Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0E09504g3.566ON37737720300.0
TDEL0D063403.566ON40238710251e-137
NCAS0E002703.566ON3883849891e-132
Skud_7.243.566ON3913839701e-129
Smik_7.183.566ON3853859681e-129
YGL243W (TAD1)3.566ON4003809631e-128
KAFR0J028703.566ON3843869501e-126
NDAI0I032303.566ON3863819501e-126
Kpol_380.73.566ON3853869331e-124
TPHA0G036403.566ON3963889131e-120
SAKL0F00836g3.566ON3833679121e-120
KLTH0G00748g3.566ON3853799051e-119
Ecym_25963.566ON3873798821e-116
Suva_7.183.566ON3853838771e-115
KLLA0A00759g3.566ON3803818741e-115
Kwal_47.192633.566ON3833778731e-115
KNAG0I002403.566ON3913858631e-113
AFR267W3.566ON3853798261e-107
TBLA0E002303.566ON3943928211e-107
CAGL0H07733g3.566ON3853857521e-96
Suva_10.1408.41ON36543721.8
KNAG0J018408.698ON650111712.6
Kwal_23.52583.68ON52649686.7
Kpol_388.114.26ON77736678.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0E09504g
         (377 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {...   786   0.0  
TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa] ...   399   e-137
NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566...   385   e-132
Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)   378   e-129
Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)   377   e-129
YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}  TAD1tRNA-spe...   375   e-128
KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {...   370   e-126
NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {O...   370   e-126
Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON} ...   363   e-124
TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {O...   356   e-120
SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar ...   355   e-120
KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar ...   353   e-119
Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {O...   344   e-116
Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)   342   e-115
KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar ...   341   e-115
Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]...   340   e-115
KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566...   337   e-113
AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic ho...   322   e-107
TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566...   320   e-107
CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} simila...   294   1e-96
Suva_10.140 Chr10 (255480..256577) [1098 bp, 365 aa] {ON} YLR056...    32   1.8  
KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {...    32   2.6  
Kwal_23.5258 s23 (1079727..1081307) [1581 bp, 526 aa] {ON} YNL29...    31   6.7  
Kpol_388.11 s388 complement(31022..33355) [2334 bp, 777 aa] {ON}...    30   8.7  

>ZYRO0E09504g Chr5 complement(756951..758084) [1134 bp, 377 aa] {ON}
           similar to uniprot|P53065 Saccharomyces cerevisiae
           YGL243W TAD1 tRNA-specific adenosine deaminase
           deaminates adenosine-37 to inosine in tRNA-Ala
          Length = 377

 Score =  786 bits (2030), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/377 (100%), Positives = 377/377 (100%)

Query: 1   MDDVSLGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIAT 60
           MDDVSLGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIAT
Sbjct: 1   MDDVSLGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIAT 60

Query: 61  GVKALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQ 120
           GVKALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQ
Sbjct: 61  GVKALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQ 120

Query: 121 LFHFKDNWELAIYISTLPCGDASMDLLCQDESIIEMQDDDPIQFVDPAVTSIVRGRFNYS 180
           LFHFKDNWELAIYISTLPCGDASMDLLCQDESIIEMQDDDPIQFVDPAVTSIVRGRFNYS
Sbjct: 121 LFHFKDNWELAIYISTLPCGDASMDLLCQDESIIEMQDDDPIQFVDPAVTSIVRGRFNYS 180

Query: 181 RRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTTDL 240
           RRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTTDL
Sbjct: 181 RRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTTDL 240

Query: 241 LHQSFYDRIKVLPNVPLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPESTVEQALLNG 300
           LHQSFYDRIKVLPNVPLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPESTVEQALLNG
Sbjct: 241 LHQSFYDRIKVLPNVPLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPESTVEQALLNG 300

Query: 301 LKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNALIQDCR 360
           LKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNALIQDCR
Sbjct: 301 LKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNALIQDCR 360

Query: 361 KLLSPKGWISTSRDDCE 377
           KLLSPKGWISTSRDDCE
Sbjct: 361 KLLSPKGWISTSRDDCE 377

>TDEL0D06340 Chr4 complement(1138653..1139861) [1209 bp, 402 aa]
           {ON} Anc_3.566 YGL243W
          Length = 402

 Score =  399 bits (1025), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 214/387 (55%), Positives = 271/387 (70%), Gaps = 16/387 (4%)

Query: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSD--LRLISIATGVK 63
           LG+RIA+   + Y KL S+CKP  RSNG KEWTVL+GIVAID  + D  LRL+SI TGVK
Sbjct: 10  LGDRIAKLFEDEYLKLSSACKPVIRSNGSKEWTVLSGIVAIDHLSVDKKLRLVSIGTGVK 69

Query: 64  ALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQLFH 123
           ALPDA L RS G+MVHDCHAEILALR FN V+L+ + Y+ +    + DL+ER +      
Sbjct: 70  ALPDATLERSHGRMVHDCHAEILALRGFNTVLLEHMNYMVTEQCGETDLIERTTAGVCI- 128

Query: 124 FKDNWELAIYISTLPCGDASMDLL-------CQDESIIEMQDDDPIQFVDPAVTSIVRGR 176
            K  W+LA+YISTLPCGDASM  L          +  +  +++  IQ++D  + SI+RGR
Sbjct: 129 LKSKWKLALYISTLPCGDASMKDLQTYNNTDTNRKQELTFEENTEIQWIDQKIRSILRGR 188

Query: 177 FNYSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPN 236
           FNY R  VVRTKPGR+DSQIT  KSCSDKLC +QV SILN +TW L+ +PV+L YLV PN
Sbjct: 189 FNYDRLGVVRTKPGRYDSQITFSKSCSDKLCIKQVTSILNSLTWSLMAQPVFLDYLVIPN 248

Query: 237 TT----DLLHQSFYDRIKVLPNVPLKVLQCSYQFEHDKHSSEEEPSAMSSIKLY-STPE- 290
                   +H SF DR+  LP   L++L+C+  F  +K S  EEPS+MSS+KL+   PE 
Sbjct: 249 LAVDRCQGVHHSFQDRLGRLPQKSLELLECNVPFFDNKSSKSEEPSSMSSVKLFLDLPER 308

Query: 291 STVEQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQ 350
              EQA+LNGLKNGFYTKGNKPLR+NCE AVSR AQW+++  +RP+    TYL+FKA + 
Sbjct: 309 KCTEQAILNGLKNGFYTKGNKPLRKNCESAVSRLAQWKIYVNIRPDAKQQTYLEFKAGLS 368

Query: 351 DRNALIQDCRKLLSPKGWISTSRDDCE 377
           +RN +IQ+ +K+LSP GWIST  DDC 
Sbjct: 369 ERNRIIQEVKKVLSPDGWISTRNDDCH 395

>NCAS0E00270 Chr5 (41231..42397) [1167 bp, 388 aa] {ON} Anc_3.566
           YGL243W
          Length = 388

 Score =  385 bits (989), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 200/384 (52%), Positives = 260/384 (67%), Gaps = 13/384 (3%)

Query: 3   DVSLGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIATGV 62
           +V L +R+A+ V E Y KL  S KP  RSNGVKEWTVLA  + +D    +L++IS++TGV
Sbjct: 4   EVLLPDRVAKIVQEEYNKLKPSSKPVLRSNGVKEWTVLASTLLLDSNTGNLKMISLSTGV 63

