Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0E09460g3.564ON1009100947920.0
TDEL0D063203.564ON1018101722000.0
NCAS0F039503.564ON1012101620770.0
NDAI0B062603.564ON1013102620610.0
Smik_7.203.564ON1004100520210.0
Kpol_380.63.564ON1002100519880.0
YGL241W (KAP114)3.564ON1004100919800.0
KAFR0J001903.564ON1012103219260.0
Suva_7.203.564ON1008101019140.0
Skud_7.263.564ON1015101018990.0
TPHA0G036303.564ON1022102718520.0
SAKL0F00880g3.564ON1009102317840.0
TBLA0E002403.564ON1010102317410.0
KNAG0D029403.564ON1009101517210.0
CAGL0H07777g3.564ON1021102717160.0
Ecym_25943.564ON1019101016210.0
AFR269W3.564ON1017100515790.0
Kwal_47.192583.564ON1011101315590.0
KLTH0G00792g3.564ON1021101015150.0
KLLA0A00803g3.564ON9528606484e-70
KAFR0H027008.624ON104192840.29
Kpol_530.128.624ON103076801.0
Ecym_83098.624ON102781781.4
NDAI0A001101.2ON21173751.6
CAGL0J06776g8.624ON1027103781.6
NDAI0E021708.624ON102981771.9
TPHA0C013907.201ON1123111762.4
Skud_16.1558.624ON1032104762.8
Kwal_26.85958.624ON103477763.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0E09460g
         (1009 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] ...  1850   0.0  
TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa]...   852   0.0  
NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {...   804   0.0  
NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa]...   798   0.0  
Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (R...   783   0.0  
Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON} ...   770   0.0  
YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}  KAP114Karyo...   767   0.0  
KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.5...   746   0.0  
Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (R...   741   0.0  
Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (R...   736   0.0  
TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {...   717   0.0  
SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar...   691   0.0  
TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.56...   675   0.0  
KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {...   667   0.0  
CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} simil...   665   0.0  
Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {...   629   0.0  
AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic h...   612   0.0  
Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa...   605   0.0  
KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar...   588   0.0  
KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar ...   254   4e-70
KAFR0H02700 Chr8 (512455..515580) [3126 bp, 1041 aa] {ON} Anc_8....    37   0.29 
Kpol_530.12 s530 (33954..37046) [3093 bp, 1030 aa] {ON} (33954.....    35   1.0  
Ecym_8309 Chr8 complement(629689..632772) [3084 bp, 1027 aa] {ON...    35   1.4  
NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  sil...    33   1.6  
CAGL0J06776g Chr10 (651309..654392) [3084 bp, 1027 aa] {ON} high...    35   1.6  
NDAI0E02170 Chr5 complement(445219..448308) [3090 bp, 1029 aa] {...    34   1.9  
TPHA0C01390 Chr3 (314359..317730) [3372 bp, 1123 aa] {ON} Anc_7....    34   2.4  
Skud_16.155 Chr16 (284989..288087) [3099 bp, 1032 aa] {ON} YPL12...    34   2.8  
Kwal_26.8595 s26 complement(855035..858139) [3105 bp, 1034 aa] {...    34   3.0  

>ZYRO0E09460g Chr5 complement(753030..756059) [3030 bp, 1009 aa] {ON}
            similar to uniprot|P53067 Saccharomyces cerevisiae
            YGL241W
          Length = 1009

 Score = 1850 bits (4792), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 915/1009 (90%), Positives = 915/1009 (90%)

Query: 1    MFDAPSLILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALL 60
            MFDAPSLILEAQSPLDNVRKSSEERLLQMCDE                  ELPSRQFALL
Sbjct: 1    MFDAPSLILEAQSPLDNVRKSSEERLLQMCDEDSSQVFVQFVQVAADTQQELPSRQFALL 60

Query: 61   TLRKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQIS 120
            TLRKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQIS
Sbjct: 61   TLRKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQIS 120

Query: 121  AVDFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHV 180
            AVDFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVIS            TLKIVFHV
Sbjct: 121  AVDFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISEEMFFEEGIGFETLKIVFHV 180

Query: 181  MNSYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNK 240
            MNSYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNK
Sbjct: 181  MNSYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNK 240

Query: 241  TISETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENS 300
            TISETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENS
Sbjct: 241  TISETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENS 300

Query: 301  SQDQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSF 360
            SQDQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSF
Sbjct: 301  SQDQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSF 360

