Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0E09526g3.567ON56053522500.0
TDEL0D063503.567ON56554315580.0
YGL244W (RTF1)3.567ON55853514630.0
SAKL0F00814g3.567ON57448214640.0
Smik_7.173.567ON56553714580.0
KAFR0J028803.567ON55553914520.0
Skud_7.233.567ON56453814470.0
Suva_7.173.567ON56954114350.0
CAGL0H07711g3.567ON56655014200.0
NDAI0I032403.567ON56354314180.0
KLTH0G00726g3.567ON56153714040.0
NCAS0E002603.567ON55853814020.0
TPHA0A060003.567ON54953513950.0
KNAG0I002303.567ON57155513800.0
Kwal_47.192653.567ON56754113790.0
Kpol_507.103.567ON46146213530.0
AFR266W3.567ON56248013311e-178
Ecym_25973.567ON56254913301e-178
KLLA0A00737g3.567ON58232510701e-139
TBLA0E002203.567ON57032410121e-130
TBLA0H026902.579ON496117742.0
Kpol_1007.58.168ON107251714.7
Kpol_1054.581.530ON40164689.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0E09526g
         (560 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {...   871   0.0  
TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa] ...   604   0.0  
YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit ...   568   0.0  
SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar ...   568   0.0  
Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)   566   0.0  
KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {...   563   0.0  
Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)   561   0.0  
Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)   557   0.0  
CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly...   551   0.0  
NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {O...   550   0.0  
KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar ...   545   0.0  
NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567...   544   0.0  
TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa] ...   541   0.0  
KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567...   536   0.0  
Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]...   535   0.0  
Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON} (57107..5...   525   0.0  
AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic ho...   517   e-178
Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {O...   516   e-178
KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar ...   416   e-139
TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567...   394   e-130
TBLA0H02690 Chr8 complement(635310..636800) [1491 bp, 496 aa] {O...    33   2.0  
Kpol_1007.5 s1007 (6709..7899,7949..7957,8000..10018) [3219 bp, ...    32   4.7  
Kpol_1054.58 s1054 (144394..145599) [1206 bp, 401 aa] {ON} (1443...    31   9.4  

>ZYRO0E09526g Chr5 complement(758296..759978) [1683 bp, 560 aa] {ON}
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244W RTF1 Subunit of the RNA polymerase II-associated
           Paf1 complex directly or indirectly regulates
           DNA-binding properties of Spt15p (TATA box-binding
           protein) and relative activities of different TATA
           elements
          Length = 560

 Score =  871 bits (2250), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/535 (82%), Positives = 439/535 (82%)

Query: 26  SSAKRSGKSDRASSKKRRIXXXXXXXXXXXXXXXYNPAASGAGTGDYDDXXXXXXNPFPL 85
           SSAKRSGKSDRASSKKRRI               YNPAASGAGTGDYDD      NPFPL
Sbjct: 26  SSAKRSGKSDRASSKKRRIEVEGGEDDEDEDEDDYNPAASGAGTGDYDDEEEEEENPFPL 85

Query: 86  EGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXXXXXXX 145
           EGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNL            
Sbjct: 86  EGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLKEQQQRSKQQEE 145

Query: 146 XXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPXXXXXXXXXXXXXXXXXXXXX 205
              TRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRP                     
Sbjct: 146 GKKTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPYSDEEEEGEDEGDDYGYEDKK 205

Query: 206 XXXXXXXXXXXPYSRRSRFXXXXXXXXXXXXXLDREANVADFNKAKIGRSFVANFCFYPG 265
                      PYSRRSRF             LDREANVADFNKAKIGRSFVANFCFYPG
Sbjct: 206 YSDEEDEEEYDPYSRRSRFEEDEDEVQWAEEALDREANVADFNKAKIGRSFVANFCFYPG 265

Query: 266 FNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQGKDRKV 325
           FNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQGKDRKV
Sbjct: 266 FNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQGKDRKV 325

Query: 326 FQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQLTNDIV 385
           FQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQLTNDIV
Sbjct: 326 FQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQLTNDIV 385

Query: 386 RNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMSTYEKQHE 445
           RNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMSTYEKQHE
Sbjct: 386 RNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMSTYEKQHE 445

Query: 446 NDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRTKFYYQEIXX 505
           NDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRTKFYYQEI  
Sbjct: 446 NDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRTKFYYQEIQK 505

Query: 506 XXXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSIDI 560
                        QLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSIDI
Sbjct: 506 EENEKAKNDAEQKQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSIDI 560

>TDEL0D06350 Chr4 complement(1140059..1141756) [1698 bp, 565 aa]
           {ON} Anc_3.567 YGL244W
          Length = 565

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/543 (58%), Positives = 376/543 (69%), Gaps = 11/543 (2%)

Query: 26  SSAKRSGKSDRASSKKRRIX---XXXXXXXXXXXXXXYNPAASGAGTGDYDDXXXXXX-- 80
           +SAKR+  SD ASSK+R+I                  YNPAA    +G Y +        
Sbjct: 26  TSAKRNKTSDNASSKRRKIAVEGAEEDEDEDEDEEDDYNPAAVQTESGRYSEEDEEDEEE 85

Query: 81  --NPFPLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXX 138
             NPFPLEGKYKD+ DR +L GLPEMERET+LFERSQIMQKY DR++FR+RG+N+     
Sbjct: 86  EENPFPLEGKYKDDNDRAHLEGLPEMERETLLFERSQIMQKYHDRRLFRERGRNMKEQQK 145

Query: 139 XXXXXXXXXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPXXXXXXXXXXXXXX 198
                     TRSS R+T ATGHSD+KASKLSQLRKQRE+K                   
Sbjct: 146 NRQLREGNK-TRSSARTTHATGHSDLKASKLSQLRKQREQKGHR--ANRDRDFEEEEEEE 202

Query: 199 XXXXXXXXXXXXXXXXXXPYSRRS-RFXXXXXXXXXXXXXLDREANVADFNKAKIGRSFV 257
                             PY+R+S R              LDREA++ DFNK KIGRSFV
Sbjct: 203 EDRYEGSEYEDEDEEDYDPYNRKSHRDARKGRRSGMGRDQLDREADITDFNKIKIGRSFV 262

Query: 258 ANFCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGV 317
           A FCFYPGFND+V+G+YGRVNVG DKRSG+T YRMVKIEKVF QKPYNMG F TNQYFGV
Sbjct: 263 AKFCFYPGFNDVVKGHYGRVNVGVDKRSGQTQYRMVKIEKVFFQKPYNMGNFFTNQYFGV 322

Query: 318 TQGKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLT 377
           TQGKDRKVFQM +FSDG  TQ E++RY+ AL+  HIT PS+YSL+NKAKE+N+FVSQPLT
Sbjct: 323 TQGKDRKVFQMNFFSDGNFTQSEYDRYLRALDGVHITKPSMYSLDNKAKEMNAFVSQPLT 382

Query: 378 EQLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRM 437
           ++LT+DIVRNRM+FNKKLSG NAVLEKTVLKEKL+YA ET N+RDIAKYSSQLR+  KRM
Sbjct: 383 DKLTDDIVRNRMLFNKKLSGSNAVLEKTVLKEKLRYAQETGNDRDIAKYSSQLRNLVKRM 442

Query: 438 STYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRTK 497
           S YEK HE D+ GI KL ALT+KNR+VN+DR++NAE +KKED +FD+KSDPFSRLKTRTK
Sbjct: 443 SAYEKHHETDQSGIKKLGALTSKNRKVNMDRIRNAEHIKKEDVNFDAKSDPFSRLKTRTK 502

Query: 498 FYYQEIXXXXXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFS 557
            YYQEI               QL+E E    R++ ELLS+ F+RLGGL++VIG +   F+
Sbjct: 503 VYYQEIQKEENERAQDIARQKQLDESEEAIARREKELLSSDFKRLGGLERVIGQMQLPFT 562

Query: 558 IDI 560
            D+
Sbjct: 563 FDV 565

>YGL244W Chr7 (41498..43174) [1677 bp, 558 aa] {ON}  RTF1Subunit of
           RNAPII-associated chromatin remodeling Paf1 complex;
           regulates gene expression by directing cotranscriptional
           histone modification, influences transcription and
           chromatin structure through several independent
           functional domains; directly or indirectly regulates
           DNA-binding properties of Spt15p and relative activities
           of different TATA elements; involved in transcription
           elongation as demonstrated by the G-less-based run-on
           (GLRO) assay
          Length = 558

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/535 (54%), Positives = 366/535 (68%), Gaps = 7/535 (1%)

Query: 26  SSAKRSGKSDRASSKKRRIXXXXXXXXXXXXXXXYNPAASGAGTGDYDDXXXXXXNPFPL 85
           +SAKR+  +D++ SKKRRI               YNP +   G  DY        NPFPL
Sbjct: 27  TSAKRAKNNDQSLSKKRRIEVGSVEDDDEEDD--YNPYS--VGNADYGSEEEEEANPFPL 82

