILSDASDVPXXXXXXXXX 109
                  S G +SS++           RRR SGRFSDISIDNILSD SD+P         
Sbjct: 54  K------SQGVRSSAIGPSPLQSFTHPRRRSSGRFSDISIDNILSDNSDIPSARREERLS 107

Query: 110 XXXLDRFFPSGPLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYG------ 163
               DR      L   S  KM+NPLP RTSKTSQKLVLIPE+       T          
Sbjct: 108 SSSSDRPRQYERLS--SRRKMINPLPPRTSKTSQKLVLIPEDDNLNHFQTLPTNALDRQR 165

Query: 164 PKRAAASLNATGKRSQGRRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVYDECLY 223
           PK  +   N+  +  +  + + ++RITAYNVA+GFNL  +  FL+ THEVSPR+YDECLY
Sbjct: 166 PKVGSMKSNSFDRLPRYSKEKSMARITAYNVADGFNLNQLYKFLQETHEVSPRLYDECLY 225

Query: 224 VAYTLPLLLGKDGFRVRSNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDNN 283
           VAYTLPLL GK GFR++SN+SKK +GGKTLID LID SEQRDHHYEYYSGVET+ED +NN
Sbjct: 226 VAYTLPLLPGKGGFRIKSNLSKKTMGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANNN 285

Query: 284 FELDSNG-----NYDADITPDHLPNAMGNQDTFNPSEPQFFA 320
           +EL+++G     N D    PDHLPN +G QD+FNP EPQFFA
Sbjct: 286 YELETSGNNNNANQDTTTVPDHLPNPVGQQDSFNPMEPQFFA 327

>Skud_6.139 Chr6 (241140..243125) [1986 bp, 661 aa] {ON} YFR048W
           (REAL)
          Length = 661

 Score =  445 bits (1145), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 208/251 (82%), Positives = 228/251 (90%)

Query: 336 FNFDSSSKNDDVGNDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPL 395
           FN     + D+    +D+HAEIFIF YGVIVFWNFTEIQEKNILGDI FAD++NL IRPL
Sbjct: 405 FNRAYEMRKDNEHEGNDRHAEIFIFHYGVIVFWNFTEIQEKNILGDITFADYRNLTIRPL 464

Query: 396 DEHDIEREQFHFDYDKDIERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRITP 455
           DE DIE EQFHF+YD+D ERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRI+P
Sbjct: 465 DEQDIETEQFHFEYDRDTERPRIFNDIVTLRSGDHIIELTLSHAIAQSSKLSRFESRISP 524

Query: 456 ILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLH 515
           IL S TKLPKRLAL+GTLG+KREQLLKKSGKLFKLRVDVNLSS+ILDTPEFFWSFEPSLH
Sbjct: 525 ILISVTKLPKRLALYGTLGLKREQLLKKSGKLFKLRVDVNLSSTILDTPEFFWSFEPSLH 584

Query: 516 PLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFS 575
           PLY+AMREYLEIDQRVQV+NDR KV+LEFFD+CVDSVAERNMARVTWWFI VI+ GV+FS
Sbjct: 585 PLYVAMREYLEIDQRVQVLNDRCKVFLEFFDICVDSVAERNMARVTWWFILVILFGVIFS 644

Query: 576 VAEILVRYVMI 586
           + EI VRYV+I
Sbjct: 645 LTEICVRYVII 655

 Score =  330 bits (845), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 192/373 (51%), Positives = 233/373 (62%), Gaps = 39/373 (10%)

Query: 1   MAYKPTSRRKPGQQDATMSMSKRSPSILVTDSRSAGKRMSAPFAGHAAGV-KSREDHVAD 59
           M+YK  ++  PG+      M KRSPSILVTD+R++ KRMSAPFAGHAAG  K+ E+    
Sbjct: 1   MSYK-ANQPSPGE------MPKRSPSILVTDARTSKKRMSAPFAGHAAGSRKTMENKDLA 53

Query: 60  RNRLAPYPSNGSKSSSV-----------RRRPSGRFSDISIDNILSDASDVPXXXXXXXX 108
           R       S G++SS++           RRR SGRFSDISIDNILSD S +P        
Sbjct: 54  R-------SQGARSSNIGPSPLLNQPHPRRRSSGRFSDISIDNILSDNSGIPSARREERL 106

Query: 109 XXXXLDRFFPSGPLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYG----- 163
                DR      L   S+ KM+NPLP RTSKTSQKLVLIPE+       T         
Sbjct: 107 SSSSSDRPRHYERLN--SHRKMINPLPPRTSKTSQKLVLIPEDDDLNHFKTMPTKALDRQ 164

Query: 164 -PKRAAASLNATGKRSQGRRGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVYDECL 222
            PK  +   N+  +  +  R + ++RITAYNVA+GFNL ++  FL+ THEVSPR+YDECL
Sbjct: 165 RPKVGSMRTNSFDRLPRHSREKSMARITAYNVADGFNLNHLYKFLQDTHEVSPRLYDECL 224

Query: 223 YVAYTLPLLLGKDGFRVRSNVSKKVLGGKTLIDKLIDNSEQRDHHYEYYSGVETIEDVDN 282
           YVAYTLPLL GK GFR++SN+SKK +GGKTLID LID SEQRDHHYEYYSGVET+ED +N
Sbjct: 225 YVAYTLPLLPGKGGFRIKSNISKKTVGGKTLIDNLIDTSEQRDHHYEYYSGVETVEDANN 284

Query: 283 NFELDSNG-----NYDADITPDHLPNAMGNQDTFNPSEPQFFAXXXXXXXXXXXXXXNFN 337
           N+EL++NG     N D  I PDHLPN +G QD+FNP EPQFFA                N
Sbjct: 285 NYELETNGGNNTTNQDTTIVPDHLPNPVGQQDSFNPMEPQFFAEETPSEIENRERTERIN 344

Query: 338 FDSSSKNDDVGND 350
                +ND  GND
Sbjct: 345 MLKKEENDADGND 357

>Smik_4.235 Chr4 (427186..428481) [1296 bp, 431 aa] {ON} YDL001W
           (REAL)
          Length = 431

 Score =  176 bits (447), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 97/257 (37%), Positives = 154/257 (59%), Gaps = 11/257 (4%)

Query: 336 FNFDSSSKNDDVGND---SDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVI 392
           F  +   + DD G +   SD+H ++FIF YGV+V W FTE +EK  L DI   + + L  
Sbjct: 182 FEHEDVIRLDDEGGEIIVSDKHPDLFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEKLA- 240

Query: 393 RPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFES 451
               E DI+ E+F++   K  + PRI+ND +TLR G +++++L++SHAIAQS K+S FE 
Sbjct: 241 ----EEDIQVEEFNYYVTKSYQ-PRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEE 295

Query: 452 RITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFE 511
            +   +     +P+ +A  G + M +E ++K  G+LF LR+++NL  SILD+PE  WS E
Sbjct: 296 LVDNTIEDTQDIPQEIAYSGKVSMSKEDIMKSIGELFILRININLHGSILDSPEIMWS-E 354

Query: 512 PSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLG 571
           P L P+Y A R YLEI+QRV ++N R +V  +   +  + +   +   + +  I ++ + 
Sbjct: 355 PQLEPIYQATRGYLEINQRVSLLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVILLVGVE 414

Query: 572 VLFSVAEILVRYVMIRN 588
           VL SV  I+V  +  +N
Sbjct: 415 VLISVINIVVDMLASQN 431

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (45%), Gaps = 12/120 (10%)

Query: 119 SGPLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRES-STTGYGPKRAAASLNATGKR 177
           S  + P+S          RTS+T+QKL L+PEE   R+    T    +   + +N    +
Sbjct: 52  SAMINPISKQSRTGAGAQRTSRTAQKLKLLPEEPFQRDGDGLTELKNQEVYSQVNRIKDK 111

Query: 178 SQGRRGRKLS--------RITAYNVAEGFNLEYMADFLKAT---HEVSPRVYDECLYVAY 226
              R   KL         R TAY  A  +N++ +  +LK +   H   P+++DECLY  +
Sbjct: 112 PARRDAEKLGKAHRHLLPRSTAYCTASSYNMKELIRWLKDSRKLHHTHPKLFDECLYTPF 171

>Suva_4.252 Chr4 (445183..446475) [1293 bp, 430 aa] {ON} YDL001W
           (REAL)
          Length = 430

 Score =  176 bits (445), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 151/250 (60%), Gaps = 11/250 (4%)

Query: 336 FNFDSSSKNDDVGND---SDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVI 392
           F  +   + DD G +   SD+H ++FIF YGV+V W FTE +EK  L DI   + + L  
Sbjct: 181 FEHEDVIRLDDEGGEIIVSDKHPDLFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEKLA- 239

Query: 393 RPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFES 451
               E DI+ E+F++   K  + PRI+ND +TLR G +++++L++SHAIAQS K+S FE 
Sbjct: 240 ----EEDIQVEEFNYYVTKSYQ-PRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEE 294

Query: 452 RITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFE 511
            +   +     +P+ +A  G + M +E ++K  G+LF LR+++NL  S+LD+PE  WS E
Sbjct: 295 LVDNTIEDTQDIPQEIAYSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-E 353

Query: 512 PSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLG 571
           P L P+Y A R YLEI+QRV ++N R +V  +   +  + +   +   + +  I ++ + 
Sbjct: 354 PQLEPIYQATRGYLEINQRVSLLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVILLVGVE 413

Query: 572 VLFSVAEILV 581
           VL SV  I+V
Sbjct: 414 VLISVINIVV 423

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 38/148 (25%), Positives = 62/148 (41%), Gaps = 12/148 (8%)

Query: 119 SGPLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGR-ESSTTGYGPKRAAASLNATGKR 177
           S  + P+S          RTS+T+QKL L+PEE   R +   T    +   + +N    +
Sbjct: 51  SAMINPISKQSRTGAGAQRTSRTAQKLKLLPEEPFQRDDEGLTDLKNQEVYSQVNRIKDK 110

Query: 178 SQGRRGRKLS--------RITAYNVAEGFNLEYMADFLK---ATHEVSPRVYDECLYVAY 226
              R   KL         R TAY  +  +N++ +  +LK     H   P+++DECLY  +
Sbjct: 111 PARRDAEKLGKAHRHLLPRSTAYCTSSSYNMKELIRWLKDCRKIHHTHPKLFDECLYTPF 170