Query: 361  VSKETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFXXXXXXXX 420
            VSKETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIF        
Sbjct: 361  VSKETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFNESLLYLL 420

Query: 421  XXXXXXXXXXXXFMDAVTRIFTKLQSILEKSLSCVFVNCRXXXXXXXXXXXXMDSFPNVR 480
                        FMDAVTRIFTKLQSILEKSLSCVFVNCR            MDSFPNVR
Sbjct: 421  QSLLLNEANSLEFMDAVTRIFTKLQSILEKSLSCVFVNCRIILLIPKLLEKIMDSFPNVR 480

Query: 481  DLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLIA 540
            DLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLIA
Sbjct: 481  DLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLIA 540

Query: 541  QLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIEL 600
            QLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIEL
Sbjct: 541  QLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIEL 600

Query: 601  QECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXXXXXXXXXXMKRKP 660
            QECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSP            MKRKP
Sbjct: 601  QECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPLLSLTLQVLGVLMKRKP 660

Query: 661  LDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNIL 720
            LDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNIL
Sbjct: 661  LDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNIL 720

Query: 721  DALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLLS 780
            DALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLLS
Sbjct: 721  DALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLLS 780

Query: 781  VFCFVTSADAQQTVDFLFNTTISNQNGLNLVMSKWLESFDVVRGEKRTKENIITLSKLFF 840
            VFCFVTSADAQQTVDFLFNTTISNQNGLNLVMSKWLESFDVVRGEKRTKENIITLSKLFF
Sbjct: 781  VFCFVTSADAQQTVDFLFNTTISNQNGLNLVMSKWLESFDVVRGEKRTKENIITLSKLFF 840

Query: 841  LNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGKHQ 900
            LNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGKHQ
Sbjct: 841  LNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGKHQ 900

Query: 901  DPQLLMAGTYGIXXXXXXXXXXXXXXXXXXXXGPLEYERLQHYVEEDETDDRGEELDEQC 960
            DPQLLMAGTYGI                    GPLEYERLQHYVEEDETDDRGEELDEQC
Sbjct: 901  DPQLLMAGTYGIETNTEENQDDDDNDDWEDVEGPLEYERLQHYVEEDETDDRGEELDEQC 960

Query: 961  LADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL 1009
            LADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL
Sbjct: 961  LADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL 1009

>TDEL0D06320 Chr4 complement(1134120..1137176) [3057 bp, 1018 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1018

 Score =  852 bits (2200), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/1017 (44%), Positives = 646/1017 (63%), Gaps = 12/1017 (1%)

Query: 1    MFDAPSLILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALL 60
            +FD+  LI EAQS  D VR+S+E +LL++ D                    L SRQFAL+
Sbjct: 6    LFDSQQLIKEAQSADDVVRRSAEAQLLELSDRDASLVFLSFMKVASDSQELLSSRQFALV 65

Query: 61   TLRKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQIS 120
            +LRKL+TMYW+PGFES+R  S +K EA+  +RD LL+LCL++ + SK+ + A+Y VVQIS
Sbjct: 66   SLRKLITMYWSPGFESYRSCSNLKEEAKETVRDYLLKLCLNDQEISKVISAAAYCVVQIS 125

Query: 121  AVDFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHV 180
            AVDFPDQWP+LL ++Y+ I+  HSL+AM LL EIYDDV+S            T++IVF +
Sbjct: 126  AVDFPDQWPKLLTVLYDGILNKHSLSAMSLLTEIYDDVMSEEMFFEEGIGLETIRIVFQI 185

Query: 181  MNSYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNK 240
            +   + N EAK+A  NL H C+ Q+ TV+ +S  KRKE+TVE  KE L +W   L  Q+ 
Sbjct: 186  VRDPNTNLEAKLAGFNLFHACLQQILTVDLNSAPKRKEMTVECAKEALTVWGEHL--QSH 243

Query: 241  TISE-TLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVEN 299
            +I+E +LQL    +IY+ L+L+KNE SKK++   +Y  F+ +V+ DLE A ++Y+ + + 
Sbjct: 244  SITEHSLQLQIKGRIYEDLSLMKNELSKKLIPDALYVPFKELVLIDLETAGKVYLSISQG 303

Query: 300  SSQD-QLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFN 358
              +  +LD +NE A++I+EFL++ C       E++ ++  L  LCCL+ DTV  W  DFN
Sbjct: 304  FVEGYRLDDLNECAIHIIEFLTATCHFTMDSAEVERIITALGELCCLDNDTVTLWLEDFN 363