Query: 63  KALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQLF 122
           KALPD  L RSGGKM+HDCHAEILALR FN V+L  I  +N N   Q DL+E +  +  +
Sbjct: 64  KALPDKELSRSGGKMIHDCHAEILALRGFNTVLLKDIDNMNQNL-RQSDLLEISDANGKY 122

Query: 123 HFKDNWELAIYISTLPCGDASM----DLLCQDESIIEMQDDDPIQFVDPAVTSIVRGRFN 178
           H +  W+L +YIS LPCGDASM    +      S+  + D D  Q++DP + +I+RGR N
Sbjct: 123 HLRAKWKLILYISRLPCGDASMRTLSNSSPTSSSLKSIDDSDEFQYIDPNIPTILRGRLN 182

Query: 179 YSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTP--- 235
           +SR  VVRTKPGR DS  TL KSCSDKLC RQV SILNCMTW LL+ PV++ YL+ P   
Sbjct: 183 FSRNGVVRTKPGRLDSLTTLSKSCSDKLCLRQVTSILNCMTWSLLDTPVFIDYLLIPQLN 242

Query: 236 --NTTDLLHQSFYDRIKV--LPNVPLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPES 291
             N  DLL  SF +R+K   +   P+K L  + +F  DK+   EEPS+MSSIKL+ T   
Sbjct: 243 YDNKNDLL-LSFQNRLKCSKVNYRPMKYLTTTVKFSEDKNFITEEPSSMSSIKLFLTQGE 301

Query: 292 TVEQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQD 351
           T+E+ALLNG+KNG YTKGNKPLR+NCE  VSRYAQW ++K + P ++  +YL+FK +   
Sbjct: 302 TIEEALLNGVKNGSYTKGNKPLRKNCESIVSRYAQWHIYKRINPNYSATSYLEFKRSQTA 361

Query: 352 RNALIQDCRKLLSPKGWISTSRDD 375
           R  LI+   ++LS +GW+ T  DD
Sbjct: 362 RLELIKYTNEILSSEGWLPTQPDD 385

>Skud_7.24 Chr7 (47515..48690) [1176 bp, 391 aa] {ON} YGL243W (REAL)
          Length = 391

 Score =  378 bits (970), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 192/383 (50%), Positives = 266/383 (69%), Gaps = 19/383 (4%)

Query: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKN--SDLRLISIATGVK 63
           L   I+ KV+  Y KL S CKP TR  G+KEWT+LAG+V I++    +++ ++S+ATGVK
Sbjct: 13  LAEEISNKVIGEYSKLKSVCKPATRPTGIKEWTILAGVVVINRSGGANNVEVLSVATGVK 72

Query: 64  ALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQL-F 122
           ALPD+ L RSGGK++HDCHAEILALR  N V+L  I   + +  N  D +E  +E  + F
Sbjct: 73  ALPDSELQRSGGKLLHDCHAEILALRGANTVLLKHIK--DYDPANGSDFIESNNEIPIRF 130

Query: 123 HFKDNWELAIYISTLPCGDASMDLL---CQD-ESIIEMQDDDPIQFVDPAVTSIVRGRFN 178
           + KD+WELA+YIS LPCGDASMD L   C++ E  I+++D+D  Q+VDP V +I+RGR N
Sbjct: 131 NLKDDWELALYISRLPCGDASMDFLNDSCKNNEDFIKIEDNDAFQYVDPKVKTILRGRLN 190

Query: 179 YSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTT 238
           + ++ VVRTKPGR+DS ITL KSCSDKL  +Q+ SILN + ++L  +PVYLKY+V P+  
Sbjct: 191 FHKKSVVRTKPGRYDSNITLSKSCSDKLSMKQISSILNSLNYELFEQPVYLKYIVIPDIE 250

Query: 239 D----LLHQSFYDRIKVLPNVPLKV--LQCSYQFEHDKHSSEEEPSAMSSIKLYSTPEST 292
           D    +L +SF++R   LP    KV  L C   F  D+    + PS+M SIKL+   +S+
Sbjct: 251 DKTKHILERSFHNR---LPCDGHKVEFLNCHTPFYDDRTDENDIPSSMCSIKLFVN-DSS 306

Query: 293 VEQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDR 352
            E+A+ NG+KNGFYTK +KPLR++C+  VSR+AQW+LF+ +RP+  + +YL FK+  ++R
Sbjct: 307 TEEAIFNGMKNGFYTKSSKPLRKHCQSQVSRFAQWELFRQIRPKHKSMSYLHFKSQQKER 366

Query: 353 NALIQDCRKLLSPKGWISTSRDD 375
           N LI   +  LSP GWIST  DD
Sbjct: 367 NRLITTAKNALSPDGWISTRIDD 389

>Smik_7.18 Chr7 (38166..39323) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  377 bits (968), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 195/385 (50%), Positives = 267/385 (69%), Gaps = 19/385 (4%)

Query: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKN--SDLRLISIATGVK 63
           LG+RI+ +V+  Y KL   C+P TR  GVKEWTVLAGIVAI++KN  +++ ++S+ATGVK
Sbjct: 7   LGDRISTRVINEYSKLKPICRPVTRPTGVKEWTVLAGIVAINRKNDTNNIDVLSMATGVK 66

Query: 64  ALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQ-LF 122
           A+PD+ L RSGGK++HDCHAEILALR  N V+L+ I     N  N  D ++   E    F
Sbjct: 67  AMPDSELRRSGGKILHDCHAEILALRGLNTVLLNHIK--EYNPANGSDFIQSNDETPPRF 124

Query: 123 HFKDNWELAIYISTLPCGDASMDLL---CQ-DESIIEMQDDDPIQFVDPAVTSIVRGRFN 178
             KDNWELA+YIS LPCGDAS+D L   C+ D    +++DDD  Q+V+ +V +I+RG  N
Sbjct: 125 KLKDNWELALYISKLPCGDASIDFLNDNCKNDHDFPKIEDDDEFQYVNSSVKTILRGNLN 184

Query: 179 YSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTT 238
           ++R+ VVRTKPGR+DS ITL KSCSDKL  +++ SILN + ++L  +PV+LKY+V P   
Sbjct: 185 FNRKNVVRTKPGRYDSNITLSKSCSDKLLMKRLSSILNALNYELFVQPVFLKYVVIPGLE 244

Query: 239 D----LLHQSFYDRIKVLPNVPLKV--LQCSYQFEHDKHSSEEEPSAMSSIKLYSTPEST 292
           +    +L QSF+DR   LPN   +   + C+  F  DK   E+ PS M SIKL+   + T
Sbjct: 245 NEVKHVLKQSFHDR---LPNANHETIFMSCNTSFYDDKAGEEDVPSLMCSIKLFMN-DHT 300

Query: 293 VEQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDR 352
            E+A+LNG+KNGFYTK +KPLR++C+  VSR+AQW+LFK +RPE+   +YLQFK++ + R
Sbjct: 301 NEEAILNGVKNGFYTKSSKPLRKHCQSLVSRFAQWELFKQIRPEYEGMSYLQFKSSQKRR 360