Query: 227 TLPLLLGKDGFRVRSNVSKKVLGGKTLI 254
                 G   F     +     GG+ ++
Sbjct: 171 IYNDWRGDKRFEHEDVIRLDDEGGEIIV 198

>YDL001W Chr4 (447984..449276) [1293 bp, 430 aa] {ON}
           RMD1Cytoplasmic protein required for sporulation
          Length = 430

 Score =  175 bits (444), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 148/241 (61%), Gaps = 11/241 (4%)

Query: 345 DDVGND---SDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIE 401
           DD G +   SD+H ++FIF YGV+V W FTE +EK  L DI   + + L      E DI+
Sbjct: 190 DDEGGEIIVSDKHPDLFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEKLA-----EEDIQ 244

Query: 402 REQFHFDYDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRITPILTSA 460
            E+F++   K  + PRI+ND +TLR G +++++L++SHAIAQS K+S FE  +   +   
Sbjct: 245 VEEFNYYVTKSYQ-PRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDT 303

Query: 461 TKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIA 520
             +P+ +A  G + M +E ++K  G+LF LR+++NL  S+LD+PE  WS EP L P+Y A
Sbjct: 304 QDIPQEIAYSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQA 362

Query: 521 MREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEIL 580
            R YLEI+QRV ++N R +V  +   +  + +   +   + +  I ++ + VL SV  I+
Sbjct: 363 TRGYLEINQRVSLLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVILLVGVEVLISVINIV 422

Query: 581 V 581
           V
Sbjct: 423 V 423

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 57/124 (45%), Gaps = 23/124 (18%)

Query: 126 SYT--KMLNPL---------PSRTSKTSQKLVLIPEEVAGRESS-TTGYGPKRAAASLNA 173
           SYT   M+NP            RTS+T+QKL L+PEE   R+S   T    +   + +N 
Sbjct: 47  SYTGSAMINPTSKQSRTGSGAQRTSRTAQKLKLLPEEPFQRDSERLTDLKNQEVYSQVNR 106

Query: 174 TGKRSQGRRGRKLS--------RITAYNVAEGFNLEYMADFLKAT---HEVSPRVYDECL 222
              +   R   KL         R TAY  A  +N++ +  +LK     H   P+++DECL
Sbjct: 107 IKDKPARRDAEKLGKAHRHLLPRSTAYCTASSYNMKELVRWLKDCRKLHHTHPKLFDECL 166

Query: 223 YVAY 226
           Y  +
Sbjct: 167 YTPF 170

>Skud_4.253 Chr4 (439498..440790) [1293 bp, 430 aa] {ON} YDL001W
           (REAL)
          Length = 430

 Score =  175 bits (443), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 95/250 (38%), Positives = 151/250 (60%), Gaps = 11/250 (4%)

Query: 336 FNFDSSSKNDDVGND---SDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVI 392
           F  +   + DD G +   SD+H ++FIF YGV+V W FTE +EK  L DI   + + L  
Sbjct: 181 FEHEDVIRLDDEGGEIIVSDKHPDLFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEKLA- 239

Query: 393 RPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFES 451
               E DI+ E+F++   K  + PRI+ND +TLR G +++++L++SHAIAQS K+S FE 
Sbjct: 240 ----EEDIQVEEFNYYVTKSYQ-PRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEE 294

Query: 452 RITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFE 511
            +   +     +P+ +A  G + M +E ++K  G+LF LR+++NL  S+LD+PE  WS E
Sbjct: 295 LVDNTIEDTQDIPQEIAYSGKVSMGKEDIMKSIGELFILRININLHGSVLDSPEIMWS-E 353

Query: 512 PSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLG 571
           P L P+Y A R YLEI+QRV ++N R +V  +   +  + +   +   + +  I ++ + 
Sbjct: 354 PQLEPIYQATRGYLEINQRVSLLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVILLVGVE 413

Query: 572 VLFSVAEILV 581
           VL SV  I+V
Sbjct: 414 VLISVINIVV 423

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 38/125 (30%), Positives = 58/125 (46%), Gaps = 23/125 (18%)

Query: 125 LSYT--KMLNPL---------PSRTSKTSQKLVLIPEEVAGR-ESSTTGYGPKRAAASLN 172
           +SYT   M+NP+           RTS+T+QKL L+PEE   R +   T    +   + +N
Sbjct: 46  VSYTGNAMINPISKQSRTGAGAQRTSRTAQKLKLLPEEPFQRDDEGLTDLKNQEVYSQVN 105

Query: 173 ATGKRSQGRRGRKLS--------RITAYNVAEGFNLEYMADFLK---ATHEVSPRVYDEC 221
               +   R   KL         R TAY  A  +N++ +  +LK     H   P+++DEC
Sbjct: 106 RIKDKPARRDAEKLGKAHRHLLPRSTAYCTASSYNMKELIRWLKDCRKIHHTHPKLFDEC 165

Query: 222 LYVAY 226
           LY  +
Sbjct: 166 LYTPF 170

>SAKL0C11286g Chr3 complement(1012631..1013917) [1287 bp, 428 aa]
           {ON} highly similar to uniprot|Q05210 Saccharomyces
           cerevisiae YDL001W RMD1 Cytoplasmic protein required for
           sporulation
          Length = 428

 Score =  174 bits (442), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 151/250 (60%), Gaps = 11/250 (4%)

Query: 336 FNFDSSSKNDDVG---NDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVI 392
           F  +   + DD G   N SD+  ++FIF YGVIV W FTE +EK +L D+   + + L  
Sbjct: 179 FEHEDVIRLDDEGGEINVSDKQPDLFIFEYGVIVMWGFTEREEKALLNDVEKFEKEKLA- 237

Query: 393 RPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFES 451
               E D++ EQF++ Y     +PRI+ND +TLR G +++I+L++SHAIAQS K+S FE 
Sbjct: 238 ----EEDVQVEQFNY-YITQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEE 292

Query: 452 RITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFE 511
            +   +     +P+ +A  G + M +E ++K  G+LF LR+++NL  S+LD+PE  WS E
Sbjct: 293 LVDNTIEDTQDIPQEIASSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-E 351

Query: 512 PSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLG 571
           P L P+Y A R YLEI+QRV ++N R +V  +   +  + +   +   + +  I ++ + 
Sbjct: 352 PQLEPIYQATRGYLEINQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIIIVLVGVE 411

Query: 572 VLFSVAEILV 581
           VL SV  I+V
Sbjct: 412 VLISVINIIV 421

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 49/103 (47%), Gaps = 11/103 (10%)

Query: 135 PSRTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAASLNATGKRSQGRRGRKLS------- 187
           P RTS+T+QKL L+PEE   R+        K   + +N    +   R   KL        
Sbjct: 66  PQRTSRTAQKLKLLPEEPFQRKDEELELVDKDVYSQVNRITDKPARRDAEKLGKGHRHLL 125

Query: 188 -RITAYNVAEGFNLEYMADFLKAT---HEVSPRVYDECLYVAY 226
            R+TAY  A  ++++ +  +LK     H    +++DECLY  +
Sbjct: 126 PRVTAYCTASSYSMKELIRWLKDCKRIHHTHTKLFDECLYTPF 168

>NCAS0A10120 Chr1 (2022090..2023361) [1272 bp, 423 aa] {ON}
           Anc_3.209
          Length = 423

 Score =  174 bits (440), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 93/241 (38%), Positives = 148/241 (61%), Gaps = 11/241 (4%)

Query: 345 DDVGND---SDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIE 401
           DD G +   SD+H+E+FIF YGV+V W FTE +EK  L D+   + + L      + DI+
Sbjct: 183 DDEGGEIDVSDKHSELFIFEYGVVVMWGFTEREEKCFLTDLERFEKEKLA-----DEDIQ 237

Query: 402 REQFHFDYDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRITPILTSA 460
            E+F++   K  + PRI+ND +TLR G +++++L++SHAIAQS K+S FE  +   +   
Sbjct: 238 VEEFNYYVTKSYQ-PRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDT 296

Query: 461 TKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIA 520
             +P+ +A  G + M +E ++K  G+LF LR+++NL  S+LD+PE  WS EP L P+Y A
Sbjct: 297 QDIPQEIASSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQA 355

Query: 521 MREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEIL 580
            R YLEI+QRV ++N R +V  +   +  + +   +   + +  I ++ + VL SV  I 
Sbjct: 356 TRGYLEINQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVIILVGVEVLISVINIA 415

Query: 581 V 581
           V
Sbjct: 416 V 416

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 47/100 (47%), Gaps = 10/100 (10%)

Query: 137 RTSKTSQKLVLIPEEVAGRE-----SSTTGYGPKRAAASLNATGKRSQ-GRRGRK-LSRI 189
           RTS+T+QKL L+PEE    +        T Y        + A     + G+  R  L R 
Sbjct: 62  RTSRTTQKLKLLPEEPFNDKRKQPNGDNTVYSQVNRITDMPARKDAEKLGKAHRHLLPRA 121

Query: 190 TAYNVAEGFNLEYMADFLKAT---HEVSPRVYDECLYVAY 226
           T Y  A  +N+  +  +L+ +   H   P+++DECLY  +
Sbjct: 122 TGYCTASSYNMRDLIRWLRDSRKIHHTHPKLFDECLYTPF 161

>TDEL0D04130 Chr4 (760040..761356) [1317 bp, 438 aa] {ON} Anc_3.209
           YDL001W
          Length = 438

 Score =  173 bits (438), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/250 (37%), Positives = 149/250 (59%), Gaps = 11/250 (4%)

Query: 336 FNFDSSSKNDDVG---NDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVI 392
           F  +   + DD G   N SD+  E++IF YGVIV W FTE +EK  L D+   + + L  
Sbjct: 189 FEHEDVIRLDDEGGEINVSDKQPELYIFEYGVIVLWGFTEREEKAFLNDLERFEKEKLA- 247

Query: 393 RPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFES 451
               E D++ E+F++ Y     +PRI+ND +TLR G +++I+L++SHAIAQS K+S FE 
Sbjct: 248 ----EEDVQVEEFNY-YVTQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEE 302