Query: 359  SFVSKETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFXXXXXX 418
            S++S E+GL AS+++RDQA+ELL+S D ++Y+ V   +++++S ++++   W F      
Sbjct: 364  SYISMESGLTASYSVRDQASELLTSMDGRNYSLVCQHILYKVSHLNEWKQEWKFQESFLF 423

Query: 419  XXXXXXXXXXX-XXXFMDAVTRIFTKLQSILEKSLSCVFVNCRXXXXXXXXXXXXMDSFP 477
                           F++ +  + + L S+L       FV+ R            MD   
Sbjct: 424  LVQAAALNESLPSGNFINEIREVLSFLGSMLCSEDVVSFVSSRIILLLPKILEKYMDLLD 483

Query: 478  NVRDLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLK 537
            +VR L  + L  S + AL+ ++++IK++ LI+FTY S FAEL SVLG + C   Q++ L 
Sbjct: 484  DVRILTSHLLTKSAELALATNDDIIKASVLIAFTYCSNFAELSSVLGQEVCEITQKRVLG 543

Query: 538  LIAQLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTT 597
            LIA++  +AEDDTDGVLMEVL+NVIDCN+  V + + I+QTEF LV  IS+KDP+NIQ  
Sbjct: 544  LIARISEDAEDDTDGVLMEVLNNVIDCNTPGVPN-NEIVQTEFSLVLKISAKDPANIQIV 602

Query: 598  IELQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXXXXXXXXXXMK 657
            +E QECL KLL+N+D+  +  + E   P  +  + GSA + + YSP            +K
Sbjct: 603  VESQECLEKLLENLDIDHYKNYVETWLPSFMKSIEGSAQTKYAYSPLLSLVLQFLTTFLK 662

Query: 658  RKPLDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIV 717
             KP D  L   +CN  FEPL+ IL  S+D+E +Q ATEA  Y +YNT+  V+ PHL++IV
Sbjct: 663  -KPTDYQLPTVMCNLTFEPLRQILLNSEDDETIQLATEAFSYFLYNTDPTVVAPHLEAIV 721

Query: 718  NILDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQN 777
             ILD LLS  V D AA +VGSL VT+F++FS EI+N++P+IL+AAA RL QA +++T+QN
Sbjct: 722  AILDRLLSFDVSDAAAMYVGSLIVTVFTRFSTEIENMMPIILRAAANRLIQAKHLSTSQN 781

Query: 778  LLSVFCFVTSADAQQTVDFLFNTTISN--QNGLNLVMSKWLESFDVVRGEKRTKENIITL 835
            LLSVFCF+TS D +QTVDFLF   + N   N L  ++S WLESF+ +RGE+RTKEN+I L
Sbjct: 782  LLSVFCFLTSVDPRQTVDFLFGLHLDNTEHNALYSIVSIWLESFESIRGERRTKENVIAL 841

Query: 836  SKLFFLNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEF 895
             KL+ L+D+RL  MQVN ++IPYE + IITRSMAK+MPDRY+QVSVY KIIKLF +EL F
Sbjct: 842  IKLYLLHDKRLMEMQVNDEIIPYEGEQIITRSMAKKMPDRYSQVSVYTKIIKLFVAELNF 901

Query: 896  QGKHQDPQLLMAGTYGIXXXXXXXXXXXXXXXX-XXXXGPLEYERLQHYVEEDETDDRGE 954
            Q K  DP+  +                             L YE+LQ YV+E + D  G 
Sbjct: 902  QDKQPDPERFITSDMAKEGNNGNSDNDTDSDGEWEDVEDVLNYEKLQEYVDESDQDGEGS 961

Query: 955  ELDE--QCLADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL 1009
            + D+      D   + SV  +LV FFKEVAA N  GF+ IY  L++ EK+ILSENL+
Sbjct: 962  DSDDFFASAIDEYSNASVRDILVSFFKEVAANNTGGFRDIYNSLTEVEKKILSENLV 1018

>NCAS0F03950 Chr6 complement(791754..794792) [3039 bp, 1012 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1012

 Score =  804 bits (2077), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/1016 (42%), Positives = 634/1016 (62%), Gaps = 14/1016 (1%)

Query: 3    DAPSLILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALLTL 62
            D   LI +AQS     R+++E +L   CD+                   L +RQF+LLT+
Sbjct: 2    DIYQLITQAQSSDTQTREAAENQLSSSCDQNASQIFTSLMSVALDPKSPLSTRQFSLLTI 61