Query: 353 NALIQDCRKLLSPKGWISTSRDDCE 377
             LI   + +LSP GWI T  DD +
Sbjct: 361 TRLIIAIKDILSPDGWIPTKIDDVQ 385

>YGL243W Chr7 (43307..44509) [1203 bp, 400 aa] {ON}
           TAD1tRNA-specific adenosine deaminase, deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 400

 Score =  375 bits (963), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 189/380 (49%), Positives = 264/380 (69%), Gaps = 14/380 (3%)

Query: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKN--SDLRLISIATGVK 63
           LG  I+ +V+  Y KL S+C+P  R +G++EWT+LAG+ AI++    + + ++SIATGVK
Sbjct: 23  LGEEISTRVINEYSKLKSACRPIIRPSGIREWTILAGVAAINRDGGANKIEILSIATGVK 82

Query: 64  ALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASE-DQLF 122
           ALPD+ L RS GK++HDCHAEILALR  N V+L++I   N +S ++   ++   E    F
Sbjct: 83  ALPDSELQRSEGKILHDCHAEILALRGANTVLLNRIQNYNPSSGDK--FIQHNDEIPARF 140

Query: 123 HFKDNWELAIYISTLPCGDASMDLL---CQDESIIEMQDDDPIQFVDPAVTSIVRGRFNY 179
           + K+NWELA+YIS LPCGDASM  L   C+++  I+++D D  Q+VD +V +I+RGR N+
Sbjct: 141 NLKENWELALYISRLPCGDASMSFLNDNCKNDDFIKIEDSDEFQYVDRSVKTILRGRLNF 200

Query: 180 SRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTTD 239
           +RR VVRTKPGR+DS ITL KSCSDKL  +Q  S+LNC+ ++L  KPV+LKY+V PN  D
Sbjct: 201 NRRNVVRTKPGRYDSNITLSKSCSDKLLMKQRSSVLNCLNYELFEKPVFLKYIVIPNLED 260

Query: 240 ----LLHQSFYDRIKVLPNVPLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPESTVEQ 295
                L QSF+ R+  L N  +K L C   F  DK   E+ P  M S+KL+    ST E+
Sbjct: 261 ETKHHLEQSFHTRLPNLDN-EIKFLNCLKPFYDDKLDEEDVPGLMCSVKLFMDDFST-EE 318

Query: 296 ALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNAL 355
           A+LNG++NGFYTK +KPLR++C+  VSR+AQW+LFK +RPE+   +YL+FK+  + R+ L
Sbjct: 319 AILNGVRNGFYTKSSKPLRKHCQSQVSRFAQWELFKKIRPEYEGISYLEFKSRQKKRSQL 378

Query: 356 IQDCRKLLSPKGWISTSRDD 375
           I   + +LSP GWI T  DD
Sbjct: 379 IIAIKNILSPDGWIPTRTDD 398

>KAFR0J02870 Chr10 complement(546360..547514) [1155 bp, 384 aa] {ON}
           Anc_3.566 YGL243W
          Length = 384

 Score =  370 bits (950), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 194/386 (50%), Positives = 267/386 (69%), Gaps = 13/386 (3%)

Query: 1   MDDVSLGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKK--NSDLRLISI 58
           M+D SLG+ IA+ V E Y +L +S KP TRSNG KEWTVLA +VAI++     DL+LI+I
Sbjct: 1   MND-SLGDEIAKLVYEEYDQLKASSKPVTRSNGTKEWTVLAAVVAINENADEKDLKLIAI 59

Query: 59  ATGVKALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASE 118
           +TGVKA+P+A L RS G+++HDCHAEILALR FN V+L  +  L +N  +    ++++++
Sbjct: 60  STGVKAMPNARLDRSCGRILHDCHAEILALRGFNFVLLKNMQDLKNNETSS--FLDKSAQ 117

Query: 119 DQLFHFKDNWELAIYISTLPCGDASMDLLCQDESI-IEMQDDDPIQFVDPAVTSIVRGRF 177
              F +K  W+LA+Y+S LPCGDASMD L     + IEM +DD +Q++DP  + I+RGR 
Sbjct: 118 GGKFRWKSKWKLALYVSRLPCGDASMDHLEDASELDIEMSEDDRLQYIDPGKSKILRGRM 177

Query: 178 NYSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTP-- 235
           N+ R+  VRTKPGR DS ITL KSCSDKLC +Q+ S LN +TW+L+  PVYLKYLV P  
Sbjct: 178 NFKRKGAVRTKPGRLDSDITLSKSCSDKLCIKQITSALNSLTWELMETPVYLKYLVIPEL 237

Query: 236 NTTD--LLHQSFYDRIKVLPNVPLKVLQCSYQ--FEHDKHSSEEEPSAMSSIKLYSTPES 291
           N TD   L + F+ R+    ++  +    +YQ  F  DK S  + PSA S IK++ + E 
Sbjct: 238 NDTDKKALIRCFHTRLCSSLDLISRFQFLTYQGSFTDDKTSDSQLPSATSFIKVFPSQEH 297

Query: 292 TVEQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNA-TYLQFKATIQ 350
           T+EQA+LNG+KNGFYTK +KPLRR CE  +SRY+QW L+K+L+ +  N  +YLQFKA  +
Sbjct: 298 TIEQAILNGVKNGFYTKLDKPLRRGCESILSRYSQWNLYKSLKSDVENGLSYLQFKAEQE 357

Query: 351 DRNALIQDCRKLLSPKGWISTSRDDC 376
            R  L+++ +  LS   WI+T +DDC
Sbjct: 358 QRRDLVENAKICLSHGSWIATLKDDC 383

>NDAI0I03230 Chr9 complement(759205..760365) [1161 bp, 386 aa] {ON}
           Anc_3.566 YGL243W
          Length = 386

 Score =  370 bits (950), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 185/381 (48%), Positives = 259/381 (67%), Gaps = 13/381 (3%)

Query: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIATGVKAL 65
           L +RIA  + + Y  L SS KP  RSNG+KEWTV AGIVAI+   +DLR+IS+ATGVKAL
Sbjct: 7   LADRIADLLQQKYDTLKSSSKPVARSNGIKEWTVFAGIVAINTDTNDLRVISLATGVKAL 66

Query: 66  PDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQLFHFK 125
           P+  L RSGGKM+HD HAEI+ALR FN VIL QI  L +  +   DLV  + + + + FK
Sbjct: 67  PNKELERSGGKMLHDGHAEIVALRGFNTVILQQIYQLKNGEET--DLVIHSKDSEYYSFK 124

Query: 126 DNWELAIYISTLPCGDASMDLLCQDESIIE---MQDDDPIQFVDPAVTSIVRGRFNYSRR 182
            N ++A+YIS LPCGD SM +L + +   E   ++D+D IQ+++    +I+RGR N++++
Sbjct: 125 SNLKIALYISQLPCGDISMRMLKERDIAPEELAIKDEDSIQYINQDNKTILRGRLNFNKK 184

Query: 183 QVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTT---- 238
             VRTKPGR DSQ+T  KSCSDKLC +Q  SILNC+T++LL +PVYL Y++ P  T    
Sbjct: 185 GYVRTKPGRLDSQLTKSKSCSDKLCMKQYTSILNCLTFQLLEQPVYLDYMIVPGMTTEMK 244