Query: 452 RITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFE 511
            +   +     +P+ +A  G + M +E ++K  G+LF LR+++NL  S+LD+PE  WS E
Sbjct: 303 LVDNTIEDTQDIPQEIACSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-E 361

Query: 512 PSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLG 571
           P L P+Y A R YLEI+QRV ++N R +V  +   +  + +   +   + +  I ++ + 
Sbjct: 362 PQLEPIYHATRGYLEINQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVILLVGME 421

Query: 572 VLFSVAEILV 581
           VL +V  I V
Sbjct: 422 VLIAVVNIAV 431

 Score = 50.1 bits (118), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 53/116 (45%), Gaps = 11/116 (9%)

Query: 122 LRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAASLNATGKRSQGR 181
           + P +  K +     RTS+T+QKL L+PEE   R+        +   + ++    +   R
Sbjct: 63  MNPPAPGKQMRAGAQRTSRTAQKLKLLPEEPFQRDEEMQELRDRDVYSQVSRITDKPARR 122

Query: 182 RGRKLS--------RITAYNVAEGFNLEYMADFLK---ATHEVSPRVYDECLYVAY 226
              KL         R TAY  A  ++++ +  +LK     H   P+++DECLY  +
Sbjct: 123 DAEKLGKGHRHLLPRATAYCTASSYHMKELIKWLKDCRKIHHTHPKLFDECLYTPF 178

>TBLA0A00170 Chr1 (16781..18298) [1518 bp, 505 aa] {ON} Anc_3.209
           YDL001W
          Length = 505

 Score =  174 bits (441), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 95/253 (37%), Positives = 151/253 (59%), Gaps = 11/253 (4%)

Query: 336 FNFDSSSKNDDVGND---SDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVI 392
           F  D   + DD G D   SD+  ++FIF YGVIV W F E +E+ +L DI   + + L  
Sbjct: 256 FEHDDVIRLDDEGGDINVSDKQPDLFIFEYGVIVMWGFIEREEQALLADIERFEREKLA- 314

Query: 393 RPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFES 451
               E DI+ E+F++ Y     +PRI+ND +TLR G +++++L++SHAIAQS K+S FE 
Sbjct: 315 ----EEDIQIEEFNY-YVTQSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEE 369

Query: 452 RITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFE 511
            +   +     +P+ +AL G + M +E ++K  G+LF LR+++NL  S+LD+PE  WS E
Sbjct: 370 LVDNTIEDTQGIPQEIALSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-E 428

Query: 512 PSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLG 571
           P L P+Y A R YLEI+QRV ++N R +V  +   +  + +   +   + +  I ++ + 
Sbjct: 429 PQLEPIYQATRGYLEINQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVIVLVGVE 488

Query: 572 VLFSVAEILVRYV 584
           VL S+  I V  +
Sbjct: 489 VLISLINIAVDLI 501

 Score = 55.1 bits (131), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 54/106 (50%), Gaps = 14/106 (13%)

Query: 135 PSRTSKTSQKLVLIPE---EVAGRESSTTGYGPKRAAASLNATGKRSQGRRGRKLS---- 187
           P RTS+T++KL L+PE   ++   E  T  +  +   + +N    ++  R   KL     
Sbjct: 140 PQRTSRTARKLKLLPEGPFQMTPAEFQTDIFPEQEVYSQVNRITDKNARRDAEKLGKAHR 199

Query: 188 ----RITAYNVAEGFNLEYMADFLKAT---HEVSPRVYDECLYVAY 226
               R TAY  A  +N+  +  +LK T   H+ +P+++DECLY  +
Sbjct: 200 HLLPRTTAYCTASSYNMRGLIHWLKETKKAHQTTPKLFDECLYTPF 245

>Kwal_27.11001 s27 complement(593288..594514) [1227 bp, 408 aa] {ON}
           YDL001W - Hypothetical ORF [contig 32] FULL
          Length = 408

 Score =  170 bits (430), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 93/241 (38%), Positives = 148/241 (61%), Gaps = 11/241 (4%)

Query: 345 DDVG---NDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIE 401
           DD G   N SD+  ++FIF YGV+V W FTE +EK  L D+   + + L      E D++
Sbjct: 168 DDEGGEINVSDKQPDLFIFEYGVVVMWGFTEREEKAFLNDLEKFEKEKLA-----EEDVQ 222

Query: 402 REQFHFDYDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRITPILTSA 460
            EQF++ Y     +PRI+ND +TLR G +++I+L++SHAIAQS K+S FE  +   +   
Sbjct: 223 LEQFNY-YITQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDT 281

Query: 461 TKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIA 520
             +P+++A  G + M +E ++K  G+LF LR+++NL  S+LD+PE  WS EP L P+Y A
Sbjct: 282 QDIPQQIASSGKVSMGKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYHA 340

Query: 521 MREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEIL 580
            R YLEI+QRV ++N R +V  +   +  + +   +   + +  I ++ + VL S+  I+
Sbjct: 341 TRGYLEINQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIIIVLVGVEVLVSLINII 400

Query: 581 V 581
           V
Sbjct: 401 V 401

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 32/104 (30%), Positives = 53/104 (50%), Gaps = 12/104 (11%)

Query: 135 PSRTSKTSQKLVLIPEEVAGRE-----SSTTGYGPKRAAASLNATGKRSQGRRGRK---- 185
           P RTS+T+QKL L+PEE   R+     SST      +     +   +R   + G+     
Sbjct: 45  PQRTSRTTQKLKLLPEEPFNRQQDELLSSTDREVYSQVGRITDTPARRDAEKLGKGQRHL 104

Query: 186 LSRITAYNVAEGFNLEYMADFL---KATHEVSPRVYDECLYVAY 226
           L R+TAY  +  +N++ +  +L   K  H   P+++DECL+  +
Sbjct: 105 LPRVTAYCTSSSYNMKELIRWLKDCKKVHHTHPKLFDECLFTPF 148

>KAFR0F02500 Chr6 complement(484705..486105) [1401 bp, 466 aa] {ON}
           Anc_3.209 YDL001W
          Length = 466

 Score =  171 bits (433), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 155/258 (60%), Gaps = 13/258 (5%)

Query: 336 FNFDSSSKNDDVG---NDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVI 392
           F  D   + DD G   N SD+  ++FIF YGVIV W FTE +EK  L DI   + + L  
Sbjct: 217 FAHDDLIRLDDEGGEINVSDKQPDLFIFEYGVIVMWGFTEREEKAFLNDIERFEKEKLA- 275

Query: 393 RPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFES 451
               E D++ E+F++ Y     +PRI+ND +TLR+G +++ +L++SHAIAQS K+S FE 
Sbjct: 276 ----EEDVQVEEFNY-YVTQSYQPRIYNDFITLRNGSNYMTKLSISHAIAQSVKISLFEE 330

Query: 452 RITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFE 511
            +   +     +P+++A  G + M +E +++  G+LF LR+++NL  S+LD+P+  WS E
Sbjct: 331 LVDNTIEDTEDIPQQIASSGKVSMSKEDIMRSIGELFILRININLHGSVLDSPDIMWS-E 389

Query: 512 PSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLG 571
           P L P+Y A R YLEI+QRV+++N R +V  +   +  + +       +   FI +I++G
Sbjct: 390 PQLEPIYQATRGYLEINQRVELLNQRLEVVSDLLQMLKEQLGHSQEEYLE--FIVIILVG 447

Query: 572 VLFSVAEILVRYVMIRNR 589
           V   ++ I +   MI N+
Sbjct: 448 VEVLISVINIAVDMIANK 465

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 16/106 (15%)

Query: 137 RTSKTSQKLVLIPEEVAGRESS-----TTGYGPKRAAASLNATGKRSQGRRGRKLS---- 187
           RTS+T+QKL L+PEE   +ESS     T     +   + +N    +      +KL     
Sbjct: 101 RTSRTAQKLKLLPEEAFAKESSIDSGITVNDEDREVYSQVNRIKDKPARIDAQKLGKAHR 160

Query: 188 ----RITAYNVAEGFNLEYMADFLKAT---HEVSPRVYDECLYVAY 226
               R TAY  A  +N+  +  ++K +   H   P+++DECL+  +
Sbjct: 161 HLLPRCTAYCTASSYNMRELIRWIKNSKKIHFTHPKLFDECLFTPF 206

>Ecym_5293 Chr5 (595331..596764) [1434 bp, 477 aa] {ON} similar to
           Ashbya gossypii AEL004W
          Length = 477

 Score =  171 bits (432), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 91/253 (35%), Positives = 149/253 (58%), Gaps = 11/253 (4%)

Query: 336 FNFDSSSKNDDVGND---SDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVI 392
           F  D   + DD G D    D+  ++FIF YGV+V W FTE +EK  L D+   + + L  
Sbjct: 226 FEHDDHIRLDDEGGDINVGDKQPDLFIFEYGVVVMWGFTEREEKAFLNDVEKFEKEKLA- 284

Query: 393 RPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFES 451
               E D++ E+F++ Y     +PRI+ND +TLR G +++I+L++SHAI+QS K+S FE 
Sbjct: 285 ----EEDVQVEEFNY-YVTQSYQPRIYNDFITLRDGSNYMIKLSISHAISQSVKISLFEE 339

Query: 452 RITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFE 511
            +   +     +P+ +A  G + M +  ++K  G+LF LR+++NL  S+LD+PE  WS E
Sbjct: 340 LVDNTIEDTQDIPQEIASSGKVSMSKADIMKSIGELFILRININLHGSVLDSPEIMWS-E 398

Query: 512 PSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLG 571
           P L P+Y A R YLEI+QRV ++N R +V  +   +  + +   +   + +  I ++ + 
Sbjct: 399 PQLEPIYQATRGYLEINQRVALLNQRLEVVSDLLQMLKEQLGHSHEENLEFIVILLVGVE 458

Query: 572 VLFSVAEILVRYV 584
           VL S+  I+V  +
Sbjct: 459 VLISLINIIVDII 471

 Score = 53.5 bits (127), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 54/117 (46%), Gaps = 12/117 (10%)