Query: 86  EGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXXXXXXX 145
           EGKYKDE+DR++L  LPEMERET+LFERSQIMQKYQ+RK+FR RG+++            
Sbjct: 83  EGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAKNDED 142

Query: 146 XXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPXXXXXXXXXXXXXXXXXXXXX 205
              TR+STRST ATGHSDIKASKLSQL+KQR +K+++                       
Sbjct: 143 SRKTRASTRSTHATGHSDIKASKLSQLKKQRARKNRHYSDNEDEDDEEDYREEDYKDDEG 202

Query: 206 XXXXXXXXXXXPYSRRSRFXXXXXXXXXXXXXL-DREANVADFNKAKIGRSFVANFCFYP 264
                      P+ RR  +               DRE  ++DFNK +IGRSFVA FCFYP
Sbjct: 203 SEYGDDEEYN-PFDRRDTYDKREEVEWAEEEDEQDREPEISDFNKLRIGRSFVAKFCFYP 261

Query: 265 GFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQGKDRK 324
           GF D V+G YGRVNVGTDKR+G+T YRMV+IE+VFLQKPYNMGKF TNQYFGVTQGKDRK
Sbjct: 262 GFEDAVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGVTQGKDRK 321

Query: 325 VFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQLTNDI 384
           VFQM YFSDG   + E++RY+ AL+   +  PS++SL NK KE+  FV+ PLT++ T+++
Sbjct: 322 VFQMNYFSDGLFAEDEYQRYLRALDNSQMIKPSLHSLSNKTKEVMDFVNTPLTDKTTDEV 381

Query: 385 VRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMSTYEKQH 444
           VR+RM FNKKLSG NAVLEKTVL+EKLQYA ET NE+DIAKYS+QLR+FEKRMS YEK H
Sbjct: 382 VRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSVYEKHH 441

Query: 445 ENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDT-SFDSKSDPFSRLKTRTKFYYQEI 503
           END+  I KL  LT+KNR++N+  ++NAE VKKED+ +FDSKSDPFSRLKTRTK YYQEI
Sbjct: 442 ENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDSNNFDSKSDPFSRLKTRTKVYYQEI 501

Query: 504 XXXXXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSI 558
                          +L+ED+   ++++ ELL A+FRRLGGL++++G +D +F +
Sbjct: 502 QKEENAKAKEIAQQEKLQEDKDAKDKREKELLVAQFRRLGGLERMVGELDIKFDL 556

>SAKL0F00814g Chr6 (72843..74567) [1725 bp, 574 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 574

 Score =  568 bits (1464), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/482 (58%), Positives = 344/482 (71%), Gaps = 2/482 (0%)

Query: 81  NPFPLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXX 140
           NPFPLEGKYKDE DR  L  LPEMERE++LFERSQIMQ+YQ+R+  +QR KN+       
Sbjct: 93  NPFPLEGKYKDEQDRTQLESLPEMERESLLFERSQIMQQYQERRFLKQRAKNIRDQQQKR 152

Query: 141 XXXXXXXXTRSSTRSTVATGHSDIKASKLSQLRKQREKK--SQNRPXXXXXXXXXXXXXX 198
                    RSSTR+T ATGHSD+K SKLS+L+KQR KK  + +                
Sbjct: 153 QQQQEGKQVRSSTRTTRATGHSDVKTSKLSELKKQRAKKSGTYDYSEDEEGDGDDHKYDD 212

Query: 199 XXXXXXXXXXXXXXXXXXPYSRRSRFXXXXXXXXXXXXXLDREANVADFNKAKIGRSFVA 258
                               +R                  DR+  +ADFNK KIGRSFVA
Sbjct: 213 YYDEGGEDDDEDDYDPYYRKNRHEEDDDDEEVKWAETEDFDRDTGLADFNKVKIGRSFVA 272

Query: 259 NFCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVT 318
            FCFYPGFN++V+ +YGRVNVG DK +G+T YRMVKIEKVFLQKPYNMGKF TNQYFGVT
Sbjct: 273 KFCFYPGFNELVQNSYGRVNVGIDKHTGQTAYRMVKIEKVFLQKPYNMGKFFTNQYFGVT 332

Query: 319 QGKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTE 378
           QGKDRKVFQM +FSDGAITQ E+ERY+ +LE+  I  PSVY+L NK+KEI+ FVSQP+T 
Sbjct: 333 QGKDRKVFQMNFFSDGAITQVEYERYLKSLEKYGINKPSVYNLNNKSKEISEFVSQPMTS 392

Query: 379 QLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMS 438
           +LT+DIVRNRMVFNKKLSG NAVLEKTVLKEKLQYA ET NERDIAKYSSQL++ EKR+S
Sbjct: 393 KLTDDIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYAKETSNERDIAKYSSQLKNLEKRIS 452

Query: 439 TYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRTKF 498
           +YEK HEND+ GI KL  LT+KNR++NIDR+K+AE V+K+D +FD+KSDPFSRLKTRTK 
Sbjct: 453 SYEKHHENDQAGIKKLGVLTSKNRKLNIDRIKHAELVQKDDVNFDAKSDPFSRLKTRTKI 512

Query: 499 YYQEIXXXXXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSI 558
           YY+E+               QLEED+ T  RK++ELL A+FR LGGL+++IG +D Q ++
Sbjct: 513 YYKEVQQQENEKAKEAARQKQLEEDKGTATRKENELLLAKFRSLGGLEEIIGGIDLQINV 572

Query: 559 DI 560
           ++
Sbjct: 573 NL 574

>Smik_7.17 Chr7 (36297..37994) [1698 bp, 565 aa] {ON} YGL244W (REAL)
          Length = 565

 Score =  566 bits (1458), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/537 (54%), Positives = 363/537 (67%), Gaps = 8/537 (1%)

Query: 26  SSAKRSGKSDRASSKKRRIX---XXXXXXXXXXXXXXYNPAASGAGTGDYDDXXXXXXNP 82
           +SAKR+  +D++ SKKRRI                  YNP +   G   Y        NP
Sbjct: 27  TSAKRAKNNDQSLSKKRRIEVGNAEEDDEEDEDEEDDYNPYS--VGNASYGSEEVEEPNP 84

Query: 83  FPLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXXXX 142
           FPLEGKYK+E+DR++L  LPEMERET+LFERSQIMQKYQ+RK+FR RG+++         
Sbjct: 85  FPLEGKYKNESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAKN 144

Query: 143 XXXXXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPXXXXXXXXXXXXXXXXXX 202
                 TR+STRST ATGHSDIKASKLSQL+KQR +K+++                    
Sbjct: 145 DEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRHYSDNEGEVDDEDEYREDDYK 204

Query: 203 XXXXXXXXXXXXXXPYSRRSRFXX--XXXXXXXXXXXLDREANVADFNKAKIGRSFVANF 260
                         P+ R   +               LDRE  ++DFNK +IGRSFVA F
Sbjct: 205 DDEGSEYGDDEEYNPFDRGDLYDKREEEVEWAEEEDELDREPEISDFNKVRIGRSFVAKF 264

Query: 261 CFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQG 320
           CFYPGF D+V+G YGRVNVGTDKR+G+T YRMV+IE+VFLQKPYNMGKF TNQYFGVTQG
Sbjct: 265 CFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERVFLQKPYNMGKFYTNQYFGVTQG 324

Query: 321 KDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQL 380
           KDRKVFQM YFSDG     E++RY+ AL+   I  PS++SL NK KE+  FV+ PLT++ 
Sbjct: 325 KDRKVFQMNYFSDGLFADDEYQRYLRALDNSQIVKPSLHSLNNKTKEVMDFVNTPLTDKT 384

Query: 381 TNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMSTY 440
           T+++VR+RM FNKKLSG NAVLEKTVL+EKLQYA ET NE+DIAKYS+QLR+FEKRMS Y
Sbjct: 385 TDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSVY 444

Query: 441 EKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDT-SFDSKSDPFSRLKTRTKFY 499
           EK HEND+  I KL  LT+KNR++N+  ++NAE VKKED  +FDSKSDPFSRLKTRTK Y
Sbjct: 445 EKHHENDQSDIKKLGELTSKNRKLNMSNIRNAEHVKKEDVNNFDSKSDPFSRLKTRTKVY 504

Query: 500 YQEIXXXXXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQF 556
           YQEI               +L+ED+   E+++ ELL A+FRRLGGL+++IG +D +F
Sbjct: 505 YQEIQKEENAKAKEIAQQEKLQEDKVAKEKREKELLLAQFRRLGGLERMIGELDIKF 561

>KAFR0J02880 Chr10 complement(547671..549338) [1668 bp, 555 aa] {ON}
           Anc_3.567 YGL244W
          Length = 555

 Score =  563 bits (1452), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/539 (55%), Positives = 375/539 (69%), Gaps = 11/539 (2%)

Query: 26  SSAKRSGKS-DRASSKKRRIXXXXXXXXXXXXXXXYNPAASGAGTG---DYDDXXXXXXN 81
           +++KR+ +S D +++KKRRI               YNPAA   G G   + DD      N
Sbjct: 24  TTSKRTKQSGDSSANKKRRIESDSDEDEDD-----YNPAAIDGGDGAYNENDDEEEYEEN 78