Query: 239 ---DLLHQSFYDRIKVLPNVPLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPESTVEQ 295
              DL     ++R  V     +  L  S +F+  +++S++EPSA+ +IK++    +++EQ
Sbjct: 245 EDIDLCFNKQFERC-VGTRHEVCYLSTSKEFKDTRNTSDQEPSAIGAIKVFIGQGNSIEQ 303

Query: 296 ALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNAL 355
            +LNG+KNG YTK NKPLR+NCE  VSR++QWQ+FK + P+++  +YL FK +  +R  L
Sbjct: 304 TILNGVKNGSYTKKNKPLRKNCETLVSRFSQWQIFKEIEPKYSQMSYLDFKQSQHERRKL 363

Query: 356 IQDCRKLLSPKGWISTSRDDC 376
           I   R  +SP GWIST  DDC
Sbjct: 364 IDYTRSKMSPDGWISTQEDDC 384

>Kpol_380.7 s380 complement(11933..13090) [1158 bp, 385 aa] {ON}
           complement(11933..13090) [1158 nt, 386 aa]
          Length = 385

 Score =  363 bits (933), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 178/386 (46%), Positives = 259/386 (67%), Gaps = 12/386 (3%)

Query: 1   MDDVSLGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIAT 60
           M + SLG++I+  + E Y KL SS KP TRSN VKEWTVLA IVAI    +++  I+I+T
Sbjct: 1   MKEKSLGDKISNIIFEEYSKLKSSSKPTTRSNNVKEWTVLAAIVAISNDENEIIPITIST 60

Query: 61  GVKALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQ 120
           GVKA P+  L RS GK++HDCH+EIL+LRAFN  +L  +  ++    ++  L  +A  D 
Sbjct: 61  GVKATPNDELERSSGKILHDCHSEILSLRAFNTYLLQSVQRVSEGDKSKFILPAKA--DG 118

Query: 121 LFHFKDNWELAIYISTLPCGDASMDLLCQD----ESIIEMQDDDPIQFVDPAVTSIVRGR 176
            +++ +N+++A+YIS LPCGDASMD L +D    E    ++D+D  QF+DP + +++RGR
Sbjct: 119 KYNWNENYKIALYISKLPCGDASMDTLNEDLEDNEQNFTIEDNDAYQFIDPKIKTVIRGR 178

Query: 177 FNYSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPN 236
            NYS++ VVRTKPGR+DS +TL KSCSDKLC +Q  SILN + W L   P++L Y++ P 
Sbjct: 179 LNYSKKNVVRTKPGRYDSNVTLSKSCSDKLCMKQAKSILNSLNWDLFENPIFLAYVIIPT 238

Query: 237 TTD----LLHQSFYDRIKVL--PNVPLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPE 290
             D     L++ F +R++ +  P +PL  L C  +F  DK   + EP+ +SSIK+    E
Sbjct: 239 LKDELLLKLNKEFPERLRGIGIPIMPLTFLTCVEKFIDDKTEIKTEPALVSSIKILLPRE 298

Query: 291 STVEQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQ 350
             +EQ+++NG++NG YTK NKPL++NC+  +S+Y+QWQLFKTL+ E    +Y+++K +  
Sbjct: 299 HQIEQSIVNGVRNGSYTKKNKPLKKNCQSDISKYSQWQLFKTLKEEQLAKSYIEYKKSQT 358

Query: 351 DRNALIQDCRKLLSPKGWISTSRDDC 376
            R  L    +  LSP GWIST +DDC
Sbjct: 359 LREDLKDIIKSKLSPDGWISTFQDDC 384

>TPHA0G03640 Chr7 complement(774037..775227) [1191 bp, 396 aa] {ON}
           Anc_3.566 YGL243W
          Length = 396

 Score =  356 bits (913), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 176/388 (45%), Positives = 251/388 (64%), Gaps = 14/388 (3%)

Query: 1   MDDVSLGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIAT 60
           + D  +  +++  V   Y KL  S KP  +SN V EWTVLAGI+AI+ +  +   I+I T
Sbjct: 11  ISDNYIAEKVSATVHGEYSKLRPSSKPVIKSNSVPEWTVLAGIIAINNETGEFETIAITT 70

Query: 61  GVKALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQ 120
           GVKA PDA L RS GK++HDCHAEILALR FN  +LD I  + SN D     V+  ++  
Sbjct: 71  GVKATPDADLDRSQGKIIHDCHAEILALRCFNIFLLDTINRI-SNHDGTSKFVQ-VTKTN 128

Query: 121 LFHFKDNWELAIYISTLPCGDASMDLLCQ--DESIIEMQDDDPIQFVDPAVTSIVRGRFN 178
            + +   W+LA+YIS LPCGDASMD L +  D +  E+ DD+P+Q++DP   + +RGR N
Sbjct: 129 SYEWNKKWDLALYISKLPCGDASMDDLMKVGDTAEFEITDDNPLQYIDPKNKTTIRGRLN 188

Query: 179 YSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTT 238
           Y +R V+RTKPGR+DS+ITL KSC+DKLC +QV+ IL+     L+  P++L+Y++ P  +
Sbjct: 189 YKKRDVIRTKPGRYDSKITLSKSCTDKLCMKQVMGILDSTCSLLMKDPIFLQYIIIPRIS 248

Query: 239 ---DLLHQSFYDRIKV--LPNVPLKVLQCSYQFEHDKHSSE--EEPSAMSSIKLYSTPES 291
               +L  +F DR++    P    K + C   F  D H +    EP+ ++SIK++     
Sbjct: 249 GKESILKHAFIDRLRGGNFPVQEFKFISCENHFIDDNHDTTIVREPALVNSIKIFMDNNR 308

Query: 292 TVEQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTL---RPEFTNATYLQFKAT 348
            +EQ+++NG+KNGFY+K  KPLR+NCEP +SRY++W L K +   R E  N +YL+FK+T
Sbjct: 309 VMEQSIINGVKNGFYSKPKKPLRKNCEPIISRYSKWNLLKQIEFNRAELLNVSYLEFKST 368

Query: 349 IQDRNALIQDCRKLLSPKGWISTSRDDC 376
           +  R  L Q+ R LLSP GWI+T +DDC
Sbjct: 369 LTKRMTLQQEVRSLLSPDGWITTKKDDC 396

>SAKL0F00836g Chr6 (74958..76109) [1152 bp, 383 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 383

 Score =  355 bits (912), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 177/367 (48%), Positives = 243/367 (66%), Gaps = 6/367 (1%)

Query: 16  EGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIATGVKALPDAFLHRSGG 75
           E Y +L   CKP  RSNG+KEWTVLAGI+AI+++ + +RL+S+ TGVKA P+  L RS G
Sbjct: 17  EAYARLKPICKPTVRSNGIKEWTVLAGIIAINERKNTMRLVSLGTGVKATPNEELKRSKG 76

Query: 76  KMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQLFHFKDNWELAIYIS 135
           K+VHDCHAEILALR FN V+L Q++ L      ++DLVE+A +   F   D+W  A+YIS
Sbjct: 77  KIVHDCHAEILALRGFNTVLLMQVSELTQGKHERVDLVEKAVDGLSFKVPDHWSFALYIS 136