Query: 122 LRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGR-ESSTTGYGPKRAAASLNATGKRSQG 180
           ++P + T      P RTS+T+QKL L+PEE   R          +   + +N    +   
Sbjct: 99  VKPTNNTATTKLGPQRTSRTAQKLKLLPEEPFQRIREQDCDIIDRDVYSQVNRITDKPAR 158

Query: 181 RRGRKLS--------RITAYNVAEGFNLEYMADFL---KATHEVSPRVYDECLYVAY 226
           R   KL         R TAY  A  +N++ +  +L   K TH   P+++DECLY  +
Sbjct: 159 RDAEKLGKSQRHLLPRATAYCTASSYNMKELVRWLKYCKKTHHTHPKLFDECLYTPF 215

>AEL004W Chr5 (630125..631552) [1428 bp, 475 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDL001W (RMD1)
          Length = 475

 Score =  171 bits (432), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 93/253 (36%), Positives = 150/253 (59%), Gaps = 11/253 (4%)

Query: 336 FNFDSSSKNDDVG---NDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVI 392
           F  +   + DD G   N SD+  ++FIF YGV+V W FTE +EK  L D+   + + L  
Sbjct: 226 FEHEDVIRLDDEGGEINVSDKQPDLFIFEYGVVVMWGFTEREEKAFLNDLERFEKEKLA- 284

Query: 393 RPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFES 451
               E D++ E+F++ Y     +PRI+ND +TLR G +++I+L++SHAI+QS K+S FE 
Sbjct: 285 ----EEDVQVEEFNY-YITQSYQPRIYNDFITLRDGSNYMIKLSISHAISQSVKISLFEE 339

Query: 452 RITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFE 511
            +   +     +P+ +A  G + M +  ++K  G+LF LR+++NL  S+LD+PE  WS E
Sbjct: 340 LVDNTIEDTQDIPQEIASSGKVSMSKADIMKSIGELFILRININLHGSVLDSPEIMWS-E 398

Query: 512 PSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLG 571
           P L P+Y A R YLEI+QRV ++N R +V  +   +  + +   +   + +  I ++ + 
Sbjct: 399 PQLEPIYQATRGYLEINQRVALLNQRLEVVSDLLQMLKEQLGHSHEENLEFIVILLLGVE 458

Query: 572 VLFSVAEILVRYV 584
           VL SV  I+V  V
Sbjct: 459 VLISVVNIIVDIV 471

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 51/104 (49%), Gaps = 12/104 (11%)

Query: 135 PSRTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAAS-----LNATGKRSQGRRGRK---- 185
           P RTS+T+QKL L+PEE   R          R   S      +   +R   + G+     
Sbjct: 112 PQRTSRTAQKLKLLPEEPFQRSQEQEDDSVDREVYSQVNRITDKPARRDAEKLGKSHRHL 171

Query: 186 LSRITAYNVAEGFNLEYMADFL---KATHEVSPRVYDECLYVAY 226
           L R+TAY  A  +N++ +  +L   K TH   P+++DECLY  +
Sbjct: 172 LPRVTAYCTASSYNMKELVRWLKDCKRTHHTHPKLFDECLYTPF 215

>KLTH0G16544g Chr7 complement(1435479..1436705) [1227 bp, 408 aa]
           {ON} similar to uniprot|Q05210 Saccharomyces cerevisiae
           YDL001W RMD1 Cytoplasmic protein required for
           sporulation
          Length = 408

 Score =  169 bits (427), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 92/241 (38%), Positives = 147/241 (60%), Gaps = 11/241 (4%)

Query: 345 DDVG---NDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIE 401
           DD G   N SD+  ++FIF YGVIV W FTE +EK  L D+   + + L      E D++
Sbjct: 168 DDEGGEINVSDKQPDLFIFEYGVIVMWGFTEREEKAFLNDVEKFEKEKLA-----EEDVQ 222

Query: 402 REQFHFDYDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRITPILTSA 460
            EQF++ Y     +PRI+ND +TLR G +++++L++SHAIAQS K+S FE  +   +   
Sbjct: 223 VEQFNY-YITQSYQPRIYNDFITLRDGSNYMVKLSISHAIAQSVKISLFEELVDNTIEDT 281

Query: 461 TKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIA 520
             +P+++A  G + M +  ++K  G+LF LR+++NL  S+LD+PE  WS EP L P+Y A
Sbjct: 282 QDIPQQIASSGKVSMGKADIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYHA 340

Query: 521 MREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEIL 580
            R YLEI+QRV ++N R +V  +   +  + +   +   + +  I ++ + VL S+  I+
Sbjct: 341 TRGYLEINQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIIIVLVGVEVLISLINIV 400

Query: 581 V 581
           V
Sbjct: 401 V 401

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 52/103 (50%), Gaps = 12/103 (11%)

Query: 136 SRTSKTSQKLVLIPEEVAGR-ESSTTGYGPKRAAASLN----ATGKRSQGRRGRK----L 186
            RTS+T+QKL L+PEE   R E    G   +   + +N       +R   + G+     L
Sbjct: 46  QRTSRTAQKLKLLPEEPFNRPEDLLLGNADRDVYSQVNRITDTPARRDAEKLGKGQRHLL 105

Query: 187 SRITAYNVAEGFNLEYMADFLKAT---HEVSPRVYDECLYVAY 226
            R+TAY  +  +N++ +  +LK     H   P+++DECL+  +
Sbjct: 106 PRVTAYCTSSAYNMKELVRWLKGCKKAHHTHPKLFDECLFTPF 148

>Kpol_1045.58 s1045 (139327..140670) [1344 bp, 447 aa] {ON}
           (139329..140672) [1344 nt, 448 aa]
          Length = 447

 Score =  169 bits (429), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 91/241 (37%), Positives = 147/241 (60%), Gaps = 11/241 (4%)

Query: 345 DDVG---NDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIE 401
           DD G   N SD+  ++FIF YGV+V W FTE +EK  L DI   + + L      E D++
Sbjct: 205 DDEGGEINVSDKQPDVFIFEYGVVVMWGFTEREEKAFLNDIEKFEKEKLA-----EEDVQ 259

Query: 402 REQFHFDYDKDIERPRIFNDIVTLR-SGDHIIELTLSHAIAQSSKLSRFESRITPILTSA 460
            E+F++ Y  +  +PRI+ND +TLR + +++I+L++SH +AQS K+S FE  +   +   
Sbjct: 260 VEEFNY-YITESYQPRIYNDFITLRDASNYMIKLSISHGLAQSVKISLFEELVDNTIEDT 318

Query: 461 TKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIA 520
             +P+ +A  G + M +E ++K  G+LF LR+++NL  S+LD+PE  WS EP L P+Y A
Sbjct: 319 QDIPQEIASSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQA 377

Query: 521 MREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEIL 580
           MR YLEI+QRV ++N R +V  +   +  + +   +   + +  I ++ + VL S+  I 
Sbjct: 378 MRGYLEINQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLEFIVIILVGVEVLVSIINIA 437

Query: 581 V 581
           V
Sbjct: 438 V 438

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 34/107 (31%), Positives = 50/107 (46%), Gaps = 20/107 (18%)

Query: 136 SRTSKTSQKLVLIPEE---------VAGRESSTTGYGPKRAAASLNATGKRSQGRRGRK- 185
            RTS+T+QKL L+PEE         +A R+     Y         NA  +R   + G+  
Sbjct: 83  QRTSRTAQKLKLLPEEPFKIDPENLIALRDQDV--YTQVNRITDKNA--RRDAEKLGKAH 138

Query: 186 ---LSRITAYNVAEGFNLEYMADFL---KATHEVSPRVYDECLYVAY 226
              L R TAY  A  +N+  +  +L   K  H   P+++DECLY  +
Sbjct: 139 RHLLPRTTAYCTASSYNMRGLIKWLKDSKKAHHTHPKLFDECLYTPF 185

>TPHA0P00550 Chr16 complement(110346..111686) [1341 bp, 446 aa] {ON}
           Anc_3.209 YDL001W
          Length = 446

 Score =  169 bits (429), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 93/241 (38%), Positives = 145/241 (60%), Gaps = 11/241 (4%)

Query: 345 DDVG---NDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIE 401
           DD G   N SD+  ++FIF YGV+V W FTE +EK  L DI   + + L      E DI+
Sbjct: 206 DDEGGEINVSDKQPDVFIFEYGVVVLWGFTEREEKEFLNDIEKYEKEKLA-----EEDIQ 260

Query: 402 REQFHFDYDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRITPILTSA 460
            E+F++ Y  +  +PRI+ND +TLR G +++ +L++SHA++QS K+S FE  +   +   
Sbjct: 261 IEEFNY-YVTESYQPRIYNDFITLRDGSNYMTKLSISHALSQSVKISLFEELLDNTIEDT 319

Query: 461 TKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIA 520
             +P+ +A  G + M +E ++K  G+LF LR+++NL  SILD+PE  WS EP L P+Y A
Sbjct: 320 QDIPQEIASSGKVSMSKEDIMKSIGELFILRININLHGSILDSPEIMWS-EPQLEPIYQA 378

Query: 521 MREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEIL 580
            R YLEI+QRV ++N R +V  +   +  + +       + +  I ++ + VL SV  I 
Sbjct: 379 TRGYLEINQRVALLNQRLEVVSDLLQMLKEQLGHTQEEYLEFIVIVLVGVEVLLSVINIS 438

Query: 581 V 581
           V
Sbjct: 439 V 439

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 52/102 (50%), Gaps = 12/102 (11%)

Query: 137 RTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAAS-LNATGKRSQGRRGRKLS-------- 187
           RTS+T+QKL L+PEE    + +     P+    S +N    +S  R   KL         
Sbjct: 85  RTSRTTQKLKLLPEEPYDLDHNNFPDLPENEVYSQVNRIKDKSARRDAEKLGKAHRHLLP 144

Query: 188 RITAYNVAEGFNLEYMADFLK-ATHEV--SPRVYDECLYVAY 226
           R+TA+  A  +N+  +  +LK + H+    P+++DECLY  +
Sbjct: 145 RVTAFCTASSYNMRGLIRWLKDSKHQFRSHPKLFDECLYTPF 186