Query: 82  PFPLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXXX 141
           PFPLEGKYK+E DRDYL  LPEMERET+L++RSQ M+KY++R+ F+ R KNL        
Sbjct: 79  PFPLEGKYKNEEDRDYLESLPEMERETVLYDRSQTMRKYRERQFFKDRNKNLKRQKERNE 138

Query: 142 XXXXXXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPXXXXXXXXXXXXXXXXX 201
                  TRSS R+T ATGH+D+KASKLSQL+KQREKK+++R                  
Sbjct: 139 DDEALK-TRSSGRATHATGHTDLKASKLSQLKKQREKKNKSRQYSDYEEEEEEDEEEFED 197

Query: 202 XXXXXXXXXXXXXXXPYSRRSRFXXXXXXXXXXXXXLDREANVADFNKAKIGRSFVANFC 261
                          PY R++ +              DR+  + DFNK +IGRSFVA FC
Sbjct: 198 EYREGSEYEEEEDYNPYERKTAYKDEEDEEVEWAEDTDRDTELNDFNKLRIGRSFVAKFC 257

Query: 262 FYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQGK 321
           FYP F +IV+G YGRVNVG DKR+G+T YRMVKIE++FLQKPY+MGKF TNQYFGVTQGK
Sbjct: 258 FYPDFGEIVKGCYGRVNVGVDKRTGQTSYRMVKIERIFLQKPYSMGKFFTNQYFGVTQGK 317

Query: 322 DRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQLT 381
           DRKVFQM +FSDG IT QE+ERY+ +LE  HI  P+VY+L++K+KE+ SFVS+PLTE+LT
Sbjct: 318 DRKVFQMSFFSDGLITPQEYERYIRSLESSHIPKPTVYTLKSKSKELVSFVSEPLTEKLT 377

Query: 382 NDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMSTYE 441
           N+IVRNRMVFNKKLSG NAVLEKTVLKEKLQYA ET NERD+AKYS+QLR+FEKRM+ YE
Sbjct: 378 NEIVRNRMVFNKKLSGTNAVLEKTVLKEKLQYARETNNERDVAKYSAQLRNFEKRMNMYE 437

Query: 442 KQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRTKFYYQ 501
           K HEND+ G  KL ALT+KN++VN+D+L+NAE VKKED   D KSDPFSRLKTRTK YYQ
Sbjct: 438 KHHENDQTGSKKLGALTSKNKKVNMDKLRNAEHVKKEDLPID-KSDPFSRLKTRTKIYYQ 496

Query: 502 EIXXXXXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSIDI 560
           EI               ++EE+E  T+RK+ ELL A+FRRLGGL+++I  ++ +F + I
Sbjct: 497 EIQKEENERAKALAQQKKMEENEEATKRKEKELLLAQFRRLGGLEKMISGLNIEFDLGI 555

>Skud_7.23 Chr7 (45674..47368) [1695 bp, 564 aa] {ON} YGL244W (REAL)
          Length = 564

 Score =  561 bits (1447), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/538 (53%), Positives = 363/538 (67%), Gaps = 11/538 (2%)

Query: 26  SSAKRSGKSDRASSKKRRIX--XXXXXXXXXXXXXXYNPAASG-AGTGDYDDXXXXXXNP 82
           +SAKR+  +D++ SKKRRI                 YNP + G AG G          NP
Sbjct: 27  TSAKRAKNNDQSVSKKRRIEVDSAEEEDEEDEEEDDYNPYSVGNAGYG----SEGEEANP 82

Query: 83  FPLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXXXX 142
           FPLEGK+KDE DR++L  LPEMERET+LFERSQIMQKYQ+RK+FR RG+++         
Sbjct: 83  FPLEGKFKDENDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGRDMKEQQQRAKD 142

Query: 143 XXXXXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPXXXXXXXXXXXXXXXXXX 202
                 TR+STRST ATGHSDIKASKLSQL+KQR +K++                     
Sbjct: 143 KEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRQYSDNEDEEDDEDEYREDNYK 202

Query: 203 XXXXXXXXXXXXXXPYSRRSRFXX---XXXXXXXXXXXLDREANVADFNKAKIGRSFVAN 259
                         P+ R+  +                LDRE  ++D+NK +IGRSFVA 
Sbjct: 203 NEEESEYEDDEEYNPFDRKDLYDKREEEVEWAEEGEDELDREPEISDYNKLRIGRSFVAK 262

Query: 260 FCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQ 319
           FCFYPGF D+V+G YGRVN+GTDKR+G+T YRMV+IE+VFLQKPY+MGKF TNQYFGVTQ
Sbjct: 263 FCFYPGFEDVVKGCYGRVNIGTDKRTGKTSYRMVRIERVFLQKPYSMGKFYTNQYFGVTQ 322

Query: 320 GKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQ 379
           GKDRKVFQM YFSDG+    E+ RY  AL+  H+  PS++SL NK KE+  FV+ PLT++
Sbjct: 323 GKDRKVFQMNYFSDGSFADDEYRRYFKALDNSHMVKPSLHSLSNKTKEVMDFVNTPLTDK 382

Query: 380 LTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMST 439
            T+++VR+RM FNKKLSG NAVLEKTVL+EKLQYA ET NE+DIAKYS+QLR+FEKRMS 
Sbjct: 383 TTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMSI 442

Query: 440 YEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTS-FDSKSDPFSRLKTRTKF 498
           YEK HEND+  I  L  LT+KNR++N+  ++NAE VKKED S FDSKSDPFSRLKTRTK 
Sbjct: 443 YEKHHENDQSDIKTLGELTSKNRKLNMSNIRNAEHVKKEDNSNFDSKSDPFSRLKTRTKV 502

Query: 499 YYQEIXXXXXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQF 556
           YYQEI               +L+ED+   ++++ ELL A+FRRLGGL+++IG +D +F
Sbjct: 503 YYQEIQKEENAKAKEIAQQEKLQEDKEAKDKREKELLLAQFRRLGGLERMIGELDIKF 560

>Suva_7.17 Chr7 (36045..37754) [1710 bp, 569 aa] {ON} YGL244W (REAL)
          Length = 569

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/541 (54%), Positives = 365/541 (67%), Gaps = 8/541 (1%)

Query: 26  SSAKRSGKSDRASSKKRRIX--XXXXXXXXXXXXXXYNPAASGAGTGDYDDXXXXXXNPF 83
           +SAKR+  +D++ SKKRRI                 YNP + G      ++      NPF
Sbjct: 27  TSAKRAKNNDQSISKKRRIEVGSAEEEEEEDEEEDDYNPYSVGNTGYGSEEEEEVEPNPF 86

Query: 84  PLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXXXX- 142
           PLEGKYKDE+DR++L  LPEMERET+LFERSQIMQKYQ+RK+FR RGK++          
Sbjct: 87  PLEGKYKDESDREHLESLPEMERETLLFERSQIMQKYQERKLFRARGKDMKEQQQRKRAR 146

Query: 143 -XXXXXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPXXXXXXXXXXXXXXXXX 201
                  TR+STRST ATGHSDIKASKLSQL+KQR +K++                    
Sbjct: 147 DDEDSRKTRTSTRSTHATGHSDIKASKLSQLKKQRARKNRQYSDSEDEQDDQEEYREDDY 206

Query: 202 XXXXXXXXXXXXXXXPYSRRSRFXX---XXXXXXXXXXXLDREANVADFNKAKIGRSFVA 258
                          P+ R+  +                LDR+  ++DFNK +IGRSFVA
Sbjct: 207 KNDEGSEYGDDEEYNPFDRKGVYDKREEEVEWAEEEEDELDRDPEISDFNKLRIGRSFVA 266

Query: 259 NFCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVT 318
            FCFYPGF D+V+G YGRVNVGTDKR+G+T YRMV+IE++FLQKPYNMGKF TNQYFGVT
Sbjct: 267 KFCFYPGFEDVVKGCYGRVNVGTDKRTGKTSYRMVRIERIFLQKPYNMGKFFTNQYFGVT 326

Query: 319 QGKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTE 378
           QGKDRKVFQM YFSDG  T  E++RY  AL+  H+  PS+++L NK KE+  FV+ PLT+
Sbjct: 327 QGKDRKVFQMNYFSDGLFTDDEYQRYFKALDGSHMVKPSLHTLSNKTKEVIDFVNTPLTD 386

Query: 379 QLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMS 438
           + T+++VR+RM FNKKLSG NAVLEKTVL+EKLQYA ET NE+DIAKYS+QLR+FEKRMS
Sbjct: 387 KTTDEVVRHRMQFNKKLSGTNAVLEKTVLREKLQYAKETNNEKDIAKYSAQLRNFEKRMS 446

Query: 439 TYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTS-FDSKSDPFSRLKTRTK 497
            YEK HEND+  I  L  LT+KNR++NI  ++NAE VKKEDTS FDSKSDPFSRLKTRTK
Sbjct: 447 VYEKHHENDQSDIKTLGELTSKNRKLNISNIRNAEHVKKEDTSNFDSKSDPFSRLKTRTK 506