Query: 136 TLPCGDASMDLLCQDE-SIIEMQDDDPIQFVDPAVTSIVRGRFNYSRRQVVRTKPGRFDS 194
            LPCGD+SMD L +++ +   +++ D  Q+++    +++RGRFNY ++  VRTKPGR DS
Sbjct: 137 KLPCGDSSMDTLEEEDLNSFNIENTDACQYLEQNNHTLLRGRFNYQKKGFVRTKPGRKDS 196

Query: 195 QITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTTDLLHQSFYDRIKVLPN 254
           +ITL KSCSDKL  RQV S+LN + W+L + P+YLKY++ PN  +          + L N
Sbjct: 197 KITLSKSCSDKLSIRQVTSMLNSINWELFDTPIYLKYIIIPNLDEHALVGLERSFERLCN 256

Query: 255 VP----LKVLQCSYQFEHDKHSSEEEPSAMSSIKL-YSTPESTVEQALLNGLKNGFYTKG 309
            P    L+ L  S  F  DK + +++PS+MSSI L         ++A+LNG+KNGFY K 
Sbjct: 257 HPSFNALRFLSGSQTFCDDKITQDQQPSSMSSISLNVHNNGEEFQEAILNGVKNGFYVKN 316

Query: 310 NKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNALIQDCRKLLSPKGWI 369
            KPLR+NCE  VSR +QWQL+ T+     + TYLQFK+T  +RN L  + +  LSP GWI
Sbjct: 317 KKPLRKNCESIVSRLSQWQLYNTISSNTEHETYLQFKSTQVERNILKNEAKLCLSPDGWI 376

Query: 370 STSRDDC 376
            T  DDC
Sbjct: 377 PTGVDDC 383

>KLTH0G00748g Chr7 (51751..52908) [1158 bp, 385 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 385

 Score =  353 bits (905), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 184/379 (48%), Positives = 249/379 (65%), Gaps = 9/379 (2%)

Query: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIATGVKAL 65
           + ++IA+   E YRKL  S KP  RSNG KEW VLA +VAI++ N DLRL+S+ATGVKA 
Sbjct: 7   VADKIAELASEYYRKLKPSAKPTVRSNGTKEWNVLACVVAINRANEDLRLVSLATGVKAA 66

Query: 66  PDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQI-DLVERASEDQ-LFH 123
           P+  L RS G+++HDCHAEILALR FNAV+L QI  L  +  + + DLV  +S++  ++ 
Sbjct: 67  PNEDLKRSNGRILHDCHAEILALRGFNAVLLKQIQLLKDSQSHPVPDLVSSSSDNSGIYR 126

Query: 124 FKDNWELAIYISTLPCGDASMDLLCQDESIIEMQDDDPIQFVDPAVTSIVRGRFNYSRRQ 183
             + W  A+YIS  PCGDASM LL  DE  I   DDD  Q+VD    +I+RGRFNY+++ 
Sbjct: 127 LNEEWSFALYISRAPCGDASMGLL-YDEGCISFTDDDRCQYVDDNNKTIIRGRFNYAKKG 185

Query: 184 VVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTTDL--- 240
            VRTKPGR DS++TL KSC+DKLC +QV+SILN +TW LL  PV+L+Y+V P    +   
Sbjct: 186 YVRTKPGRKDSKVTLSKSCTDKLCSKQVLSILNSLTWDLLEAPVFLEYIVIPQLPRVAEA 245

Query: 241 -LHQSFYDRIK-VLPNVPLKVLQCSYQFEHDKHSSEEEPSAMSSIKL-YSTPESTVEQAL 297
              ++F  RIK  +P   +++L CS +F+ DK    + PS MSSI L     + T +Q++
Sbjct: 246 DFERAFDTRIKDSVPMEKVQILSCSQRFDDDKTYENQPPSLMSSILLNIIEGQVTQQQSI 305

Query: 298 LNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNALIQ 357
           LNG+K G + K   PL++NCE  VSR +QW LFK ++    + TY +FK+   DRNAL +
Sbjct: 306 LNGVKCGAFVKPPNPLKKNCETVVSRASQWSLFKQIKGGVDSQTYREFKSQQTDRNALKE 365

Query: 358 DCRKLLSPKGWISTSRDDC 376
             R  LS  GW+ T  DDC
Sbjct: 366 RIRLALSKDGWVGTESDDC 384

>Ecym_2596 Chr2 complement(1159583..1160746) [1164 bp, 387 aa] {ON}
           similar to Ashbya gossypii AFR267W
          Length = 387

 Score =  344 bits (882), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 179/379 (47%), Positives = 244/379 (64%), Gaps = 8/379 (2%)

Query: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIATGVKAL 65
           L   +++ V++ Y  L  S KP  +SNG+KEWTVLAGIVAID+  ++LRLIS+ATGVKAL
Sbjct: 8   LAEGVSELVIKQYDSLKISNKPSIKSNGIKEWTVLAGIVAIDENTNELRLISVATGVKAL 67

Query: 66  PDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQLFHFK 125
           P+  L RS G+M+HD HAEILALRAFN V+L Q+A L +N     DLVER +    +  +
Sbjct: 68  PNEELERSHGRMLHDSHAEILALRAFNVVLLKQMALLAANPTETCDLVERCNTTHPYRMR 127

Query: 126 DNWELAIYISTLPCGDASMDLLCQDES-IIEMQDDDPIQFVDPAVTSIVRGRFNYSRRQV 184
             W++A+YIS  PCGD SMD+L +D++  ++   DD  Q+++P + + +RGRFNY  + V
Sbjct: 128 KRWKIALYISRPPCGDCSMDILGEDDTNYMQFSFDDCCQYINPGIRTTLRGRFNYDCKGV 187

Query: 185 VRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPN-----TTD 239
            RTKPGR DS+ITL KSCSDKL  +QVISILN   WKLL  PV+L YLV P       +D
Sbjct: 188 TRTKPGRPDSKITLSKSCSDKLASKQVISILNSTNWKLLETPVFLSYLVLPQHHREKASD 247

Query: 240 LLHQSFYDRIKVLPNV-PLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTP-ESTVEQAL 297
              ++F+ R+  L  V  ++++ CS +F  DK    + P  +S + +   P E  +E+ +
Sbjct: 248 GCLRNFHYRLLGLNEVHSIEMIFCSKKFNGDKEEESQTPCPISGVYINIKPMEMDIEEGI 307

Query: 298 LNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNALIQ 357
           LNG+ NGFY K  +PLR+NCE  +SR + W LF  L     + +YL FK+    RN L +
Sbjct: 308 LNGVLNGFYVKATRPLRKNCESILSRSSFWTLFTQLGYYVNSNSYLDFKSKQTSRNQLKE 367

Query: 358 DCRKLLSPKGWISTSRDDC 376
             R  LS  GWI TS DDC
Sbjct: 368 QVRLHLSSDGWIPTSADDC 386

>Suva_7.18 Chr7 (37929..39086) [1158 bp, 385 aa] {ON} YGL243W (REAL)
          Length = 385

 Score =  342 bits (877), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 190/383 (49%), Positives = 254/383 (66%), Gaps = 15/383 (3%)