>CAGL0M10483g Chr13 complement(1049771..1051069) [1299 bp, 432 aa]
           {ON} highly similar to uniprot|Q03441 Saccharomyces
           cerevisiae YDL001w
          Length = 432

 Score =  169 bits (427), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 131/200 (65%), Gaps = 11/200 (5%)

Query: 345 DDVG---NDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIE 401
           DD G   N SD+H +IFIF YGVIV W FTE +EK  L D+   + + L      E DI+
Sbjct: 192 DDEGGEINVSDKHPDIFIFEYGVIVLWGFTEREEKAFLNDLEKFEKEKLA-----EEDIQ 246

Query: 402 REQFHFDYDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRITPILTSA 460
            E+F++ Y     +PRI+ND +TLR G +++I+L++SHAIAQS K+S FE  +   +   
Sbjct: 247 IEEFNY-YVTQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEELVDNTIEDT 305

Query: 461 TKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIA 520
             +P+ +A  G + M +E+++K  G+LF LR+++NL  S+LD+PE  WS EP L P+Y A
Sbjct: 306 QDIPQEIASSGKVSMSKEEIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQA 364

Query: 521 MREYLEIDQRVQVINDRAKV 540
            R YLEI+QRV ++N R +V
Sbjct: 365 TRGYLEINQRVALLNQRLEV 384

 Score = 56.2 bits (134), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/101 (30%), Positives = 51/101 (50%), Gaps = 11/101 (10%)

Query: 137 RTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAASLNATGKRSQGRRGRKLS--------R 188
           RTS+T+QKL L+PEE   R+   +    +   + +N    ++  R   KL         R
Sbjct: 72  RTSRTAQKLKLLPEEAFHRDEEVSELRDRDVYSQVNRITDKNARRDAEKLGKAHRHLLPR 131

Query: 189 ITAYNVAEGFNLEYMADFL---KATHEVSPRVYDECLYVAY 226
            T+Y  A  +N++ +  +L   K TH   P+++DECLY  +
Sbjct: 132 CTSYCTASSYNMKDLIRWLKDSKKTHHTHPKLFDECLYTPF 172

>ZYRO0A04400g Chr1 (359271..360647) [1377 bp, 458 aa] {ON} similar
           to uniprot|Q05210 Saccharomyces cerevisiae YDL001W RMD1
           Cytoplasmic protein required for sporulation
          Length = 458

 Score =  169 bits (428), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/248 (36%), Positives = 148/248 (59%), Gaps = 11/248 (4%)

Query: 336 FNFDSSSKNDDVGND---SDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVI 392
           F  +   + DD G D   SD+  ++F+F YGV+V W FTE +EK  L DI   + + L  
Sbjct: 209 FEHEDVIRLDDEGGDINVSDKQPDLFVFEYGVVVLWGFTEREEKAFLNDIEGFEKEKLA- 267

Query: 393 RPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLR-SGDHIIELTLSHAIAQSSKLSRFES 451
               E D++ E+F++ Y     +PRI+ND +TLR + +++I+L++SHAIAQS K+S FE 
Sbjct: 268 ----EEDVQIEEFNY-YVTQSYQPRIYNDFITLRDASNYMIKLSISHAIAQSVKISLFEE 322

Query: 452 RITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFE 511
            +   +     +P+ +A  G + M +E ++K  G+LF LR+++NL  S+LD+PE  WS E
Sbjct: 323 LVDNTIEDTQDIPQEIASSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-E 381

Query: 512 PSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLG 571
           P L P+Y A R YLEI+QRV ++N R +V  +   +  + +   +   + +  I ++ + 
Sbjct: 382 PQLEPIYQATRGYLEINQRVALLNQRLEVVSDLLQMLKEQLGHSHEEYLEFIVILLVGVE 441

Query: 572 VLFSVAEI 579
           V+ SV  I
Sbjct: 442 VIISVVNI 449

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (46%), Gaps = 11/109 (10%)

Query: 129 KMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAASLNATGKRSQGRRGRKLS- 187
           K +     RTS+T+QKL L+PEE   R+  +     +   + +N    +   R   KL  
Sbjct: 90  KQIRTGAQRTSRTAQKLKLLPEEPFQRDEESLDLRDRDVYSQVNRITDKPARRDAEKLGK 149

Query: 188 -------RITAYNVAEGFNLEYMADFLKAT---HEVSPRVYDECLYVAY 226
                  R TAY  A G+++  +  +LK     H   P+++DEC+Y  +
Sbjct: 150 SHRHLLPRATAYCTASGYSMRELVRWLKECKKIHHTHPKLFDECIYTPF 198

>KNAG0K01490 Chr11 (310336..311553) [1218 bp, 405 aa] {ON} Anc_3.209
           YDL001W
          Length = 405

 Score =  167 bits (424), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 150/242 (61%), Gaps = 10/242 (4%)

Query: 349 NDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHFD 408
           N SD+  ++F+F YGV+V W FTE +EK  L DI   + + L      + D++ E+F++ 
Sbjct: 173 NVSDKQPDLFVFEYGVVVMWGFTEREEKAFLSDIDRFEKEKLA-----DEDVQVEEFNY- 226

Query: 409 YDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFESRITPILTSATKLPKRL 467
           Y     +PRI+ND +TLR G +++++L+++HAIAQS K+S FE  +   +     +P+ +
Sbjct: 227 YVTQSYQPRIYNDFITLRDGSNYMVKLSIAHAIAQSVKISFFEELVDNTIEDTQDIPQEI 286

Query: 468 ALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMREYLEI 527
           AL G + M +E+++K  G+LF LR+++NL  S+LD+PE  WS EP L P+Y A R YLEI
Sbjct: 287 ALSGKVSMTKEEIMKSIGELFILRININLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEI 345

Query: 528 DQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRYVMIR 587
           +QRV ++N R +V  +   +  + +   +   +   FI +I++GV   ++ + V   +I 
Sbjct: 346 NQRVALLNQRLEVISDLLQMLKEQLGHSHEEYLE--FIVIILVGVEVVISLVNVFSDIIA 403

Query: 588 NR 589
           NR
Sbjct: 404 NR 405

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/148 (28%), Positives = 59/148 (39%), Gaps = 23/148 (15%)

Query: 127 YTKMLNPLPSRTSKTSQKLVLIPEEVAGR-ESSTTGYGPKRAAASLNAT----------- 174
           Y    N  P RTS+T+QKL L+PEE   R  SS TG      A++L              
Sbjct: 24  YVPGRNVGPQRTSRTAQKLKLLPEEPFQRGNSSDTGTRTGGGASTLTPVDRDVYSQVDRI 83

Query: 175 ----GKRSQGRRGRK----LSRITAYNVAEGFNLEYMADFL---KATHEVSPRVYDECLY 223
                +R   + G+     L R TAY  A  +N+  +  +    K  H    R++DECLY
Sbjct: 84  LDKPARRDAEKLGKAHRHLLPRCTAYCTASSYNMRELIRWFKDSKKVHHTHARLFDECLY 143

Query: 224 VAYTLPLLLGKDGFRVRSNVSKKVLGGK 251
             +      G   F     +     GG+
Sbjct: 144 TPFMYTDWRGDKRFEHEDVIRLDAEGGE 171

>NDAI0A07350 Chr1 complement(1671549..1673117) [1569 bp, 522 aa]
           {ON} Anc_3.209
          Length = 522

 Score =  169 bits (429), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 93/267 (34%), Positives = 150/267 (56%), Gaps = 28/267 (10%)

Query: 336 FNFDSSSKNDDVGNDSDQHAEI--------------------FIFRYGVIVFWNFTEIQE 375
           F  D  S++D+   D + H ++                    FIF YGVIV W FTE +E
Sbjct: 255 FQDDEGSQDDEGSQDDEDHGDVIRLDDEGGEISVSDKRYPDLFIFEYGVIVMWGFTEREE 314

Query: 376 KNILGDIAFADFKNLVIRPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSG-DHIIEL 434
           K  L D+   + + L      E DI+ E+F++   K  + PRI+ND +TLR G +++ +L
Sbjct: 315 KRFLNDLEKFEKEKLA-----EEDIQIEEFNYYVTKSYQ-PRIYNDFITLRDGSNYMTKL 368

Query: 435 TLSHAIAQSSKLSRFESRITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDV 494
           ++SHAIAQS K+S FE  +   +     +P+ +A  G + M +E+++K  G+LF LR+++
Sbjct: 369 SISHAIAQSVKISLFEELVDNTIEDTQDIPQEIASSGKVSMTKEEIMKSIGELFILRINI 428

Query: 495 NLSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAE 554
           NL  S+LD+PE  WS EP L P+Y A R YLEI+QRV ++N R +V  +   +  + +  
Sbjct: 429 NLHGSVLDSPEIMWS-EPQLEPIYQATRGYLEINQRVALLNQRLEVISDLLQMLKEQLGH 487

Query: 555 RNMARVTWWFIFVIVLGVLFSVAEILV 581
            +   + +  IF++ + V+ S+  I V
Sbjct: 488 SHEEYLEFIVIFLVAVEVIISLVNIAV 514

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 50/126 (39%), Gaps = 35/126 (27%)

Query: 137 RTSKTSQKLVLIPEE------VAGRESSTTGYGPKRAAASLNATGKRSQG---------- 180
           R+S+TSQKL L+P+E       +G  +S    G        N TG+   G          
Sbjct: 106 RSSRTSQKLKLLPDEPFLDYDNSGNRASGNDVGGYITGIVNNKTGRNRVGGNEEVYSQVN 165

Query: 181 ----RRGRK------------LSRITAYNVAEGFNLEYMADFLK---ATHEVSPRVYDEC 221
               +  RK            L R T Y  A  +N+  +  +L+     +   P+++DEC
Sbjct: 166 KIMDKPARKDAEKLGKAHRHLLPRTTGYCTASSYNMRELIRWLRDFSGVYHTHPKLFDEC 225

Query: 222 LYVAYT 227
           LY  + 
Sbjct: 226 LYTPFV 231

>KLLA0E17381g Chr5 complement(1540387..1541721) [1335 bp, 444 aa]
           {ON} similar to uniprot|Q05210 Saccharomyces cerevisiae
           YDL001W RMD1 Cytoplasmic protein required for
           sporulation
          Length = 444