Query: 63   RKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAV 122
            RK +TMYW+PGF+S+R TST++   +  IR+ LLQLCLD+ Q +KI+N ASY +VQISAV
Sbjct: 62   RKFITMYWSPGFQSYRNTSTIQENTKEYIRNSLLQLCLDDAQDTKIKNSASYCIVQISAV 121

Query: 123  DFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHVMN 182
            DFPDQWP+LL+ +Y AI ++HSL A+ LLNEIYDDVIS            TL+I+F ++ 
Sbjct: 122  DFPDQWPQLLSTIYMAIEQNHSLNALSLLNEIYDDVISEEMFFEGQIGMETLQIIFQLLT 181

Query: 183  SYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNKTI 242
            + +AN +AK+A   L + C+LQMS V+ SS   RKE   E   + L++    L     + 
Sbjct: 182  NNNANLKAKIAGTKLFNACLLQMSVVDSSSKHNRKEFVKECIFKALEVLGQLLELYPVS- 240

Query: 243  SETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENSSQ 302
            +++L L    KIY+ + L+ NEFS+K+        ++    RDLE  S  +   +EN SQ
Sbjct: 241  NDSLILNLRTKIYENVVLISNEFSRKLFTQAFKGLYKLQSFRDLEACSNQFNAFLENLSQ 300

Query: 303  ---DQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNS 359
               D L+++NE  +++L+FL+S+ D  FT +E+  +++ L+ LCCL+ DT++ W  DFN 
Sbjct: 301  ADNDILESMNECVIHVLDFLTSISDSDFTMQEINLIVQSLTFLCCLDSDTLEQWSEDFND 360

Query: 360  FVSKETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEI--SQISDFSDGWIFXXXXX 417
            FVSKETGL+ASFTIRDQAAE +S   + +Y+     +  ++  S   D +D         
Sbjct: 361  FVSKETGLLASFTIRDQAAEFMSGLSNPNYSNFFNSIYAQVIYSLTGDVNDNLRESLLYL 420

Query: 418  XXXXXXXXXXXXXXXFMDAVTRIFTKLQSILEKSLSCVFVNCRXXXXXXXXXXXXMDSFP 477
                            ++  + I  +  S+ E  L   F+  R            MD   
Sbjct: 421  LQTLLTNEEDNDHDINIEP-SVILKQFSSVFENGLQKTFLLSRIILLTPKLLEKFMDQLQ 479

Query: 478  NVRDLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLK 537
            +V+ L  N+L  +LD AL   NE+IKS+++I+FTYYSYFAELPSVLGP+ C  VQ+ TLK
Sbjct: 480  DVKQLTGNYLRRTLDLALETHNEIIKSSSIIAFTYYSYFAELPSVLGPELCSIVQENTLK 539

Query: 538  LIAQLYPEAEDDTDGVLMEVLDNVIDCN-SENVDDTSSIIQTEFHLVFTISSKDPSNIQT 596
            +I++L  EAE+DT+G+LME L+ +I CN  EN+  +  I+QTEF+LV +ISSKDP+N+Q 
Sbjct: 540  IISELSKEAEEDTNGLLMETLNQIISCNVHENL--SPEILQTEFNLVLSISSKDPANVQV 597

Query: 597  TIELQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXXXXXXXXXXM 656
            T+E Q+CL  LL+ ++ +T++ + +IC P  ++ +  SA + + Y+P            M
Sbjct: 598  TVEAQDCLEHLLEGMNTETYLHYVDICLPSFIHTIDASAINQYRYTPVLSLILEFLTIFM 657

Query: 657  KRKPLDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSI 716
            K+KP+D  L  +I +  F+ L N+L+ S ++E LQ AT+A  Y++YNTE   ++P L+ I
Sbjct: 658  KKKPVDGFLPTSISDFSFKSLCNLLSLSTEDETLQLATDAFSYMVYNTEPSAMVPKLQDI 717

Query: 717  VNILDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQ 776
            +N+LD LLS  V D AA +VG+L VT+FSKFSNEIQ LIP IL+AA  RL QA NI+T Q
Sbjct: 718  INVLDRLLSINVSDTAAMNVGTLVVTLFSKFSNEIQPLIPTILRAAVGRLIQAQNISTQQ 777