Query: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNS--DLRLISIATGVK 63
           L  +I+ KV+  Y KL + C+P TR +G++EWT+LAG+ AI++  S  +++++SIATGVK
Sbjct: 7   LAEQISTKVIGEYSKLKAVCRPVTRPSGIREWTILAGVAAINRNASADNIKVLSIATGVK 66

Query: 64  ALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASE-DQLF 122
           +LPD+ L RS GK++HDCHAEILALR  N V L+ I   + +  N  DL+E  +E    F
Sbjct: 67  SLPDSELQRSRGKLLHDCHAEILALRGANTVFLNHIK--DWDLTNGDDLIESNNEIPPKF 124

Query: 123 HFKDNWELAIYISTLPCGDASMDLL---CQDESIIEMQDDD-PIQFVDPAVTSIVRGRFN 178
             KD WELA+YIS LPCGDASMD L   C+ +      DDD   Q+VDP V +I+RGR N
Sbjct: 125 RLKDKWELALYISKLPCGDASMDFLNDNCRSDDDFLEIDDDDTFQYVDPDVKTILRGRLN 184

Query: 179 YSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPN-- 236
           + ++ VVRTKPGR+DS ITL KSCSDKL  RQ  SILN +   L  +PV+L+Y+V PN  
Sbjct: 185 FGKKSVVRTKPGRYDSNITLSKSCSDKLLMRQSSSILNSLNSALFAQPVFLRYIVIPNLD 244

Query: 237 --TTDLLHQSFYDRIKVLPNVPLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPESTVE 294
             T   L QSF++R+    +   + L C   F  DK      PS M S KL+   +STVE
Sbjct: 245 EKTRHTLEQSFHNRLPFCSHR-FEFLNCHTPFYDDKKDENSVPSLMCSTKLFMN-DSTVE 302

Query: 295 QALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNA 354
           +A+LNG+KNGFYTK  KPLR++CE  +SR+AQW+LF  ++PE+ + +YLQFKA   +RN 
Sbjct: 303 EAILNGMKNGFYTKPCKPLRKHCESHLSRFAQWELFTQIKPEYKDTSYLQFKAQQTERNQ 362

Query: 355 LIQDCRKLLSPKGWISTSRDDCE 377
           LI   +  LSP GWI T  DD +
Sbjct: 363 LITLIKGALSPDGWIPTKTDDVK 385

>KLLA0A00759g Chr1 (74187..75329) [1143 bp, 380 aa] {ON} similar to
           uniprot|P53065 Saccharomyces cerevisiae YGL243W TAD1
           tRNA-specific adenosine deaminase deaminates
           adenosine-37 to inosine in tRNA-Ala
          Length = 380

 Score =  341 bits (874), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 179/381 (46%), Positives = 247/381 (64%), Gaps = 15/381 (3%)

Query: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIATGVKAL 65
           + +RIA  V+  Y KL  S KPG RSNGV EWTVL+GIVA D+ N     IS+ TGVKA 
Sbjct: 4   IADRIAASVISAYDKLPKSGKPGIRSNGVTEWTVLSGIVAFDELNDRYEPISLGTGVKAT 63

Query: 66  PDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQLFHFK 125
           P+  L RS G++VHDCHAE++ LRAFNA++L +I  L +   +   L+E++++   +  K
Sbjct: 64  PNEELQRSNGQIVHDCHAEVICLRAFNALLLKEICDLQNGQKS--FLIEKSADG--YKVK 119

Query: 126 DNWELAIYISTLPCGDASMDLL-CQDESIIE-MQDDDPI----QFVDPAVTSIVRGRFNY 179
           D W+ A+YIS +PCGDASM+LL  +D+S  E  Q    I    Q+V P + +I+RGR NY
Sbjct: 120 DVWKFAMYISRIPCGDASMNLLEAEDKSECENCQQVGNIFINGQYVHPEIDTIIRGRANY 179

Query: 180 SRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTTD 239
             R+VVRTKPGR DS+ITL KSCSDKL  +Q+ISI N +TW LL  PVYL+++V P    
Sbjct: 180 KLRKVVRTKPGRADSKITLSKSCSDKLTMKQMISICNALTWSLLQSPVYLEWIVLPKQYQ 239

Query: 240 L----LHQSFYDRIKVLPNVPLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPESTVEQ 295
                L  +F+ R+K    +P K L C+  F  D+ +  ++PS  S + LY + E+ V +
Sbjct: 240 YEQVQLEDTFWLRLKNQQFLPFKFLFCNETFSADRTNLSQQPSLSSCVSLYGSNEA-VSE 298

Query: 296 ALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNAL 355
            +LNG+KNGFY KG KPLR+ C+  +SR AQW  FK ++   ++  Y  FK+++ DRN +
Sbjct: 299 VILNGVKNGFYVKGKKPLRKGCQSIISRCAQWSAFKKIKAMPSDTDYYGFKSSVVDRNHI 358

Query: 356 IQDCRKLLSPKGWISTSRDDC 376
           I   +  LS  GWIST RD+C
Sbjct: 359 ISKAKATLSASGWISTCRDNC 379

>Kwal_47.19263 s47 complement(1160721..1161872) [1152 bp, 383 aa]
           {ON} YGL243W (TAD1) - tRNA-specific adenosine deaminase
           1 (TAD1); Tad1p/scADAT1 [contig 344] FULL
          Length = 383

 Score =  340 bits (873), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 181/377 (48%), Positives = 240/377 (63%), Gaps = 9/377 (2%)

Query: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIATGVKAL 65
           L ++I+      Y KL  S KP  RSNGVKEW VLA ++AI   +  LRL+S+ATGVK+ 
Sbjct: 7   LADKISDLAFSYYEKLKPSAKPVIRSNGVKEWNVLACVIAIGP-DQGLRLVSLATGVKST 65

Query: 66  PDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYL-NSNSDNQIDLVERAS-EDQLFH 123
           P+  L RS G+++HDCHAEILALR FN V+L QI  L +  +    DLV  +S ED  F 
Sbjct: 66  PNDELKRSNGRILHDCHAEILALRGFNMVLLKQIQMLVDPKAAVVPDLVSPSSDEDGKFK 125

Query: 124 FKDNWELAIYISTLPCGDASMDLLCQDESIIEMQDDDPIQFVDPAVTSIVRGRFNYSRRQ 183
             D+W  A+YIS +PCGDASMDLL Q ES +E  +D   Q+V+P   +I+RGRFNY++R 
Sbjct: 126 LGDDWSFALYISRIPCGDASMDLL-QSESDMEFSEDTSCQYVNPCNRTILRGRFNYNKRG 184

Query: 184 VVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTTDL--- 240
            VRTKPGR DS +TL KSCSDKLC RQV+SILN MTW L+  P++LKY+V P  ++    
Sbjct: 185 YVRTKPGRKDSSLTLSKSCSDKLCYRQVMSILNAMTWDLMESPIFLKYIVVPKVSNTARR 244

Query: 241 -LHQSFYDRIKVLPNV-PLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPESTVEQALL 298
               +F DR++  P +  +++L+C  QF  DK    + PS++S I L +      +Q++L
Sbjct: 245 GFESAFKDRLREFPGIKSVELLECPKQFPDDKFELNQVPSSVSGILLNTNDGQPEQQSIL 304