 Score =  164 bits (415), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 88/222 (39%), Positives = 136/222 (61%), Gaps = 11/222 (4%)

Query: 336 FNFDSSSKNDDVGND---SDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVI 392
           F  +   + DD G +   SD+  ++FIF YGVIV W FTE +EK  L D+   + + L  
Sbjct: 195 FEHEDVIRLDDEGGEISTSDKQPDLFIFEYGVIVMWGFTEREEKAFLRDLERFEKEKLA- 253

Query: 393 RPLDEHDIEREQFHFDYDKDIERPRIFNDIVTLRSG-DHIIELTLSHAIAQSSKLSRFES 451
               E D++ EQF++ Y     +PRI+ND +TLR G +++I+L++SHAIAQS K+S FE 
Sbjct: 254 ----EEDVQVEQFNY-YITQSYQPRIYNDFITLRDGSNYMIKLSISHAIAQSVKISLFEE 308

Query: 452 RITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFE 511
            +   +     +P+ +A  G + M +E ++K  G+LF LR+++NL  S+LD+PE  WS E
Sbjct: 309 LVDNTIEDTQDIPQEIASSGKVSMSKEDIMKSIGELFILRININLHGSVLDSPEIMWS-E 367

Query: 512 PSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVA 553
           P L P+Y A R YLEI+QRV ++N R +V  +   +  + + 
Sbjct: 368 PQLEPIYQATRGYLEINQRVALVNQRLEVISDLLQMLKEQLG 409

 Score = 47.4 bits (111), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 54/117 (46%), Gaps = 14/117 (11%)

Query: 121 PLRPLSYTKMLNPLPSRTSKTSQKLVLIPEEVAGRESSTTGYGPKRAAASLNATGKRSQG 180
           PL P   TK+    P RTS+ +QKL L+P+E   R +       +   + +N    +   
Sbjct: 71  PLLPKVSTKVG---PQRTSRKAQKLKLLPDEAFERINEDDAPQDRDVYSQVNRITDKPAR 127

Query: 181 RRGRKLS--------RITAYNVAEGFNLEYMADFLKAT---HEVSPRVYDECLYVAY 226
           R   KL         R+TAY  A  + ++ +  +LK     +   P+++DECLY  +
Sbjct: 128 RDAEKLGKNQRHLLPRVTAYCTASLYKMKELIRWLKDCKRFNHTHPKLFDECLYTPF 184

>Skud_4.545 Chr4 complement(966078..967319) [1242 bp, 413 aa] {ON}
           YDR282C (REAL)
          Length = 413

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 64/257 (24%), Positives = 116/257 (45%), Gaps = 28/257 (10%)

Query: 350 DSDQHAEIFIF-RYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHF- 407
           D+    ++ I  + G IV W F E   +N +  +     K   I PL E D E E   + 
Sbjct: 147 DNGTKGDLMILGQNGSIVGWGFGESTVRNKIVPLV----KAASINPLSEEDFETEDMDYV 202

Query: 408 --DYDKDIERPRIFNDIVTLR-------SGDHII------------ELTLSHAIAQSSKL 446
             +  KD+E+    N  VTL+       SGD I+            +   S  +++S+ L
Sbjct: 203 ELEKKKDLEKLFSGNKNVTLKTVDQSFLSGDLILINSLDSDQGMLDKAAFSSGLSRSTNL 262

Query: 447 SRFESRITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEF 506
           +  E  +   ++    + + ++   TL +K    LK  G+LF +R  +NL S +++TP+ 
Sbjct: 263 AVLEEAMERHISKTRTITENISKGTTLKLKSSDALKSIGRLFLIRGKLNLYSELIETPDL 322

Query: 507 FWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIF 566
           +WS EP L  ++  +  YL+I  R+ ++N +     +     +  + ER    + W  I+
Sbjct: 323 YWS-EPQLELIFKNVSRYLDIVPRINILNSKLDYSTDECRALISLLNERKGTFLEWIIIY 381

Query: 567 VIVLGVLFSVAEILVRY 583
           +I   + F +  +  RY
Sbjct: 382 LIAFELCFELFHLYQRY 398

>YDR282C Chr4 complement(1023511..1024755) [1245 bp, 414 aa] {ON}
           Putative protein of unknown function
          Length = 414

 Score = 79.3 bits (194), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/260 (23%), Positives = 117/260 (45%), Gaps = 30/260 (11%)

Query: 346 DVGNDSDQHAEIFIFRYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIEREQF 405
           D GN  D    + + + G IV W F+E   +N +  I     K   + PL+  D E E  
Sbjct: 147 DNGNKGDV---MILGQNGSIVSWGFSESSVRNCIVPIV----KAASLNPLNGEDFETEDM 199

Query: 406 HF---DYDKDIERPRIFNDIVTLR-------SGDHII------------ELTLSHAIAQS 443
            +   + ++D ++    ++ VT R       SGD II            +   S  +++S
Sbjct: 200 DYVEIEGEQDFDKLSSLDNKVTPRIACESFLSGDLIIINSLDSDQGMLDKAAFSSGLSRS 259

Query: 444 SKLSRFESRITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDT 503
           + L+  E  +   ++    + + ++    L ++    LK  G+LF +R  +NL S +++T
Sbjct: 260 TNLAVLEEAMEKHISKTRTITENISKGTKLNLRSSDALKSIGRLFLIRGKLNLYSELIET 319

Query: 504 PEFFWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWW 563
           P+ +WS EP L  ++  +  YL+I  R+ ++N +     +     +  + ERN   + W 
Sbjct: 320 PDLYWS-EPQLEEIFKNVSRYLDIGPRINILNSKLDYSTDECRALISLLNERNSTFLEWI 378

Query: 564 FIFVIVLGVLFSVAEILVRY 583
            I++I   + F +     +Y
Sbjct: 379 IIYLIAFELCFEIYHFYQKY 398

>Suva_2.448 Chr2 complement(788042..789295) [1254 bp, 417 aa] {ON}
           YDR282C (REAL)
          Length = 417

 Score = 78.6 bits (192), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 63/261 (24%), Positives = 114/261 (43%), Gaps = 32/261 (12%)

Query: 350 DSDQHAEIFIF-RYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHF- 407
           D+    +I I  + G IV W F E    + + D      +   I PL + D E E   + 
Sbjct: 147 DNGVKGDIMILGQNGSIVSWGFGE----STVRDKIVPLVEGASINPLAKEDFETEDMDYV 202

Query: 408 --DYDKDIER---------PRIFNDIVTLRSGDHII------------ELTLSHAIAQSS 444
                +D+E+         PR  N+  +  SGD I+            +   S  +++S+
Sbjct: 203 ELAKKQDLEKFFSGNNEVKPRFVNE--SFLSGDLILINSLDADQGMLDKAAFSSGLSRST 260

Query: 445 KLSRFESRITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTP 504
            L+  E  +   ++    + + ++    L +K    LK  G+LF +R  +NL S + +TP
Sbjct: 261 NLAVLEEALEKHISKTRTITENISKGTKLNLKSSDALKSIGRLFLIRGKLNLYSELTETP 320

Query: 505 EFFWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWF 564
           + +WS EP L  ++  +  YL+I  R+ ++N +     +     +  + ERN A + W  
Sbjct: 321 DLYWS-EPQLEEIFKKVSRYLDIGPRINILNSKLDYSTDECRALISLLNERNGAFLEWII 379

Query: 565 IFVIVLGVLFSVAEILVRYVM 585
           I++I   + F V     RY +
Sbjct: 380 IYLIAFELCFEVYHFYQRYYL 400

>Ecym_4743 Chr4 complement(1450271..1451371) [1101 bp, 366 aa] {ON}
           similar to Ashbya gossypii AAL122C
          Length = 366

 Score = 72.8 bits (177), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/258 (24%), Positives = 112/258 (43%), Gaps = 26/258 (10%)

Query: 349 NDSDQHAEIFIFRYGVIVFWNFTEI-QEKNILGDIAFADFKNLVIRPLDEHDIEREQFHF 407
           +D  Q   + I + G +V W   E  Q +NIL  +  A      I PL E   E E   +
Sbjct: 104 HDGHQGDVMIIRQNGTVVAWGLDESSQMENILPLVDEAR-----INPLKEKQYESEDLDY 158

Query: 408 DYDKDIERPRIFNDIV-------TLRSGDHII------------ELTLSHAIAQSSKLSR 448
                 E     +DI        +   GD I+            +  LS  +++S++LS 
Sbjct: 159 VELDTTESWTQLHDITNRGEANESFVEGDLIVINSISANHGMLDKAALSGGLSRSTRLSV 218

Query: 449 FESRITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFW 508
            E+ +   +    K  + L+    L      +L+ +G+LF +R ++NL S +++TP+ +W
Sbjct: 219 LEAALESHIAKTKKFTELLSSGKKLNFTENHILESTGRLFLIRGNLNLYSELIETPDLYW 278

Query: 509 SFEPSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVI 568
           S EP L  LY  +   L+I  R+ ++N +     +     +  + E+   ++ W  I++I
Sbjct: 279 S-EPDLEKLYEKISRNLDIQPRITILNKKLDYATDESRALLSVLNEKKSTKLEWIIIWLI 337

Query: 569 VLGVLFSVAEILVRYVMI 586
            + V F +     +Y  I
Sbjct: 338 SVEVCFELFHFYEKYKTI 355

>SAKL0G10582g Chr7 (900403..901554) [1152 bp, 383 aa] {ON} similar
           to uniprot|Q05648 Saccharomyces cerevisiae YDR282C
           Hypothetical ORF
          Length = 383

 Score = 72.4 bits (176), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 56/237 (23%), Positives = 110/237 (46%), Gaps = 15/237 (6%)

Query: 363 GVIVFWNFTE-IQEKNILGDIAFADFKNLVIRPLD---------EHDIEREQFHFDYDKD 412
           G +V W F E    +NIL  I+ A    L  +  +         E+ IE EQ      K 
Sbjct: 146 GSVVSWGFDETCLTENILPLISPARVNPLAPKQFESEDMDYVELENSIELEQLKSVTHKI 205