Query: 498 FYYQEIXXXXXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFS 557
            YYQEI               +L+ED  + ER++ ELL A+FRRLGGL+++IG +D +F 
Sbjct: 507 VYYQEIQKEENAKAKEMAQQEKLQEDRESKERREKELLLAQFRRLGGLERMIGELDIKFD 566

Query: 558 I 558
            
Sbjct: 567 F 567

>CAGL0H07711g Chr8 (752900..754600) [1701 bp, 566 aa] {ON} highly
           similar to uniprot|P53064 Saccharomyces cerevisiae
           YGL244w RTF1
          Length = 566

 Score =  551 bits (1420), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/550 (54%), Positives = 365/550 (66%), Gaps = 23/550 (4%)

Query: 26  SSAKRSGKSDRASSKKRRIXXXXXXXXXXXXXXXYNPAASGAGTGDYDDXXXXXX--NPF 83
           ++ KR+  S  +  KKRRI               YNP   G    D  D        NPF
Sbjct: 25  TTNKRTKGSSNSQVKKRRIEVDSEDEEDD-----YNPD-DGYEPVDVSDKEEEEEEENPF 78

Query: 84  PLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXXXXX 143
           PLEGKYKD ADRD+L  LPEMERET+LFERSQ+M+KYQ+RK+FR+RG+NL          
Sbjct: 79  PLEGKYKDTADRDHLESLPEMERETILFERSQVMRKYQERKLFRERGRNLKQQKIQAGED 138

Query: 144 XXXXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPXXXXXXXXXXXXXXX---- 199
                TRSS RST ATGHSDIKASKLSQL+KQRE+KS+ R                    
Sbjct: 139 SQK--TRSSNRSTRATGHSDIKASKLSQLKKQRERKSKGRRSSDYEESDEDNYGDEDEFK 196

Query: 200 ----XXXXXXXXXXXXXXXXXPYSRRSRFXXXXXXXXXXXX----XLDREANVADFNKAK 251
                                PY+R+S++                 LDR+A V DFNK +
Sbjct: 197 DDFIEEDSDYKENDDDEEGYDPYARKSKYAQDNDEEEDEEVEWAEQLDRDAEVQDFNKIR 256

Query: 252 IGRSFVANFCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFIT 311
           IGRSFVA +CFYPGFN++++G YGRVNVG DKR+G   YRMVKIEKVFLQKPYNMGKF T
Sbjct: 257 IGRSFVAKYCFYPGFNELIQGCYGRVNVGVDKRTGNAAYRMVKIEKVFLQKPYNMGKFFT 316

Query: 312 NQYFGVTQGKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSF 371
           NQYFGVTQGKDRKVFQM +FSDG   +QEFERY+ AL+  +I  PS Y+++ K KEI+ F
Sbjct: 317 NQYFGVTQGKDRKVFQMNFFSDGPFVEQEFERYLKALDSSNIPKPSPYNIKTKFKEISEF 376

Query: 372 VSQPLTEQLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLR 431
           +SQPLTE+LT++IVRNRMV NKKLSG NAVLEKT+LK+KL+YA E  NE DIAKYS QLR
Sbjct: 377 ISQPLTEKLTDEIVRNRMVLNKKLSGTNAVLEKTILKDKLRYAKENGNEHDIAKYSKQLR 436

Query: 432 SFEKRMSTYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKK-EDTSFDSKSDPFS 490
           +FEKRM+ YEK HEND+  I KL  LT+KNR++N++R++NAE +KK ED +FDSKSDPFS
Sbjct: 437 NFEKRMAMYEKHHENDQADIKKLEGLTSKNRKLNMNRIRNAESIKKEEDVNFDSKSDPFS 496

Query: 491 RLKTRTKFYYQEIXXXXXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGLKQVIG 550
           RLKTRTK YYQEI               QL+ DE T + K+ +L+ A FRRLGGL+++IG
Sbjct: 497 RLKTRTKVYYQEIQKEENEKAKEEAAQEQLKIDEETKKEKEKQLMLAEFRRLGGLQKIIG 556

Query: 551 TVDFQFSIDI 560
           +++    +DI
Sbjct: 557 SINVDIKLDI 566

>NDAI0I03240 Chr9 complement(760626..762317) [1692 bp, 563 aa] {ON}
           Anc_3.567 YGL244W
          Length = 563

 Score =  550 bits (1418), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/543 (51%), Positives = 357/543 (65%), Gaps = 14/543 (2%)

Query: 26  SSAKRSGKSDRASSKKRRIXXXXXXXXXXXXXXXYNPAASGAGTGDYDDXXXXXXNPFPL 85
           +S KR+   D+  SK+++I               YNP     G    ++      NPFPL
Sbjct: 27  TSGKRAKNHDQVGSKRKKIEVDSEAEEEEEDD--YNPY----GGNQSEEEEIDEPNPFPL 80

Query: 86  EGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXXXXXXX 145
           E KYKDE DR++L  LPEMERET+LFERSQ+M+KYQ+RK+FR+R +N+            
Sbjct: 81  ENKYKDEDDREHLESLPEMERETLLFERSQVMRKYQERKLFRERQRNIKEQQERNELEEE 140

Query: 146 XXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPXXXXXXXXXXXXXXXXXXXXX 205
              TRSSTR+T ATGHSD+KASKLSQL+KQRE+K++++                      
Sbjct: 141 GKKTRSSTRATHATGHSDLKASKLSQLKKQRERKTRDQDYNDVEDEDDLDDYAPDDNYKH 200

Query: 206 XXXXXXXXXX------XPYSRRSRFXXXXXXXXXXXXXLDREANVADFNKAKIGRSFVAN 259
                            PY+ R  +              DREA + DFNK K+GRSF+A 
Sbjct: 201 EDSEYEEEGEEDEEDYNPYATRKSYDMDKDEVEWAEEQTDREAELDDFNKVKVGRSFIAK 260

Query: 260 FCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQ 319
           +CFYPGF+D+++G YGRVNVGTD+R+G + YRMVKIEKVFL+ PY MG F TNQY GVTQ
Sbjct: 261 YCFYPGFSDLLKGCYGRVNVGTDRRTGISSYRMVKIEKVFLKGPYRMGDFFTNQYLGVTQ 320

Query: 320 GKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQ 379
           G DRKV QM  FSDG  T  EF+RY  ALE  H+T PS++ L  K+KEI +FVS+PLT +
Sbjct: 321 GHDRKVLQMNIFSDGLFTSAEFDRYTRALENSHLTKPSIHVLRGKSKEIQAFVSEPLTAK 380

Query: 380 LTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMST 439
           +T+ IVRNRM+FNKKLSG NAVLEKTVLK+KL+YA E  NERD+AKYSSQLR+ EKRMS 
Sbjct: 381 MTDAIVRNRMMFNKKLSGTNAVLEKTVLKDKLRYARENNNERDVAKYSSQLRNLEKRMSV 440

Query: 440 YEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRTKFY 499
           YEK HEND++G+NKL ALT+KNR+VN+D+++NAE +KKED   DSKSDPFSRLKTRTK Y
Sbjct: 441 YEKHHENDQLGMNKLGALTSKNRKVNMDKIRNAEHIKKEDHGLDSKSDPFSRLKTRTKIY 500

Query: 500 YQEIXXX--XXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFS 557
           YQE+                 QL+E+++  E K+ ELL ARF+RLGGL+ +I  +D   +
Sbjct: 501 YQEVQKEENEKAQAMAEAKQKQLQENKALNEHKEKELLLARFKRLGGLENLIQNLDINVT 560

Query: 558 IDI 560
            DI
Sbjct: 561 FDI 563

>KLTH0G00726g Chr7 (49910..51595) [1686 bp, 561 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II- associated Paf1
           complex directly or indirectly regulates DNA-binding
           properties of Spt15p (TATA box-binding protein) and
           relative activities of different TATA elements
          Length = 561

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/537 (54%), Positives = 357/537 (66%), Gaps = 6/537 (1%)

Query: 27  SAKRSGKSDRASSKKRRI---XXXXXXXXXXXXXXXYNPAASGAGTGDYDDXXXXXXNPF 83
           S+K+  +SD  SS KRRI                  YNP A+       ++      NPF
Sbjct: 28  SSKKRSRSDHQSSSKRRIVDEDEEQDDDEEEGEEDDYNPEAASYDMDS-EEDEDEEPNPF 86

Query: 84  PLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXXXXX 143
           PLEGKYK+E DR YL  LPEMERETMLFERSQ MQKYQ+R++ ++R KN+          
Sbjct: 87  PLEGKYKNEEDRSYLESLPEMERETMLFERSQTMQKYQERRVLKERAKNIRDQQQKRQLQ 146

Query: 144 XXXXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPXXXXXXXXXXXXXXXXXXX 203
                TRSSTRST  TGHSD+K S+LS+L+KQR KK                        
Sbjct: 147 QEGKKTRSSTRSTRTTGHSDLKESRLSELKKQRAKKKGT--YEYSEEEEEEGQNEEDEYG 204