Query: 299 NGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNALIQD 358
           NG+K+G Y +  KPLR+NCE  +SR AQW LFK ++      +Y  FK     RN L   
Sbjct: 305 NGVKSGAYVREPKPLRKNCETMISRLAQWTLFKKVKDYSDKKSYQAFKGEQVARNVLKNK 364

Query: 359 CRKLLSPKGWISTSRDD 375
            R  LS  GWIST  DD
Sbjct: 365 VRSSLSSDGWISTGPDD 381

>KNAG0I00240 Chr9 (30503..31678) [1176 bp, 391 aa] {ON} Anc_3.566
           YGL243W
          Length = 391

 Score =  337 bits (863), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 179/385 (46%), Positives = 247/385 (64%), Gaps = 17/385 (4%)

Query: 6   LGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAID-KKNSDLRLISIATGVKA 64
           LGN IA  V   Y +L +S KP  RSNG KEWT+L+G+VA+       LRLIS+ TGVKA
Sbjct: 5   LGNEIADLVYSEYDRLSTSSKPAVRSNGTKEWTILSGLVAVPLHPGPQLRLISLTTGVKA 64

Query: 65  LPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASED-QLFH 123
            P+  L RS G+++HDCHAEILALR FN V+L Q+    +N  ++ DL+    +D   F 
Sbjct: 65  TPNQDLERSQGRVLHDCHAEILALRGFNYVLLRQMQAARNN--DRCDLILPGIQDTNKFR 122

Query: 124 FKDNWELAIYISTLPCGDASMDLLCQDESIIE----MQDDDPIQFVDPAVTSIVRGRFNY 179
               ++LA++IS LPCGD SM+ L +   + +    + DDDP+Q++DP   S++RGRFNY
Sbjct: 123 LNPEYQLALFISRLPCGDGSMNSLQEQGGLGQDTNGIDDDDPVQYIDPNNRSLLRGRFNY 182

Query: 180 SRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTT- 238
           +++  VRTKPGR DS+IT  KSCSDKLC  Q  SILN  TW L+ + VY+ YL+ PN + 
Sbjct: 183 AKKGCVRTKPGRMDSKITYSKSCSDKLCCHQATSILNACTWPLIEEAVYIDYLIVPNISA 242

Query: 239 ---DLLHQSFYDRIK--VLPNVPLKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPESTV 293
              + L + F  R+     P   +++L C   F  D+   +E+PS++S +KLY T   T+
Sbjct: 243 SDRNALERCFTTRLSSATFPVHKMQILSCGQSFADDQQDEDEQPSSISCVKLYITEGETL 302

Query: 294 EQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTN--ATYLQFKATIQD 351
           EQA+L+G++NGF+TK +KPLR NCE AVSR +QW+LF TL PE +N   +Y  FK+ +  
Sbjct: 303 EQAVLSGIRNGFFTKVSKPLRNNCETAVSRLSQWRLFCTLNPEASNKYTSYRDFKSKLVP 362

Query: 352 RNALIQDCRKLLS-PKGWISTSRDD 375
           R  LI   R LL+  + WI T  DD
Sbjct: 363 RAELITRTRSLLTNGQPWIPTCSDD 387

>AFR267W Chr6 (914618..915775) [1158 bp, 385 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL243W (TAD1)
          Length = 385

 Score =  322 bits (826), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 173/379 (45%), Positives = 229/379 (60%), Gaps = 4/379 (1%)

Query: 1   MDDVSLGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIAT 60
           MDD  L   I  +V+  Y     S KP  RSNG  EWTVLAG+V +D++ ++ RL+S AT
Sbjct: 1   MDDDKLAEAICAQVIRQYGNFKPSSKPARRSNGSHEWTVLAGVVLVDRQTAECRLVSAAT 60

Query: 61  GVKALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQ 120
           GVKALPD  L RS G+MVHD HAEILALR FNAV+L Q   +      + DLVE+A    
Sbjct: 61  GVKALPDKELERSHGRMVHDSHAEILALRGFNAVLLQQAKLVTDGRSAECDLVEQAKTQD 120

Query: 121 LFHFKDNWELAIYISTLPCGDASMDLLCQDESIIEMQDDDPIQFVDPAVTSIVRGRFNYS 180
            F     W+ A+YIS  PCGD SMD+   D   +    DDPIQ+V     +++RGRFNYS
Sbjct: 121 RFRLASRWQAALYISKAPCGDCSMDMADDDADEMTFSPDDPIQYVAEHNYTMLRGRFNYS 180

Query: 181 RRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNT--T 238
           R+ V RTKPGR DSQITL KSCSDKL  + V+S+L+ MTW+L  +PV+L YLV P+T  T
Sbjct: 181 RKGVARTKPGRADSQITLSKSCSDKLASKTVMSLLSSMTWELFEEPVFLDYLVLPHTIAT 240

Query: 239 DLLHQSFYDRIKVLPNVPL-KVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPESTVEQAL 297
               + F +R+  L    + ++L C   F  D+ + ++ P+  +S+ L  T +  VEQAL
Sbjct: 241 AGFERCFAERLAGLEGTHMPRLLCCHTAFPGDRAAPQQPPALTASVYLNITAKKHVEQAL 300

Query: 298 LNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNALIQ 357
           LNG++NG Y +  + L  + E  VSR A W++F  L  +    +Y  FK     RN L +
Sbjct: 301 LNGVRNGAYVRPPRALAAHAETIVSRAALWRVFMQLH-QAPPLSYAAFKRQQHARNRLKR 359

Query: 358 DCRKLLSPKGWISTSRDDC 376
             R  LSP GW +T  DDC
Sbjct: 360 HVRHRLSPDGWPTTRVDDC 378

>TBLA0E00230 Chr5 (35169..36353) [1185 bp, 394 aa] {ON} Anc_3.566
           YGL243W
          Length = 394

 Score =  320 bits (821), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 172/392 (43%), Positives = 250/392 (63%), Gaps = 17/392 (4%)

Query: 1   MDDVSLGNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDL-RLISIA 59
           MD   LG++IA  +   Y KL  S KP  +SNG+KEWT+++GIVA+  K++++ ++IS+A
Sbjct: 1   MDKRELGDKIAALLFREYNKLKKSNKPIKKSNGIKEWTIISGIVAVSNKDTNIIKVISLA 60

Query: 60  TGVKALPDAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERA--S 117
           TGVKA PD+ L RS G +VHDCHAEILA+R FN  +L +I     +  N  DL+ +   S
Sbjct: 61  TGVKATPDSELKRSQGSIVHDCHAEILAIRGFNTTLLREIENKEIDDTNSCDLIYKVENS 120

Query: 118 EDQLFHFKDNWELAIYISTLPCGDASMDL--LCQDESIIEMQDDDPIQFVDPAVTSIVRG 175
           + + + + D ++L +YIS LPCGD+SM+     +  S+I+ Q++D  Q+VDP + +I+RG
Sbjct: 121 KCKKYSWNDEYDLGLYISKLPCGDSSMEEENSLESNSLIQFQENDLTQYVDPTIRTILRG 180

Query: 176 RFNYSRRQVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTP 235
           R NY++   VRTKPGR DS+IT  KSCSDK+C +QV+S+LN +  +LL  P+Y+KYLV P
Sbjct: 181 RINYNKSGCVRTKPGRIDSEITFSKSCSDKICIKQVLSLLNSLNTELLESPIYIKYLVCP 240