Query: 413 IERPRIFNDIVTLRSGDH----IIELTLSHAIAQSSKLSRFESRITPILTSATKLPKRLA 468
            +   I  D++ + S D     + +   S  +++S++L+  E  +   +    +  + L+
Sbjct: 206 DDGSFIEGDLIVINSTDSEQGLLDKAAFSSGMSRSTRLAVLEGALETHIEKTREFTELLS 265

Query: 469 LFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMREYLEID 528
           +   L +    +LK +G+LF +R  +NL S +++TP+ +WS EP L  +Y  + + L+I 
Sbjct: 266 VGKKLNLTESDVLKYTGRLFLMRGKLNLYSELIETPDLYWS-EPRLEKIYKQISKNLDIH 324

Query: 529 QRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRYVM 585
            R+ ++N +     +     +  + E+   R+ W  I++I + V F +     +Y +
Sbjct: 325 PRITILNTKLDYATDESRALMAVLNEKKSTRLEWIIIYLITIEVCFELYHFYEKYYL 381

>KLTH0G06622g Chr7 (527870..529048) [1179 bp, 392 aa] {ON} similar
           to uniprot|Q05648 Saccharomyces cerevisiae YDR282C
           Hypothetical ORF
          Length = 392

 Score = 72.0 bits (175), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 59/250 (23%), Positives = 113/250 (45%), Gaps = 26/250 (10%)

Query: 354 HAEIFIF-RYGVIVFWNFTE-IQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHF---D 408
           H++I +    G +V W   E    +NIL  I         + PL E  +E E   F   +
Sbjct: 136 HSDIMVLGNSGTVVAWGLEESFVFENILPLIEHGR-----VNPLTEECVESEDLDFLQVE 190

Query: 409 YDKDIERPR-----------IFNDIVTLRSGDHIIEL----TLSHAIAQSSKLSRFESRI 453
             +D+E+ R           +  D++ + + D  + L      S  +++S++L+  E  +
Sbjct: 191 NAEDLEKVRQITNRSAPESFVEGDLIIVNAIDSDLGLLDKAAFSSGMSRSTRLAVLEHLL 250

Query: 454 TPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPS 513
              +  + K  + L+    L +   ++L+ +G LF +R  +NL S +++TP+ +WS EP 
Sbjct: 251 EAHIEKSRKFTELLSQGKKLSLTESEVLQSTGSLFLIRGKLNLYSELIETPDLYWS-EPQ 309

Query: 514 LHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVL 573
           L  +Y  M   L+I  R+ ++N +     E     +  + E+    + W  I++I + V 
Sbjct: 310 LERIYKQMSRSLDIQPRISILNTKLDYATEESRAFMAVLNEKKSTHLEWIIIYLITVEVF 369

Query: 574 FSVAEILVRY 583
           F +     RY
Sbjct: 370 FELHHYYERY 379

>Kwal_23.5643 s23 complement(1249364..1250488) [1125 bp, 374 aa]
           {ON} YDR282C - Hypothetical ORF [contig 11] FULL
          Length = 374

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/242 (25%), Positives = 108/242 (44%), Gaps = 25/242 (10%)

Query: 363 GVIVFWNFTE-IQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHF---DYDKDIERPR- 417
           G +V W   E    +NIL  I  A      I PL E+ +E E   +   +  +D+ER R 
Sbjct: 132 GTVVSWGIDESFTLENILPLIQSAR-----INPLAENAMESEDLDYLEIESIEDLERVRH 186

Query: 418 ----------IFNDIVTLRSGDHIIEL----TLSHAIAQSSKLSRFESRITPILTSATKL 463
                     +  D++ + S D  + L      S  I++S++L+  E  +   +    K 
Sbjct: 187 TLSRSVDGSFVEGDLIVVNSIDPELGLLDKAAFSSGISRSTRLAILEELLEAHIEKTRKF 246

Query: 464 PKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMRE 523
            + L+    L +    +L+ +G LF +R  +NL S + +TP+ +WS EP L  +Y  M  
Sbjct: 247 TENLSDGKRLNLTESMVLRSTGSLFLIRGKLNLYSELTETPDLYWS-EPQLERIYKQMSR 305

Query: 524 YLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRY 583
            L+I  R+ ++N +     E     +  + E+    + W  I++I + V F +     RY
Sbjct: 306 SLDIQPRIAILNTKLDYATEESRAFMAVLNEKKGTHLEWIIIYLITVEVCFELHHYYERY 365

Query: 584 VM 585
            +
Sbjct: 366 WL 367

>KLLA0C11165g Chr3 complement(957421..958491) [1071 bp, 356 aa] {ON}
           similar to uniprot|Q05648 Saccharomyces cerevisiae
           YDR282C Hypothetical ORF
          Length = 356

 Score = 69.7 bits (169), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/234 (22%), Positives = 110/234 (47%), Gaps = 14/234 (5%)

Query: 363 GVIVFWNFTE-IQEKNILGDIAFADFKNLV-----IRPLDEHDIEREQFHFDYDKDI--- 413
           G IV W F E +    IL  ++ A   +L+        LD  ++E E    +  +D    
Sbjct: 107 GSIVSWGFNETVMRDEILPLVSTARVNSLLDSQYESEDLDYVELENEDDMNNLKRDYSIN 166

Query: 414 ERPRIFNDIVTLRSGDH----IIELTLSHAIAQSSKLSRFESRITPILTSATKLPKRLAL 469
           +   + N+++ +   +H    + +   S  I++S++L+  E  +   +    +  + L+ 
Sbjct: 167 DESCVTNELIIINGVEHEKALLDKAAFSSGISRSTRLAVLEVALDAHIEKTREFTESLSR 226

Query: 470 FGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQ 529
              L +  + +L+ +G+LF +R  +NL S +++TP+ +WS EP L  LY  +   L+I  
Sbjct: 227 GKKLNISEKAVLQSTGRLFLMRGKLNLYSELIETPDLYWS-EPQLEKLYRQISRNLDIQP 285

Query: 530 RVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRY 583
           R+ ++N +     +     +  + E+   R+ W  I++I + V F +     +Y
Sbjct: 286 RISILNTKLDYATDEARALMAVLNEKKGTRLEWIIIYLITVEVCFELYHFYEKY 339

>Smik_4.531 Chr4 complement(955033..956277) [1245 bp, 414 aa] {ON}
           YDR282C (REAL)
          Length = 414

 Score = 69.3 bits (168), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 56/250 (22%), Positives = 110/250 (44%), Gaps = 28/250 (11%)

Query: 350 DSDQHAEIFIF-RYGVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHF- 407
           D+    +I I  + G IV W F E   +N +  +  A      I PL   + E E   + 
Sbjct: 147 DNGNKGDIMILGQNGSIVSWGFDESSVRNKIVPLIEA----ASINPLSAQNFETEDMDYV 202

Query: 408 DYDKDIERPRIFN-----------------DIVTLRSGDH----IIELTLSHAIAQSSKL 446
           + +K+ +  + FN                 D++ + S D     + +   S  +++S+ L
Sbjct: 203 ELEKNQDLEKYFNRNSKLTPKNADQSFLCGDLILINSLDSDQGMLDKAAFSSGLSRSTNL 262

Query: 447 SRFESRITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEF 506
           +  E  +   +     + + ++    L +K    LK  G+LF +R  +NL S +++TP+ 
Sbjct: 263 AVLEEAMEKHILKTRTITENISRGTKLNLKSSDALKSIGRLFLIRGKLNLYSELIETPDL 322

Query: 507 FWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIF 566
           +WS EP L  ++  +  YL+I  R+ ++N +     +     +  + ERN   + W  I+
Sbjct: 323 YWS-EPQLEEIFKNVSRYLDIAPRINILNSKLDYSTDECRALISLLNERNSTFLEWIIIY 381

Query: 567 VIVLGVLFSV 576
           +I   + F +
Sbjct: 382 LIAFELCFEI 391

>AAL122C Chr1 complement(132431..133531) [1101 bp, 366 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR282C
          Length = 366

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 88/175 (50%), Gaps = 5/175 (2%)

Query: 413 IERPRIFNDIVTL--RSGDH--IIELTLSHAIAQSSKLSRFESRITPILTSATKLPKRLA 468
           +E+  I  D++ +   SGD   + +   S  I++S+ L+  E  +   + S     + L+
Sbjct: 180 LEQSFIKEDLIVVDRTSGDKDMLDKAAFSSGISRSTMLAVLERNMEAHIESTRSFTELLS 239

Query: 469 LFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMREYLEID 528
               L +   ++LK +G+LF +R  +NL S +++TP+ +WS EP+L  +Y  +   L++ 
Sbjct: 240 KGNRLNITEAEILKSTGRLFLMRGKLNLYSELIETPDLYWS-EPTLETIYKQVSRNLDVP 298

Query: 529 QRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRY 583
            R+ ++N +     +     +  + E+   R+ W  I++I + V F +     R+
Sbjct: 299 ARISILNKKLDYATDESRALMSVLNEKKSTRLEWIIIYLITVEVCFELHHFYERF 353

>TPHA0D01710 Chr4 complement(356399..357559) [1161 bp, 386 aa] {ON}
           Anc_5.291 YDR282C
          Length = 386

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 51/208 (24%), Positives = 97/208 (46%), Gaps = 17/208 (8%)

Query: 392 IRPLDEHDIEREQFHF-------DYDKDIER-----PRIFNDIVTLRSGDHIIEL----T 435
           I PLDE   E E   F          K++E        I +D++ + S D  + L     
Sbjct: 171 INPLDESKYETEDIDFIEIENSKALSKNMESHLHNGSYIMDDLLIVNSIDPELGLLDKAA 230

Query: 436 LSHAIAQSSKLSRFESRITPILTSATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVN 495
            S  IA+S+ L+  E+ +      +  + ++ +    + +K +  L   GKLF +R  +N
Sbjct: 231 FSSGIARSTSLAVLEAALEEHTQKSRIITEKFSRGIQINLKEKHFLTSIGKLFLIRGRLN 290

Query: 496 LSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAER 555
           L S+I++TP+ +WS EP L  +Y  +  +L+I  R+ ++N +     +   + +  + E+
Sbjct: 291 LYSNIIETPDLYWS-EPRLEKIYKNVSHFLDIAPRINILNSKLDYCTDHSRMLLSVLNEK 349