Query: 204 XXXXXXXXXXXXXPYSRRSRFXXXXXXXXXXXXXLDREANVADFNKAKIGRSFVANFCFY 263
                        P  ++ +              LDRE  + DFN+ KIGRSFVA FCFY
Sbjct: 205 YQDQEDESEDDYEPMYKKGKTEDEEELKWAEDEDLDREPELGDFNRIKIGRSFVAKFCFY 264

Query: 264 PGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQGKDR 323
           P FND+++G YGRVNVG DKRSG+TLYRMVKIEKVFLQKPYNMGKF TNQYFGVTQGK+R
Sbjct: 265 PEFNDMIKGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKNR 324

Query: 324 KVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQLTND 383
           KVFQM +FSDGAITQ EFERY+ +LE   I  PS+Y + NK+ EINSFVSQP+T +LT++
Sbjct: 325 KVFQMNFFSDGAITQPEFERYLRSLETSEINKPSLYIINNKSNEINSFVSQPVTSKLTDE 384

Query: 384 IVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMSTYEKQ 443
           +VRNRM+FNKKLSG NAVLEKT+LK+KLQYA E+ +ERD+AKYSSQLR+ EKR+S+YEK 
Sbjct: 385 LVRNRMIFNKKLSGTNAVLEKTILKDKLQYAKESGSERDVAKYSSQLRNLEKRLSSYEKH 444

Query: 444 HENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRTKFYYQEI 503
           HEND+ G  KL ALT+KNRRVN+D+ KN E  KKEDT FD+K+DPFSRLKTRTK YYQEI
Sbjct: 445 HENDQAGSKKLGALTSKNRRVNLDKGKNVEVTKKEDTPFDAKTDPFSRLKTRTKIYYQEI 504

Query: 504 XXXXXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSIDI 560
                          QL++D+     K+ +LL A+F+ LGGL+ +I  +DFQ S+D+
Sbjct: 505 QREENEKAKELARQEQLQKDDLNLVEKERKLLLAKFKNLGGLEDIISNMDFQVSLDV 561

>NCAS0E00260 Chr5 (38732..40408) [1677 bp, 558 aa] {ON} Anc_3.567
           YGL244W
          Length = 558

 Score =  544 bits (1402), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/538 (54%), Positives = 363/538 (67%), Gaps = 8/538 (1%)

Query: 26  SSAKRSGKSDRASSKKRRIXXXXXXXXXXXXXXXYNPAASGAGTGDYDDXXXXXXNPFPL 85
           +S KR+   + ASSK+++I               Y+P   GAG    +       NPFPL
Sbjct: 26  TSNKRAKNHEHASSKRKKIEVDSEAEEEDD----YDPGNFGAGNISEE-EEEMEQNPFPL 80

Query: 86  EGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXXXXXXX 145
           EGKYKDEADR+ L  LPEMERET+LFERSQ M+KYQ+RK+FR+R +NL            
Sbjct: 81  EGKYKDEADREQLESLPEMERETLLFERSQTMRKYQERKLFRERQRNLKEQQQRNAPSEE 140

Query: 146 XXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNR--PXXXXXXXXXXXXXXXXXXX 203
              TR+STR+T ATGHSD+KASKLSQL+KQRE+K  +R                      
Sbjct: 141 GTKTRTSTRTTHATGHSDLKASKLSQLKKQRERKGLHRRGSDEEGSEFEEEEEEYDEEEY 200

Query: 204 XXXXXXXXXXXXXPYSRRSRFXXXXX-XXXXXXXXLDREANVADFNKAKIGRSFVANFCF 262
                        PY R+ R+               DRE  + DFNK KIGRSFVA +CF
Sbjct: 201 KKDEDSEYEEEYNPYERKGRYSEDKNDEVEWAEEQTDRETELDDFNKVKIGRSFVAKYCF 260

Query: 263 YPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQGKD 322
           YPGFN++++G YG+VNVGTD+R+G T YRMVKIEK+FLQKPY MG+F TNQYFGVTQG +
Sbjct: 261 YPGFNELIKGCYGKVNVGTDRRTGTTSYRMVKIEKIFLQKPYRMGEFFTNQYFGVTQGSN 320

Query: 323 RKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQLTN 382
           RKVFQM +FSDG  T  EFERY+ +L+  HIT PS+Y+L+NKAKEI SF+S+PLTEQL +
Sbjct: 321 RKVFQMNFFSDGLFTPDEFERYVRSLDTSHITKPSIYTLKNKAKEIQSFISEPLTEQLMD 380

Query: 383 DIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMSTYEK 442
            IVRNRM+FNKKLSG NAVLEKTVL++KL+YA E  NERD+AKYSSQLR+ EKR+S YEK
Sbjct: 381 TIVRNRMLFNKKLSGTNAVLEKTVLRDKLRYAQENNNERDVAKYSSQLRNLEKRLSVYEK 440

Query: 443 QHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRTKFYYQE 502
            HEND+VG NKL ALT+KNR+VN+D++KN    KKE+  FDSKSDPFSRLKTRTK YYQE
Sbjct: 441 HHENDQVGSNKLGALTSKNRKVNMDKIKNTGHEKKEEIGFDSKSDPFSRLKTRTKIYYQE 500

Query: 503 IXXXXXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSIDI 560
           +               QL+E+     RK++ELL A+FRRLGGL+ +I +++   + DI
Sbjct: 501 VQQEENEKAKALAAEKQLKENNEAQARKENELLLAKFRRLGGLENMINSLNLDVNFDI 558

>TPHA0A06000 Chr1 complement(1356928..1358577) [1650 bp, 549 aa]
           {ON} Anc_3.567 YGL244W
          Length = 549

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/535 (52%), Positives = 359/535 (67%), Gaps = 14/535 (2%)

Query: 26  SSAKRSGKSDRASSKKRRIXXXXXXXXXXXXXXXYNPAASGAGTGDYDDXXXXXXNPFPL 85
           S++KR   ++ + SKKR I               YNPA+  AG GD DD       PFPL
Sbjct: 27  STSKRGRSNEDSVSKKRHINVGEDDEDD------YNPAS--AGLGDDDDNDDEEEAPFPL 78

Query: 86  EGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXXXXXXX 145
           EGKY+DE DRDYL  LPEMERET+LFERSQ+MQKY+DR +FR+R + L            
Sbjct: 79  EGKYRDERDRDYLESLPEMERETLLFERSQLMQKYKDRMLFRERQRTLKRQRESSENRK- 137

Query: 146 XXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPXXXXXXXXXXXXXXXXXXXXX 205
               RSSTRS+  TGHSD+K+SKLSQL+KQRE+K+ +                       
Sbjct: 138 ---VRSSTRSSKVTGHSDVKSSKLSQLKKQRERKNNHHYSDEDDEDEYEEEENIYEDKYE 194

Query: 206 XXXXXXXXXXXPYSRRSRFXXXXXXXXXXXXX-LDREANVADFNKAKIGRSFVANFCFYP 264
                      PY R+S +               DRE+NV DFNK KIGRSFVA +CFYP
Sbjct: 195 EGSEYEDESYDPYKRKSTYAEESEEEDVKWADDTDRESNVNDFNKIKIGRSFVAKYCFYP 254

Query: 265 GFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQGKDRK 324
           GFNDIV+  YGRVNVG +K + + +YRMVKIEKVFLQKPY+MG F TNQYFGVTQGKDRK
Sbjct: 255 GFNDIVKDCYGRVNVGVNKNTNQVMYRMVKIEKVFLQKPYSMGNFFTNQYFGVTQGKDRK 314

Query: 325 VFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQLTNDI 384
           VFQM++FSDGAITQ E+ERY+ ALE  ++T PS Y+L NK KE++ FV++P+T +LT+++
Sbjct: 315 VFQMKFFSDGAITQDEYERYVRALESSNLTIPSTYALSNKFKEVDEFVNEPMTVKLTDEV 374

Query: 385 VRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMSTYEKQH 444
           VRNRM+FNKKLSG NAVLEKTVL+EKL +A +  +ERDIAKYSSQLR+ EKR+ TYEK H
Sbjct: 375 VRNRMIFNKKLSGTNAVLEKTVLREKLNFAKQNNSERDIAKYSSQLRNLEKRLMTYEKHH 434

Query: 445 ENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKE-DTSFDSKSDPFSRLKTRTKFYYQEI 503
           END+ G  KL  LT+KNR++N+D++K  E VK++ D SFD K+DPFSRLKTRTK YYQEI
Sbjct: 435 ENDQQGAKKLGKLTSKNRKLNMDKIKYGENVKEDRDESFDIKTDPFSRLKTRTKVYYQEI 494

Query: 504 XXXXXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSI 558
                          +++E++   E+K+ ELL A+FRRLGGL+ ++  +D    +
Sbjct: 495 QEEENEKAKELARQKKMQENKEAIEQKERELLLAKFRRLGGLESIVHNLDINIKL 549