Query: 777  NLLSVFCFVTSADAQQTVDFLFNTTISNQNGLNLVMSKWLESFDVVRGEKRTKENIITLS 836
            NL+S+ CF+T +D +Q +D L+N   S+ +    VM+KW ESF+ +RGEK+ KENI+ LS
Sbjct: 778  NLVSLLCFLTCSDPKQVIDLLYNFD-SDHSTFTKVMNKWFESFETIRGEKKIKENIVALS 836

Query: 837  KLFFLNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQ 896
            KL+F  D+RL  + VNGDLIPY+ D+IITRSMAK+MPD+YTQ+  + KI+KLFT+EL FQ
Sbjct: 837  KLYFTGDERLGKLIVNGDLIPYDGDLIITRSMAKKMPDKYTQIPAFTKIVKLFTTELGFQ 896

Query: 897  GKHQDPQLLMAG---TYGIXXXXXXXXXXXXXXXXXXXXGPLEYERLQHYVEEDETDDRG 953
             K  D ++L+                               L+YE+L+ +V++++  D G
Sbjct: 897  NKQPDSKILLESDIKNVDTSNNKTSEEAAGDDDEWEDVDDVLDYEKLREFVDDEDPADFG 956

Query: 954  EELDEQCLADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL 1009
            E   ++    +    ++ +LLV+FFK+VAA++++GF +IY  LS+NEK+IL+ENL+
Sbjct: 957  ENDSDEITGLDTLKETIPELLVEFFKDVAARDLNGFHNIYNTLSENEKRILTENLV 1012

>NDAI0B06260 Chr2 complement(1515207..1518248) [3042 bp, 1013 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1013

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/1026 (42%), Positives = 639/1026 (62%), Gaps = 33/1026 (3%)

Query: 3    DAPSLILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALLTL 62
            D   LI++AQS  + VR ++E +LLQ CD                   ++ SRQFALL+L
Sbjct: 2    DINQLIVQAQSSDNAVRDAAESQLLQACDTNAAQIFTSLMKGACDGNTDIASRQFALLSL 61

Query: 63   RKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAV 122
            RKL+TMYW+PGFES+R TST+  + +  IR+ LL +CLD+ Q SKI   A+Y VVQISAV
Sbjct: 62   RKLITMYWSPGFESYRNTSTINDQTKEYIRESLLNICLDDLQDSKITKSAAYCVVQISAV 121

Query: 123  DFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHVMN 182
            DFPDQWP+LL I+Y+ I +SHSL AM LLNEIYDDV+S            TL+I+F V++
Sbjct: 122  DFPDQWPQLLVILYDTISQSHSLNAMSLLNEIYDDVVSEEMFFEGQIGMETLQIIFQVLS 181

Query: 183  SYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFL------- 235
            + +   EAK+AA  L + CILQMS ++ SS+ KRK+L  E   + +Q+    L       
Sbjct: 182  NNEGKIEAKIAATKLFNACILQMSVLDPSSSLKRKKLAEECIPKSIQVLGQLLEYYTIDT 241

Query: 236  TTQNKTISETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIY-- 293
            T  +K ++  L+L +  KIY+ + L+KNE  K++   ++   F+   ++DL ++  +Y  
Sbjct: 242  TVDSKMLTSILELRS--KIYENVVLIKNELPKRLFQRNLMASFKFQTLKDLSSSCTLYET 299

Query: 294  --MQMVENSSQDQL-DAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTV 350
              +  +E  + D L DA++E ++++L+FL++ C ++F   E+ T+++ L+ LCCL+ D+ 
Sbjct: 300  YCLNNIEVVNSDNLHDALSECSIHMLDFLTATCSLKFDNSEVSTIVQDLTVLCCLDNDSQ 359

Query: 351  DSWQTDFNSFVSKETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHE-ISQISDFSDG 409
            +    DFN+FVSKETGL+ S+TIRDQA+E L+S    +YAT+L  +++  IS ++  S  
Sbjct: 360  EELAADFNAFVSKETGLLPSYTIRDQASEFLNSLSDPNYATILQAIINTFISTMNQPSRN 419

Query: 410  WIFXXXXXXXXXXXXXXXXXXXXFMDAVTRI-----FTKLQSILEKSLSCVFVNCRXXXX 464
                                     D VT I        L S+ +      F++ R    
Sbjct: 420  DRILESILYLLQSLMTNE-------DDVTNINPNILLEPLSSLFDYETENPFLHSRLILL 472