Query: 556 NMARVTWWFIFVIVLGVLFSVAEILVRY 583
               + W  I++I + V F +    V +
Sbjct: 350 KGTFLEWIIIYLITVEVCFELHHYWVSF 377

>Kpol_1033.6 s1033 complement(11719..12930) [1212 bp, 403 aa] {ON}
           complement(11719..12930) [1212 nt, 404 aa]
          Length = 403

 Score = 67.0 bits (162), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 55/232 (23%), Positives = 101/232 (43%), Gaps = 23/232 (9%)

Query: 363 GVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHF-DYDKDIERPR---- 417
           G +V W F E    N L +      ++ +I PL     E E   F + D + E       
Sbjct: 154 GSVVSWGFDE----NTLTNNILPLIESAIINPLVPDKYESEDLDFIELDNEDETTLKLLP 209

Query: 418 ---------IFNDIVTLRSGDHIIEL----TLSHAIAQSSKLSRFESRITPILTSATKLP 464
                    I  D++ + S D    L      S  I++S+ L+  ES +   +  +  + 
Sbjct: 210 SGDANEASFIAEDVIVINSIDQTSGLLDKAAFSSGISRSTSLAVLESALEEHINRSRIIT 269

Query: 465 KRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMREY 524
           + ++    + +     LK  G+LF +R  +NL S I++TP+ +WS EP L  +Y  + +Y
Sbjct: 270 ESVSNGKKMNLNERDFLKSIGRLFLIRGKLNLYSEIIETPDLYWS-EPQLEKIYKNVSKY 328

Query: 525 LEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSV 576
           L++  R+ ++N +     +     +  + ER    + W  I++I   V F +
Sbjct: 329 LDVVPRINILNSKLDYSTDESRALLAVLNERKSTFLEWIIIYLIAFEVCFEL 380

>ZYRO0G16478g Chr7 complement(1349497..1350702) [1206 bp, 401 aa]
           {ON} similar to uniprot|Q05648 Saccharomyces cerevisiae
           YDR282C Hypothetical ORF
          Length = 401

 Score = 66.6 bits (161), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 54/244 (22%), Positives = 108/244 (44%), Gaps = 28/244 (11%)

Query: 363 GVIVFWNFTEIQ-EKNILG------------------DIAFADFKNLVIRPLDEHDIERE 403
           G I+ W F E    +NIL                   D+ + + +N     L    ++ E
Sbjct: 147 GSIICWGFDEATVNQNILKLVEDARTNPLNPDEFESEDMDYVELEN----KLQLESVQLE 202

Query: 404 QFHFDYDKDIERPRIFNDIVTLRSGD----HIIELTLSHAIAQSSKLSRFESRITPILTS 459
             +    K +E   +  D++ + S D     + +   S   ++S+KL+  E+ +   +  
Sbjct: 203 SANHAAVKYLETSLLVGDLILINSTDPGAGLLHKAAFSSGFSRSTKLAVLENAMERHIVE 262

Query: 460 ATKLPKRLALFGTLGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYI 519
              + ++++    L +KR   LK  G+LF +R  +NL S +++TP+ +WS EP L  ++ 
Sbjct: 263 TRIITEKVSKGVRLNLKRGDALKSIGRLFLIRGKLNLYSELIETPDLYWS-EPQLEKIFK 321

Query: 520 AMREYLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEI 579
              +YL+I  R+ ++N +     E     +  ++E+N   +    I++I   + F +   
Sbjct: 322 ETSKYLDIGPRINILNSKLDYSTEETRALMGVLSEKNSTVLELIIIYLIAFELCFELYHF 381

Query: 580 LVRY 583
             RY
Sbjct: 382 YERY 385

>CAGL0H01045g Chr8 complement(98818..99903) [1086 bp, 361 aa] {ON}
           similar to uniprot|Q05648 Saccharomyces cerevisiae
           YDR282c
          Length = 361

 Score = 64.3 bits (155), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 87/164 (53%), Gaps = 5/164 (3%)

Query: 417 RIFNDIVTLRS---GDHIIE-LTLSHAIAQSSKLSRFESRITPILTSATKLPKRLALFGT 472
           R+  D++ + S    + I++    S  +++S+ L+  E+ +   +++   + ++++    
Sbjct: 182 RLIGDVILINSIEKSEGILDKAAFSSGLSRSTALAVLENAMERHISNTRIITEKISTGIK 241

Query: 473 LGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQ 532
           L +K    LK  G+LF +R  +NL S +++TP+ +WS EP L  ++  +  YL+I  R+ 
Sbjct: 242 LKVKESDALKSIGRLFLIRGRLNLYSELIETPDLYWS-EPELEIIFKDVSRYLDISPRIN 300

Query: 533 VINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSV 576
           ++N +     +     +  + ERN + + W  I++I   V+F +
Sbjct: 301 ILNSKLDYSTDECRAILSLLNERNSSFLEWIIIYLITFEVIFEL 344

>KAFR0E01530 Chr5 complement(309332..310423) [1092 bp, 363 aa] {ON}
           Anc_5.291 YDR282C
          Length = 363

 Score = 64.3 bits (155), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 52/233 (22%), Positives = 106/233 (45%), Gaps = 24/233 (10%)

Query: 363 GVIVFWNFTEIQEKNILGDIAFADFKNLVIRPLDEHDIEREQFHFDYDKDIERPRIFNDI 422
           G  V W      E+N+L        +N  I PL E++ E E   +   +  E      DI
Sbjct: 119 GATVSWGI----EENVLRSEIIPLIENACINPLSENEFEIEDMDYIELRKSEDLSFVQDI 174

Query: 423 V------TLRSGDHII------------ELTLSHAIAQSSKLSRFESRITPILTSATKLP 464
                  +   GD I+            ++  S  +++S+ L+  E+++   +    K+ 
Sbjct: 175 CDREDDNSFLLGDLIMINSVGPLYGVMDKVAFSSGLSRSTMLAVLENKMETHIKETRKVT 234

Query: 465 KRLALFGT-LGMKREQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMRE 523
           ++++   T   MK + +L+  G+LF +R  +NL S +++TP+ +WS E  L  ++  +  
Sbjct: 235 EKISKGVTNTKMKEKDVLRFIGRLFMIRGQLNLYSELIETPDLYWS-ETQLEEIFKKISN 293

Query: 524 YLEIDQRVQVINDRAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSV 576
           YL++  R+ ++N +     E   + +  + ER  + + W  I++I   + F +
Sbjct: 294 YLDMKPRISILNSKLDYSTEECRLLISLLNERKSSFLEWIIIYLIAFELFFEL 346

>TDEL0E03360 Chr5 (635665..636882) [1218 bp, 405 aa] {ON} Anc_5.291
           YDR282C
          Length = 405

 Score = 63.9 bits (154), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/169 (21%), Positives = 85/169 (50%), Gaps = 5/169 (2%)

Query: 421 DIVTLRSGD----HIIELTLSHAIAQSSKLSRFESRITPILTSATKLPKRLALFGTLGMK 476
           D++ + S D     + +   S  +A+S+ L+  E+ +   ++    + ++++    L + 
Sbjct: 228 DLIVINSTDPDSGMLYKAAYSSGLARSTSLAVLENSMEAHISRTRIITEKISRGVKLNLN 287

Query: 477 REQLLKKSGKLFKLRVDVNLSSSILDTPEFFWSFEPSLHPLYIAMREYLEIDQRVQVIND 536
             + L+  G+LF +R  +NL S +++TP+ +WS EP L  ++     YL+I  R+ ++N 
Sbjct: 288 EGEALRSIGRLFLIRGRLNLYSELIETPDLYWS-EPLLERIFKQTSRYLDIGPRINILNT 346

Query: 537 RAKVYLEFFDVCVDSVAERNMARVTWWFIFVIVLGVLFSVAEILVRYVM 585
           +     +     +  ++E+    + W  I++I L ++F +     RY +
Sbjct: 347 KLDYSTDECRALMGVLSEKKGTFLEWIIIYLISLEIIFEIYHFYERYYL 395

>ZYRO0G19426g Chr7 complement(1614527..1619311) [4785 bp, 1594 aa]
           {ON} weakly similar to uniprot|P53094 Saccharomyces
           cerevisiae YGL197W MDS3 Protein with an N-terminal
           kelch- like domain putative negative regulator of early
           meiotic gene expression required with Pmd1p for growth
           under alkaline conditions
          Length = 1594

 Score = 33.1 bits (74), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/31 (48%), Positives = 21/31 (67%)

Query: 133 PLPSRTSKTSQKLVLIPEEVAGRESSTTGYG 163
           PLP  TS  ++ L   P E+AGR++ST+ YG
Sbjct: 838 PLPPATSAPNEPLPPAPYEIAGRQNSTSEYG 868

>YDR120C Chr4 complement(691549..693261) [1713 bp, 570 aa] {ON}
           TRM1tRNA methyltransferase; two forms of the protein are
           made by alternative translation starts; localizes to
           both the nucleus and mitochondrion to produce the
           modified base N2,N2-dimethylguanosine in tRNAs in both
           compartments
          Length = 570

 Score = 31.2 bits (69), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 42/97 (43%), Gaps = 5/97 (5%)

Query: 127 YTKMLNPLPSRT----SKTSQKLVLIPEEVAGRESST-TGYGPKRAAASLNATGKRSQGR 181
           Y K + PL S +     +   K+   P EV    SST T Y   R  +  N    R   R
Sbjct: 288 YKKTVEPLLSLSIDFYVRVFVKVKTSPIEVKNVMSSTMTTYHCSRCGSYHNQPLGRISQR 347

Query: 182 RGRKLSRITAYNVAEGFNLEYMADFLKATHEVSPRVY 218
            GR     T Y+VA+G  ++    F + T+ ++  +Y
Sbjct: 348 EGRNNKTFTKYSVAQGPPVDTKCKFCEGTYHLAGPMY 384

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 60,195,719
Number of extensions: 2681866
Number of successful extensions: 8642
Number of sequences better than 10.0: 68
Number of HSP's gapped: 8685
Number of HSP's successfully gapped: 92
Length of query: 592
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 477
Effective length of database: 40,294,809
Effective search space: 19220623893
Effective search space used: 19220623893
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 69 (31.2 bits)