>KNAG0I00230 Chr9 (28626..30341) [1716 bp, 571 aa] {ON} Anc_3.567
           YGL244W
          Length = 571

 Score =  536 bits (1380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/555 (52%), Positives = 358/555 (64%), Gaps = 34/555 (6%)

Query: 28  AKRSGKSDRASSKKRRIXXXXXXX-------XXXXXXXXYNPAASGA-GTGDYDDXXXXX 79
           +KRS +SD  +SKKRRI                      YNP   G   TGD D+     
Sbjct: 29  SKRSKQSDATASKKRRIYEGSEEEVYDDEADDVDEEEDDYNPHEVGNYDTGD-DEAENEE 87

Query: 80  XNPFPLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXX 139
            NPFPL+GKYKDE DR+YL  LPE+ERET+LF+RSQ M+KYQ+RK+FR+R +        
Sbjct: 88  QNPFPLQGKYKDEKDREYLESLPEVERETVLFDRSQTMRKYQERKLFRERKR-------- 139

Query: 140 XXXXXXXXXTRSSTRSTVATGHSDIKASKLSQLR--------KQREKKSQNRPXXXXXXX 191
                    TRSS R+  +TGHSD+KASKLSQL+        +QR               
Sbjct: 140 ---QQEAKPTRSSGRTAHSTGHSDLKASKLSQLKRQRDKKLNRQRSDDEYEEDEEEEEED 196

Query: 192 XXXXXXXXXXXXXXXXXXXXXXXXXPYSRRSRFXXXXXXXXXXXXXL---DREANVADFN 248
                                    P + +S++                 DR + +ADFN
Sbjct: 197 DYNGYGDDLNEDAEYQEDEDEEDYNPLAIKSKYDELEEEEDDDVKWAEDNDRVSELADFN 256

Query: 249 KAKIGRSFVANFCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGK 308
           K +IGRSFVA FCFYPGFND+V G YGRVNVG DKRSG+TLYRMVKIEKVFLQKPYNMGK
Sbjct: 257 KLRIGRSFVAKFCFYPGFNDLVNGCYGRVNVGVDKRSGQTLYRMVKIEKVFLQKPYNMGK 316

Query: 309 FITNQYFGVTQGKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEI 368
           F TNQYFGVTQGKDRKVFQM +FSDG  TQ E+ERY+ +LE  +I+ PS + L NK+KEI
Sbjct: 317 FYTNQYFGVTQGKDRKVFQMNFFSDGHFTQNEYERYLRSLETANISRPSAHILSNKSKEI 376

Query: 369 NSFVSQPLTEQLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSS 428
            SF+++PLTE+LT++IVRNRM+FNKKLSG NAVLEKTVL+ KLQYA E+ NERD+AKYS+
Sbjct: 377 VSFITEPLTEKLTDEIVRNRMLFNKKLSGTNAVLEKTVLRSKLQYARESNNERDVAKYSA 436

Query: 429 QLRSFEKRMSTYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTS---FDSK 485
           QLR+FEKRM+ YEK HEND  G  KL ALT+KNR+VN+ + KN +  KKED++    DSK
Sbjct: 437 QLRNFEKRMNNYEKHHENDHTGTKKLGALTSKNRKVNMGKTKNYDHGKKEDSAGPTVDSK 496

Query: 486 SDPFSRLKTRTKFYYQEIXXXXXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGL 545
           SDPFSRLKTRTK YYQE+               ++E+++   ERK+ ELL A+FRRLGGL
Sbjct: 497 SDPFSRLKTRTKIYYQEVQKEENEKAKALAQQKEIEKNKEADERKEKELLLAQFRRLGGL 556

Query: 546 KQVIGTVDFQFSIDI 560
           + +I  ++  F ID+
Sbjct: 557 ENMISKINVNFDIDL 571

>Kwal_47.19265 s47 complement(1162019..1163722) [1704 bp, 567 aa]
           {ON} YGL244W (RTF1) - Nuclear protein [contig 344] FULL
          Length = 567

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/541 (53%), Positives = 358/541 (66%), Gaps = 10/541 (1%)

Query: 27  SAKRSGKSDRASSKKRRIXXXXXXXXXXXXXXXYNPA------ASGAGTGDYDDXXXXXX 80
           S KRS  S  AS+K+R +               YNP       ASGA   +         
Sbjct: 30  SKKRSRSSQNASNKRRIVDEDEEIDEDDDDQDDYNPERGIYGDASGAEDEE---DEEEEE 86

Query: 81  NPFPLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXX 140
           NPFPLEGKYKDE DR+YL  LPEMERET+LF+RSQ MQKY++R++ ++R +N+       
Sbjct: 87  NPFPLEGKYKDERDREYLESLPEMERETLLFDRSQEMQKYRERRVLKERARNIRAQQQKR 146

Query: 141 XXXXXXXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPXXXXXXXXXXXXXXXX 200
                   TRSSTRST  TGHSD+K S+LS+L+KQR KKS                    
Sbjct: 147 QLQQESTKTRSSTRSTRTTGHSDLKESRLSELKKQRAKKSGTYDYSEDEDDGGRDEEDDY 206

Query: 201 XXXXXXXXXXXXXXXXPYSRRSRFXXXXXXXXXXXXX-LDREANVADFNKAKIGRSFVAN 259
                           P  ++ +               LDR+  ++DFNK KIGRSFVA 
Sbjct: 207 GYDDQDEEEESEDDYQPGYKKDKIDEDDEEVKWAEEDDLDRDPELSDFNKVKIGRSFVAK 266

Query: 260 FCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQ 319
           FCFYP FND++RG YGRVNVG DKR+ +TLYRMVKIE+VFLQKPYNMGKF TNQYFGVTQ
Sbjct: 267 FCFYPEFNDLIRGCYGRVNVGVDKRNNQTLYRMVKIERVFLQKPYNMGKFFTNQYFGVTQ 326

Query: 320 GKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQ 379
           GKDRKVFQM +FSDGAITQ EFERYM +L+   I  PS+Y+L NK+ EIN FVSQP+T +
Sbjct: 327 GKDRKVFQMNFFSDGAITQPEFERYMKSLDASGINPPSLYTLNNKSNEINGFVSQPVTPK 386

Query: 380 LTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMST 439
           LT+++VRNRM+FNKKLSG NAVLEKT+L++KLQYA ET +ERD+AKYSSQLRS E+R+++
Sbjct: 387 LTDELVRNRMLFNKKLSGTNAVLEKTILRDKLQYAKETGSERDVAKYSSQLRSLERRLTS 446

Query: 440 YEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRTKFY 499
           YEK HEND+ G  KL ALT++NRR N+D+ KN +  KKEDT FD+K+DPFSRLKTRTK Y
Sbjct: 447 YEKHHENDQAGSKKLGALTSRNRRANMDKGKNVDTTKKEDTPFDAKTDPFSRLKTRTKIY 506

Query: 500 YQEIXXXXXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSID 559
           YQEI               QLE+  S    K+ +LL ARF+ LGGL++V+  +DF+ SI+
Sbjct: 507 YQEIQKEENEKAKELARIEQLEKGNSDLAEKERKLLLARFKNLGGLEEVVSGIDFKLSIE 566

Query: 560 I 560
           +
Sbjct: 567 V 567

>Kpol_507.10 s507 (57107..58492) [1386 bp, 461 aa] {ON}
           (57107..58492) [1386 nt, 462 aa]
          Length = 461

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 267/462 (57%), Positives = 324/462 (70%), Gaps = 8/462 (1%)

Query: 104 MERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXXXXXXXXXXTRSSTRSTVATGHSD 163
           MERET+LFERSQ+MQKYQDRK+FR+R +NL               TR+STRST ATGHSD
Sbjct: 1   MERETLLFERSQLMQKYQDRKLFRERQRNLKRQQRNNTSAQEGKKTRTSTRSTQATGHSD 60

Query: 164 IKASKLSQLRKQREKKSQNRPXXXXXXXXXXXXXXXXXXXX-----XXXXXXXXXXXXPY 218
           +KASKLSQL++QREK ++NR                                      PY
Sbjct: 61  VKASKLSQLKRQREK-NKNRQYSESEGEYEEEEDEDDYDTGYKYDGSEYEEDDEEEYDPY 119

Query: 219 SRRSRFXXXXXXX--XXXXXXLDREANVADFNKAKIGRSFVANFCFYPGFNDIVRGNYGR 276
           SR+ R+                +RE+ V DFNK KIGRSFVA +CF+P FN+IV+G YGR
Sbjct: 120 SRKPRYREEEEEEDVKWAEESTNRESQVDDFNKIKIGRSFVARYCFHPDFNEIVKGCYGR 179

Query: 277 VNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQGKDRKVFQMRYFSDGAI 336
           VNVG D+R+ +T YRMVKIEKVFLQKPYNMGKF TNQYFGVTQGKDRKVFQM +FSDG I
Sbjct: 180 VNVGVDRRTNQTAYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQGKDRKVFQMNFFSDGPI 239

Query: 337 TQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQLTNDIVRNRMVFNKKLS 396
           T +EF+RY  +L+  + + PSVYSL  K KEIN FVS+P+T++LT++IVRNRMVFNKKLS
Sbjct: 240 TIEEFDRYQRSLDASNASKPSVYSLTQKLKEINEFVSEPMTDKLTDEIVRNRMVFNKKLS 299

Query: 397 GVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMSTYEKQHENDKVGINKLNA 456
           G NAVLEKTVL+ KLQYA E  NERDIAKYS+QLR+ EKR+STYEK HEND+ G  KL A
Sbjct: 300 GTNAVLEKTVLRGKLQYAKENNNERDIAKYSTQLRNLEKRLSTYEKHHENDQAGARKLGA 359

Query: 457 LTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRTKFYYQEIXXXXXXXXXXXXX 516
           LT+KNR+VN+D+ KN E VK+ED +FDSK+DPFSRLKTRTK YYQE+             
Sbjct: 360 LTSKNRKVNMDKAKNVEHVKEEDINFDSKADPFSRLKTRTKIYYQEVQKEENEKAKELAQ 419

Query: 517 XXQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSI 558
             +LEED     +K+ ELL A+FRRLGGL+ +I ++D + SI
Sbjct: 420 QKKLEEDREAIAKKERELLLAKFRRLGGLESIISSIDIELSI 461

>AFR266W Chr6 (912847..914535) [1689 bp, 562 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL244W (RTF1)
          Length = 562

 Score =  517 bits (1331), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 261/480 (54%), Positives = 331/480 (68%), Gaps = 12/480 (2%)

Query: 81  NPFPLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXX 140
           NP+PL GKY+D+ADR+++  +PEMERET+LFERSQ MQKYQ+RK+ R+R KN+       
Sbjct: 93  NPYPLLGKYRDDADREHIENMPEMERETLLFERSQEMQKYQERKVLRERAKNIRAQQQRR 152

Query: 141 XXXXXXXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPXXXXXXXXXXXXXXXX 200
                    RSS RST  TGHSD++ SKLS+LRKQR KKS N                  
Sbjct: 153 QQKDGSA-LRSSGRSTRTTGHSDLRDSKLSELRKQRAKKSGN--------YDYSAGEDDS 203

Query: 201 XXXXXXXXXXXXXXXXPYSRRSRFXXXXXXXXXXXXXLDREANVADFNKAKIGRSFVANF 260
                           P+  R  +             LDR+A + DFNK K+GRSFVA F
Sbjct: 204 DHSDDYVDSDNEDDYDPHDGRQLYREEADEVKWAEDDLDRDAELDDFNKIKVGRSFVAKF 263

Query: 261 CFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFITNQYFGVTQG 320
           CFYP FN  V+G YGRVN+G DK +G+ +YRMVKIEKVFLQKPYNMGKF TNQYFGVTQG
Sbjct: 264 CFYPEFNQRVQGCYGRVNIGVDKHTGQAMYRMVKIEKVFLQKPYNMGKFFTNQYFGVTQG 323

Query: 321 KDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINSFVSQPLTEQL 380
           KDRKVFQM +FSDG I Q E+ERY++ + +  I  PS+Y+L NKAK++ +FVSQP+T +L
Sbjct: 324 KDRKVFQMNFFSDGPILQPEYERYLNQIAKHDINKPSLYTLNNKAKDLTNFVSQPMTPKL 383

Query: 381 TNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFEKRMSTY 440
           T+ IVRNRM FNKKL+G NAVLEKTVL++KLQYA +T NE+DIAKYSSQL++ EKRMS+Y
Sbjct: 384 TDQIVRNRMQFNKKLTGTNAVLEKTVLRDKLQYARDTNNEKDIAKYSSQLKNLEKRMSSY 443

Query: 441 EKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTS-FDSKSDPFSRLKTRTKFY 499
           EK HEND+ GI KL+ALT+KNR+VN+D++++ E VKKED++  + K+DPFSRLKTRTK Y
Sbjct: 444 EKHHENDQTGIRKLDALTSKNRKVNLDKIRHVENVKKEDSATLNVKTDPFSRLKTRTKIY 503

Query: 500 YQEIXXXXXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGLKQVIGTVDFQFSID 559
           YQEI               Q ++ E   +RK+   L A+FRRLGGL+  +  +DF+  +D
Sbjct: 504 YQEIQQEENEKAQELAKQKQQQDKEEKHDRKQQ--LLAKFRRLGGLEDALSKLDFRIKLD 561

>Ecym_2597 Chr2 complement(1160898..1162586) [1689 bp, 562 aa] {ON}
           similar to Ashbya gossypii AFR266W
          Length = 562

 Score =  516 bits (1330), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 276/549 (50%), Positives = 351/549 (63%), Gaps = 29/549 (5%)

Query: 27  SAKRSGKSDRASSKKRRIXXXXXXXXX----------XXXXXXYNPA------ASGAGTG 70
           S+K+  K+D A SKKR +                         YNP        +  G+G
Sbjct: 24  SSKKRSKNDIAGSKKRMLMDDDDEDDSNDDEDNDVEDSEGEDDYNPGTQYDFEGNDDGSG 83

Query: 71  DYDDXXXXXXNPFPLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRG 130
           D         NP+PLEGKYKDE DR+ +  +PEMERET+LFERSQ MQKYQ+RK+ RQR 
Sbjct: 84  D----EQEERNPYPLEGKYKDEEDRNRIQDMPEMERETLLFERSQEMQKYQERKVLRQRA 139

Query: 131 KNLXXXXXXXXXXXXXXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQNRPXXXXXX 190
           K++                RSS RST  TGHS+++ SKLS+LRKQR KKS N        
Sbjct: 140 KSIRAQQQQRQLQKDSTK-RSSGRSTRTTGHSELRTSKLSELRKQRAKKSGN-------Y 191

Query: 191 XXXXXXXXXXXXXXXXXXXXXXXXXXPYSRRSRFXXXXXXXXXXXXXLDREANVADFNKA 250
                                      +  +  F             LDR+A + DFNK 
Sbjct: 192 DYSESEEDESDQSDNYAESDNDDYDPHHGHKDGFSDHDNEVKWAEEDLDRDAELEDFNKV 251

Query: 251 KIGRSFVANFCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEKVFLQKPYNMGKFI 310
           KIGRSFVA FCFYP F + V+  YGRVN+G DK +G  +YRMVKIE+VFLQKPY+MGKF 
Sbjct: 252 KIGRSFVAKFCFYPDFAERVQACYGRVNIGLDKHTGLPMYRMVKIERVFLQKPYSMGKFF 311

Query: 311 TNQYFGVTQGKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPSVYSLENKAKEINS 370
           TNQYFGVTQGKDRKVFQM YFSDG ITQ EFERY++ + +  +  PS+Y+L NKAKE+ +
Sbjct: 312 TNQYFGVTQGKDRKVFQMNYFSDGPITQPEFERYLNQMAKYDMNKPSLYTLNNKAKELFN 371

Query: 371 FVSQPLTEQLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQL 430
           FVSQP+T +LT+ IVRNRMVFNKKL+G NAVLEK+VLK+KLQYA +T NE  +AKY++QL
Sbjct: 372 FVSQPMTMKLTDQIVRNRMVFNKKLTGTNAVLEKSVLKDKLQYAKDTNNESAVAKYAAQL 431

Query: 431 RSFEKRMSTYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTS-FDSKSDPF 489
           ++ EKRMS+YEK HEND+ GI KL ALT+KNR+VN+D+++ AE V+KED+S  D+KSDPF
Sbjct: 432 KNLEKRMSSYEKHHENDQTGIRKLGALTSKNRKVNMDKIRLAENVRKEDSSNVDAKSDPF 491

Query: 490 SRLKTRTKFYYQEIXXXXXXXXXXXXXXXQLEEDESTTERKKHELLSARFRRLGGLKQVI 549
           SRLKTRTK YYQEI                 E+D+ T E K+ +LL A+FRRLGGL++++
Sbjct: 492 SRLKTRTKIYYQEIQQEENEKAMELAKQKHQEQDKETQENKERQLLLAKFRRLGGLEEIV 551

Query: 550 GTVDFQFSI 558
            ++ F+  +
Sbjct: 552 SSIPFKIEL 560

>KLLA0A00737g Chr1 (72233..73981) [1749 bp, 582 aa] {ON} similar to
           uniprot|P53064 Saccharomyces cerevisiae YGL244W RTF1
           Subunit of the RNA polymerase II-associated Paf1 complex
           directly or indirectly regulates DNA-binding properties
           of Spt15p (TATA box-binding protein) and relative
           activities of different TATA elements
          Length = 582

 Score =  416 bits (1070), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 198/325 (60%), Positives = 252/325 (77%), Gaps = 3/325 (0%)

Query: 238 LDREANVADFNKAKIGRSFVANFCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEK 297
           LDRE+++ D+NK +IGRSFVA FCFYP FN IV G YGRVN+G DK +G ++YRMVKIE+
Sbjct: 259 LDRESSLDDYNKIQIGRSFVAKFCFYPHFNKIVEGCYGRVNIGKDKHTGNSMYRMVKIER 318