Query: 465  XXXXXXXXMDSFPNVRDLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLG 524
                    MD  PNV+ + ++FL  SL ++L  ++ L K + LI +TYY+YFAELPSVLG
Sbjct: 473  IPKILEKFMDEIPNVKVVTKDFLTKSLKYSLQMNDGLNKISALIGYTYYAYFAELPSVLG 532

Query: 525  PDNCIQVQQKTLKLIAQLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVF 584
             D C QVQ+  L LI Q+  E+E+DT G+L+EVL++VIDCN E++     I++TEF++V 
Sbjct: 533  RDVCTQVQENILLLITQVVHESEEDTHGLLVEVLNHVIDCNPEDIA-VQGILETEFYMVL 591

Query: 585  TISSKDPSNIQTTIELQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPX 644
            +ISSKDP+NIQ  I  +ECL KLL+ V+ +T+  + ++C P  +NV+ G + + ++YSP 
Sbjct: 592  SISSKDPANIQVAIGSEECLEKLLEGVNTRTYTHYIDMCLPSFINVIKGHSVTEYKYSPL 651

Query: 645  XXXXXXXXXXXMKRKPLDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNT 704
                       MK+KP D  L   I   +F+PL N+LN S ++E LQ AT+A  YL+YNT
Sbjct: 652  LSLILEFVTVFMKKKPTDGPLPAIIFEHIFQPLLNVLNHSTEDETLQLATDAFSYLLYNT 711

Query: 705  EAEVILPHLKSIVNILDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAA 764
            ++ +++PHL+ IV +LD LLS  V D AA +VG+L VTIFSKFSNE+Q+LIP IL+AA  
Sbjct: 712  DSTLMIPHLEEIVAVLDRLLSINVSDTAAMNVGTLIVTIFSKFSNELQSLIPTILRAAVT 771

Query: 765  RLGQATNITTTQNLLSVFCFVTSADAQQTVDFLFNTTISNQNGLNLVMSKWLESFDVVRG 824
            +L QA NI+T QNL+S+ CF+T  D  QT++FL+       +    VM+KW E+F+V+RG
Sbjct: 772  KLVQAKNISTQQNLISLLCFLTCTDPLQTIEFLYGLD-ETHSTFAAVMNKWFEAFEVIRG 830

Query: 825  EKRTKENIITLSKLFFLNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHK 884
            EK+ KENI+ LSKL+F  D RL S+ VNGDLIPYE D+IITRSMAK MPD+YTQ+  Y K
Sbjct: 831  EKKIKENILALSKLYFTCDPRLGSLLVNGDLIPYEGDLIITRSMAKTMPDKYTQIPAYTK 890

Query: 885  IIKLFTSELEFQGKHQ-DPQLLMAGTYGIXXXXXXXXXXXXXXXXXXXXGPLEYERLQHY 943
            IIKLF SEL FQ +   +P +L A   GI                      L+Y++L+ Y
Sbjct: 891  IIKLFVSELSFQTQQTGEPTVLNADLKGIEKEEEEVGDDDEWEDVDDV---LDYDKLKEY 947

Query: 944  VEEDETDDRGEELDEQCLADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQI 1003
            V++++  + GE+  ++         +V +LL++FFKEV +K+ + F +IY  LSDN K+I
Sbjct: 948  VDDEDPAEFGEDDKDEITGLADVKETVTELLLEFFKEVTSKDTNNFHAIYNTLSDNGKKI 1007

Query: 1004 LSENLL 1009
            LSENLL
Sbjct: 1008 LSENLL 1013

>Smik_7.20 Chr7 (40260..43274) [3015 bp, 1004 aa] {ON} YGL241W (REAL)
          Length = 1004

 Score =  783 bits (2021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 432/1005 (42%), Positives = 611/1005 (60%), Gaps = 8/1005 (0%)

Query: 7    LILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALLTLRKLV 66
            L+  AQS     R+++E +LLQ CD                    L SRQFALL+LRKL+
Sbjct: 6    LVTRAQSADKLTREAAETQLLQWCDSNASQMFTALANVALQHQSPLESRQFALLSLRKLI 65

Query: 67   TMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAVDFPD 126
            TMYW+PGFES+R TS V++  +  IR+VLL+LCL++++ +KI NGASY +VQISAVDFPD
Sbjct: 66   TMYWSPGFESYRSTSVVEVNVKDFIREVLLKLCLNDNENTKIINGASYCIVQISAVDFPD 125

Query: 127  QWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHVMNSYDA 186
            QWP+LL ++Y+AI   HSL AM LLNEIYDDV+S            T++I+F V+ +  +
Sbjct: 126  QWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLETVQIIFKVLATDTS 185

Query: 187  NWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNKTISETL 246
               AK AAL L   C+LQMS+ NG     RK    +     LQ     LT    + +   
Sbjct: 186  TLVAKFAALKLFKACLLQMSSHNGYDEESRKSFISQCLSTSLQRLGQLLTMGFHSENVVS 245

Query: 247  QLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENSSQDQLD 306
            QL   + IY+ L L+KN+FSK   + D+  QF+ + ++DL N + +         +   +
Sbjct: 246  QLKLKSIIYENLVLIKNDFSKNHFSIDLQKQFKIVTVQDLNNIAHLDTNGNSIEYESISE 305

Query: 307  AINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSFVSKETG 366
            A+++ ++ I+EFL+S+C V F  EE+  ++R L+ LC +N + ++ W +DFN+FVSKETG
Sbjct: 306  AVHDGSIYIVEFLTSVCTVPFGSEEVDIIIRSLTTLCQVNSEIMELWISDFNTFVSKETG 365

Query: 367  LVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFXXXXXXXXXXXXXX 426
            L AS+ +RDQ++E L S  +   + +  ++  +I +  +  D  I               
Sbjct: 366  LAASYNVRDQSSEFLISLSNPLLSLIFSVISKDIER--NTYDNQILESLLYLLQSVLLND 423

Query: 427  XXXXXXFMDAVTRIFTK-LQSILEKSLSCVFVNCRXXXXXXXXXXXXMDSFPNVRDLVQN 485
                   +D   +   K  Q++L           R            +D  P+++ L   
Sbjct: 424  DEITDQNLDESLQTLIKTFQNVLVSPEVKELTLARAILVIPKVLDKFIDVLPDIKSLTSK 483

Query: 486  FLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLIAQLYPE 545
            FL  SLD AL  DNELIKSA LI+FTYY YFAEL SVLGPD C ++Q K +++I  +  +
Sbjct: 484  FLTKSLDLALKHDNELIKSAALIAFTYYCYFAELDSVLGPDVCSEIQGKVIQIINDINSD 543

Query: 546  AEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIELQECLG 605
            +E+DT+G +MEVL  VI  N + +D    I+Q EFHLVFTISSKDP+N+Q  ++ QECL 
Sbjct: 544  SEEDTNGAIMEVLSQVISYNPKGLDSKEEILQAEFHLVFTISSKDPANVQVVVQSQECLE 603

Query: 606  KLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXXXXXXXXXXMKRKPLDPTL 665
            KLL  +++  +  + E+C P  +NV+  ++ +++ YSP            +K+KP+D  L
Sbjct: 604  KLLDEINMDNYKNYIELCLPSFINVLDSNSVNNYRYSPLLSLVLEFITVFLKKKPIDGFL 663

Query: 666  SITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNILDALLS 725
               I   +FEPL  +L  S +EE LQ ATE+  YLI+NT+ +V+ P L  I+ +L+ LLS
Sbjct: 664  PDEITQYLFEPLAKVLVYSSEEETLQLATESFSYLIFNTDTQVMEPRLMDIMKVLERLLS 723

Query: 726  PGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLLSVFCFV 785
              V D AA +VG L VTIF+KFS +IQ L+  IL+A   RL +A NI+T QNLLSV CF+
Sbjct: 724  LEVSDSAAMNVGPLVVTIFTKFSKDIQPLVGRILEAVIVRLVKAQNISTQQNLLSVLCFL 783

Query: 786  TSADAQQTVDFLFNTTISNQNGLNLVMSKWLESFDVVRGEKRTKENIITLSKLFFLNDQR 845
            T  D++QTV+FL N  I ++N L+LVM KW+E+F+V+RGEKR KENI+ LS LFFL+D R
Sbjct: 784  TCNDSRQTVEFLSNFRIDDKNALSLVMQKWMEAFEVIRGEKRIKENIVALSNLFFLDDAR 843

Query: 846  LNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGKHQDPQLL 905
            L  + VNGDLIPYESD+IITRSMAK MPDRY QV +Y KIIKLF SEL FQ K  DP+ L
Sbjct: 844  LRKVMVNGDLIPYESDVIITRSMAKRMPDRYVQVPLYTKIIKLFVSELGFQNKQPDPKQL 903