Query: 236 NTTD----LLHQSF--YDRIKVLPNV-----PLKVLQCSYQFEHDKHSSEEEPSAMSSIK 284
           +       LL +SF   + IK+  +      PL  +  S QF+  K +  +EPS  S +K
Sbjct: 241 DIKPQNLILLKKSFNRIENIKLEVSSSYRYHPLSFIPSSIQFQDGKTNDLQEPSFTSVVK 300

Query: 285 LYSTPES-TVEQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYL 343
           ++++ +   +EQ+++NG+K G YTK +KPL +N    VSR  QW +FK + PEF   +YL
Sbjct: 301 IFNSNDKFGLEQSIVNGVKMGAYTKKSKPLSKNAMTIVSRTFQWNIFKNIMPEFEQYSYL 360

Query: 344 QFKATIQDRNALIQDCRKLLSPKGWISTSRDD 375
            FK    DR       RK LS  GWIST  DD
Sbjct: 361 TFKRFQTDRIETRNRIRKCLSQDGWISTFNDD 392

>CAGL0H07733g Chr8 (754933..756090) [1158 bp, 385 aa] {ON} similar
           to uniprot|P53065 Saccharomyces cerevisiae YGL243w TAD1
          Length = 385

 Score =  294 bits (752), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 159/385 (41%), Positives = 231/385 (60%), Gaps = 23/385 (5%)

Query: 7   GNRIAQKVLEGYRKLGSSCKPGTRSNGVKEWTVLAGIVAIDKKNSDLRLISIATGVKALP 66
           G +I + VL  Y KL +  +P TRSNG KE T++A ++A D +     +++I TGVK+ P
Sbjct: 8   GTKITELVLSEYEKLSAKGRPVTRSNGAKEGTIVAAVIASDTRTDKHSILTITTGVKSTP 67

Query: 67  DAFLHRSGGKMVHDCHAEILALRAFNAVILDQIAYLNSNSDNQIDLVERASEDQLFHFKD 126
           +  L RS GK++HDCHAEILALR FN ++L+ I    S    + +L+        F + +
Sbjct: 68  NDELARSKGKILHDCHAEILALRGFNRLLLEHIK--RSMEGIESNLIHNTPNG--FEWNN 123

Query: 127 NWELAIYISTLPCGDASMDLL----CQDESIIEMQDDDPIQFVDPAVTSIVRGRFNYSRR 182
             EL ++IS LPCG+ SM LL    C+DE+ +  ++DD  Q++ P + +I+RGR N+++R
Sbjct: 124 ELELTLFISKLPCGELSMSLLEEMKCEDENSLTFEEDDNQQYITPEIKTILRGRCNFNKR 183

Query: 183 QVVRTKPGRFDSQITLCKSCSDKLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTTDLLH 242
             VRTKPGR DS+ T  KSCSDKL  R   S+LN +T  ++  P+Y+   V PN     H
Sbjct: 184 NYVRTKPGRIDSKATYSKSCSDKLYIRHKTSVLNSLTSYMMPTPLYISNYVIPNINS--H 241

Query: 243 QSFYDRIKVLPNVP---------LKVLQCSYQFEHDKHSSEEEPSAMSSIKLYSTPESTV 293
           Q   + + +  N P         L +    Y+F  D  S E  PS+MS++K+        
Sbjct: 242 Q--IEEMNLYFNRPMDLHSSARRLYIHTSHYKF-GDDLSPETPPSSMSALKILFNDNDIQ 298

Query: 294 EQALLNGLKNGFYTKGNKPLRRNCEPAVSRYAQWQLFKTLRPEFTNATYLQFKATI-QDR 352
           E+ +LNG+KNG+YTK +KPLR+NCE  VSRY+ W LF T+  EF + TYL+FK     +R
Sbjct: 299 EEQILNGVKNGYYTKASKPLRKNCESKVSRYSLWSLFITMHREFKDLTYLEFKRRYCAER 358

Query: 353 NALIQDCRKLLSPKGWISTSRDDCE 377
             LI+  +  LS  GW+ST+ DDC+
Sbjct: 359 AELIRSIKSSLSSDGWLSTAEDDCQ 383

>Suva_10.140 Chr10 (255480..256577) [1098 bp, 365 aa] {ON} YLR056W
           (REAL)
          Length = 365

 Score = 32.3 bits (72), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 27/43 (62%), Gaps = 3/43 (6%)

Query: 320 AVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNALIQDCRKL 362
           A S  A+WQ + TL   FTN+T LQ   T+  +NA +++CRK 
Sbjct: 26  AASIPAKWQEWLTLNSGFTNSTILQ--QTLSSKNA-VKECRKF 65

>KNAG0J01840 Chr10 complement(334573..336525) [1953 bp, 650 aa] {ON}
           Anc_8.698 YOR254C
          Length = 650

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 48/111 (43%), Gaps = 15/111 (13%)

Query: 260 LQCSYQFEHDKHSSEEEPSAMSSIKLYS-TPESTVEQALLNGLKNGFYTKGNKPLRRNCE 318
           +  SY ++    SSE  P  + +I L S  P + VE   L    +G  ++G K       
Sbjct: 1   MALSYDYDE---SSETWPFFLLTILLVSLVPLTAVEVYHLVWAPSGEDSRGGKAADGG-- 55

Query: 319 PAVSRYAQWQLFKTLRPEFTNATYLQFKATIQDRNALIQDCRKLLSPKGWI 369
                    QL  +L  EFT +  ++F+   Q + +++   R LL   GWI
Sbjct: 56  ---------QLLASLNDEFTESEIVRFRKKFQRKRSVLFKKRTLLLVSGWI 97

>Kwal_23.5258 s23 (1079727..1081307) [1581 bp, 526 aa] {ON} YNL291C
           (MID1) - N-glycosylated integral plasma membrane protein
           [contig 8] FULL
          Length = 526

 Score = 30.8 bits (68), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 24/49 (48%), Gaps = 2/49 (4%)

Query: 311 KPLRRNCEPAVSRYAQWQLFKTL-RPEFTNATYLQFKATIQDRNALIQD 358
            PLR NC+   S Y  W    T+ R   TN TY + +   Q+RN  + D
Sbjct: 407 SPLR-NCDDCASAYRNWLCAVTIPRCTTTNTTYYRHRDKTQNRNDFLND 454

>Kpol_388.11 s388 complement(31022..33355) [2334 bp, 777 aa] {ON}
           complement(31022..33355) [2334 nt, 778 aa]
          Length = 777

 Score = 30.4 bits (67), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 23/36 (63%)

Query: 205 KLCQRQVISILNCMTWKLLNKPVYLKYLVTPNTTDL 240
           K C+  ++++L   T   LNKP++++YL  P+ + L
Sbjct: 158 KCCETHLVTVLKLFTNSKLNKPIFVEYLDIPSYSLL 193

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 41,103,026
Number of extensions: 1764670
Number of successful extensions: 4878
Number of sequences better than 10.0: 29
Number of HSP's gapped: 4951
Number of HSP's successfully gapped: 29
Length of query: 377
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 266
Effective length of database: 40,753,473
Effective search space: 10840423818
Effective search space used: 10840423818
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)