Query: 298 VFLQKPYNMGKFITNQYFGVTQGKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGPS 357
           VFLQKPYNMGKF TNQYFGVTQGKDRK+FQM YFSD  +TQ E+ERY+ +LE+  IT PS
Sbjct: 319 VFLQKPYNMGKFFTNQYFGVTQGKDRKIFQMSYFSDSPVTQPEYERYLLSLEKYDITQPS 378

Query: 358 VYSLENKAKEINSFVSQPLTEQLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMET 417
            Y L NK+K +N FV +PLT +L +DIVRNRMVFNKKLSG NAV+EK VLKEKLQ++ ++
Sbjct: 379 PYILNNKSKAVNEFVCEPLTPKLMDDIVRNRMVFNKKLSGTNAVMEKQVLKEKLQFSKQS 438

Query: 418 KNERDIAKYSSQLRSFEKRMSTYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKK 477
            +    +KY++QL++ EKR+S+YEK HEND+  I  L ALT+KNR++NIDR+++AE +K+
Sbjct: 439 GDIESESKYANQLKALEKRLSSYEKHHENDQNDIKTLGALTSKNRKLNIDRIRHAETIKR 498

Query: 478 ED--TSFDSKSDPFSRLKTRTKFYYQEIXXXXXXXXXXXXXXXQLEEDESTTERKKHELL 535
           E+     D+KSDPFSRLKTRTK YYQEI               QLE D+   E+KK ELL
Sbjct: 499 EEGVNKVDAKSDPFSRLKTRTKIYYQEI-QQEENEKAREEAKRQLEVDQEAEEQKKKELL 557

Query: 536 SARFRRLGGLKQVIGTVDFQFSIDI 560
            A+FRRLGGL+++IG++D +  IDI
Sbjct: 558 LAKFRRLGGLEEIIGSLDLKLHIDI 582

 Score =  117 bits (292), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 73/101 (72%), Gaps = 2/101 (1%)

Query: 82  PFPLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXXX 141
           PFPLEGKYKDE DR+ L  LPEMERE++LFERSQ MQKYQ+RK+ RQ  K++        
Sbjct: 89  PFPLEGKYKDEKDREKLELLPEMERESILFERSQQMQKYQERKLLRQHAKSI--KQQQQL 146

Query: 142 XXXXXXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQN 182
                  TR+STRS+  TGHSD+K SKLS+L+KQR KKS N
Sbjct: 147 QREGSKSTRASTRSSRTTGHSDLKQSKLSELKKQRAKKSGN 187

>TBLA0E00220 Chr5 (32538..34250) [1713 bp, 570 aa] {ON} Anc_3.567
           YGL244W
          Length = 570

 Score =  394 bits (1012), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 190/324 (58%), Positives = 239/324 (73%), Gaps = 3/324 (0%)

Query: 238 LDREANVADFNKAKIGRSFVANFCFYPGFNDIVRGNYGRVNVGTDKRSGETLYRMVKIEK 297
           +DRE+NV DFNK KIGRSF   FCFYP FNDIV+  Y +VNV  D+   + +YRMVKIEK
Sbjct: 249 IDRESNVQDFNKIKIGRSFAFKFCFYPDFNDIVKNCYAKVNVSDDRH--KPVYRMVKIEK 306

Query: 298 VFLQK-PYNMGKFITNQYFGVTQGKDRKVFQMRYFSDGAITQQEFERYMHALERDHITGP 356
           VFL K P++MGKF TNQ FGVTQG +RKV+ M+YFSD  IT  EF+RY+  LE DHIT P
Sbjct: 307 VFLDKRPHDMGKFFTNQCFGVTQGNNRKVYSMKYFSDSPITHAEFDRYIRTLEHDHITRP 366

Query: 357 SVYSLENKAKEINSFVSQPLTEQLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAME 416
           SVY++ NK KEI +F ++PLT++LT+ IVRNRM FNKKLSG NAVLEKTVL+ KLQ+A E
Sbjct: 367 SVYAINNKFKEITAFTTEPLTDKLTDQIVRNRMRFNKKLSGTNAVLEKTVLRGKLQFAKE 426

Query: 417 TKNERDIAKYSSQLRSFEKRMSTYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVK 476
           T NERD+ KYS+QLR+ EKR+S YEK HEND+ G  KL  LT++NR++N+D+ +N E  K
Sbjct: 427 TGNERDVTKYSAQLRNLEKRLSLYEKHHENDQTGAKKLGQLTSRNRKLNMDKARNVEHKK 486

Query: 477 KEDTSFDSKSDPFSRLKTRTKFYYQEIXXXXXXXXXXXXXXXQLEEDESTTERKKHELLS 536
            E   FD+K+DPFSRLKTRTK YYQEI               QLEED     + + E L 
Sbjct: 487 VELAGFDAKADPFSRLKTRTKIYYQEIQKEENEKAQELAHKKQLEEDAEAKAQSEKEQLL 546

Query: 537 ARFRRLGGLKQVIGTVDFQFSIDI 560
           A F+ LGGL++++G+++F+F  DI
Sbjct: 547 AEFKCLGGLEKMVGSLNFKFDFDI 570

 Score =  120 bits (302), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 71/158 (44%), Positives = 96/158 (60%), Gaps = 8/158 (5%)

Query: 27  SAKRSGKSDRASSKKRRIXXXXXXXXXXXXXXXYNPA---ASGAGTGDYDDXXXXXXNPF 83
           S+K+  +++ +SSK+R+I               YNP     +   T +  D      NPF
Sbjct: 26  SSKKRARNNDSSSKRRKIEVDNEDEEEEDD---YNPVFNEDNNQSTYNTMDGEREEPNPF 82

Query: 84  PLEGKYKDEADRDYLGGLPEMERETMLFERSQIMQKYQDRKMFRQRGKNLXXXXXXXXXX 143
           PLEGKYKDE DR+ +  +PEMERET+LFERSQIMQKYQ+RKMFR+R +            
Sbjct: 83  PLEGKYKDEDDREKIESMPEMERETLLFERSQIMQKYQERKMFRERSR--KQMSLNNNSN 140

Query: 144 XXXXXTRSSTRSTVATGHSDIKASKLSQLRKQREKKSQ 181
                TR+STR T  TG SD K+SKLSQL++QRE++++
Sbjct: 141 LTGQKTRTSTRVTHTTGLSDAKSSKLSQLKRQRERRNK 178

>TBLA0H02690 Chr8 complement(635310..636800) [1491 bp, 496 aa] {ON}
           Anc_2.579 YKL059C
          Length = 496

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 50/117 (42%), Gaps = 5/117 (4%)

Query: 375 PLTEQLTNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAKYSSQLRSFE 434
           P+T  L N+ VR     NK  S  NA+  + VL E      E K E  +     + +  E
Sbjct: 304 PITGGLLNNPVRTTKCCNKLFSK-NAI--EDVLLETDFVCPECKTEDILLDSLIEDKEIE 360

Query: 435 KRMSTYEKQHENDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSR 491
           +++  + K HENDK     +N  T  N  V       A ++ K  T     SDP ++
Sbjct: 361 EKVKEFIKSHENDKSNGENINGNTVANNVVQSSDNNTAGELNK--TENGDNSDPATK 415

>Kpol_1007.5 s1007 (6709..7899,7949..7957,8000..10018) [3219 bp,
           1072 aa] {ON} (6709..7899,7949..7957,8000..10018) [3219
           nt, 1073 aa]
          Length = 1072

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 28/51 (54%), Gaps = 2/51 (3%)

Query: 446 NDKVGINKLNALTTKNRRVNIDRLKNAEQVKKEDTSFDSKSDPFSRLKTRT 496
           ++K G   + AL   +RR+ ID L      K +DT  D K+D  S+L ++T
Sbjct: 281 DEKTGATVMTALVYPHRRIKIDELIPPVHPKVQDTQADEKTD--SKLSSKT 329

>Kpol_1054.58 s1054 (144394..145599) [1206 bp, 401 aa] {ON}
           (144394..145599) [1206 nt, 402 aa]
          Length = 401

 Score = 30.8 bits (68), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 31/64 (48%), Gaps = 2/64 (3%)

Query: 368 INSFVSQPLTEQL--TNDIVRNRMVFNKKLSGVNAVLEKTVLKEKLQYAMETKNERDIAK 425
           +   +S  LTEQ    +++V+ R +  KK++ +  + E   L+EKL Y  E    R    
Sbjct: 75  LEELISDVLTEQTRQADELVKQRKLLEKKVAELKQMPESGSLREKLAYTFEYNTARKFPA 134

Query: 426 YSSQ 429
           Y  Q
Sbjct: 135 YIWQ 138

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.360 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 44,819,578
Number of extensions: 1783139
Number of successful extensions: 7127
Number of sequences better than 10.0: 129
Number of HSP's gapped: 7511
Number of HSP's successfully gapped: 147
Length of query: 560
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 445
Effective length of database: 40,294,809
Effective search space: 17931190005
Effective search space used: 17931190005
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)