Query: 906  MAGTYGIXXXXXXXXXXXXXXXXXXXXGPLEYERLQHYVEEDETDDRGEELDEQCLADNL 965
            +  T  +                      L+YE+L+ Y+  ++  D  +E D + +   +
Sbjct: 904  I--TSNMQHDAANLNNDEDNDDWEDVDDVLDYEKLKEYI--NDDVDGEDEDDSEDITGLM 959

Query: 966  DSR-SVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL 1009
            D + SV Q+LV FFKEVA K++SGF  IYE LSD+++++LSE LL
Sbjct: 960  DVKESVVQILVRFFKEVATKDVSGFNRIYETLSDSDRKVLSEALL 1004

>Kpol_380.6 s380 complement(8594..11602) [3009 bp, 1002 aa] {ON}
            complement(8594..11602) [3009 nt, 1003 aa]
          Length = 1002

 Score =  770 bits (1988), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/1005 (42%), Positives = 628/1005 (62%), Gaps = 17/1005 (1%)

Query: 1    MFDAPSLILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALL 60
            M D   LI  AQSP ++VR+ +E  LL  CDE                  EL SR FALL
Sbjct: 1    MQDIHQLINLAQSPDNSVREKAESELLAACDEDACIVFHSMIQVGSNGFEELSSRLFALL 60

Query: 61   TLRKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQIS 120
            TLRKL+TMYW+PGFES+R  ST+  E +   RD LL++CLD+ Q +KI+N ++Y VVQIS
Sbjct: 61   TLRKLITMYWSPGFESYRLNSTLNEEIKNNFRDSLLKICLDDSQDTKIKNASAYCVVQIS 120

Query: 121  AVDFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHV 180
            AVDFPDQWP LLN VY AIM+ HSL+A+ LLNEIYDDV+S            T++I+F V
Sbjct: 121  AVDFPDQWPTLLNEVYGAIMERHSLSAISLLNEIYDDVMSEEMFFEEGIGSETIRIIFSV 180

Query: 181  MNSYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNK 240
            +   +    AK+A+  L H C+LQMS ++  S  KRK+L  E   +IL +W   L  QN 
Sbjct: 181  LTDNNTGIAAKIASSKLFHSCLLQMSVLDPQSVHKRKQLVTECISQILTIWSGLLQKQNV 240

Query: 241  T-ISETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVEN 299
            T +S   +L   +KIY+ L ++K+EF +K+ + +    FR +V+ DL  A++ Y  ++ +
Sbjct: 241  TEMSSEFELR--SKIYEDLAMIKSEFPRKLFSKENIEIFRRLVINDLNIAAKCYNNVLSS 298

Query: 300  SSQD-QLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFN 358
             + D ++  INE+ ++I+EFL+++ D +F+ E++ T+ +    L C++++T +SW  DFN
Sbjct: 299  ENSDTEMIHINEFVIHIIEFLTAISDFKFSPEDIGTISKSFVTLSCIDRNTEESWTADFN 358

Query: 359  SFVSKETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFXXXXXX 418
            SF+SKETGL ASFTIRDQ A+ +S+ +   Y+    L+++E ++I + +  W        
Sbjct: 359  SFISKETGLFASFTIRDQIADFISNVNEGVYSGFYSLILNEFNEIINSNSDWRTQESVLY 418

Query: 419  XXXXXXXXXXXXXXFMDAVTRIF-TKLQSILEKSLSCVFVNCRXXXXXXXXXXXXMDSFP 477
                           +   T+I  T + +I+    +  FV  R            M++ P
Sbjct: 419  LLQCIATSETEINESLQCNTQILVTAIGNIISNPPTQSFVLMRSILTIPKLLEKFMETLP 478

Query: 478  NVRDLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLK 537
            +V++  +  L +SLD ALS  +EL++S+ LI+FTYY+ FAEL SVLG   C   Q+K LK
Sbjct: 479  DVKEYTKQLLSISLDIALSSSDELVQSSGLIAFTYYTSFAELNSVLGDVACRVEQEKVLK 538

Query: 538  LIAQLYPEAEDDTDGVLMEVLDNVIDCNS-ENVDDTSSIIQTEFHLVFTISSKDPSNIQT 596
            LI  L  ++E+DT+GVL+EVL+NVIDCNS +++D+T  I++ EF  + TIS KDPSNIQ 
Sbjct: 539  LIQNLSNDSEEDTNGVLVEVLNNVIDCNSPQHLDET--ILEVEFDFLLTISVKDPSNIQL 596

Query: 597  TIELQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXXXXXXXXXXM 656
             +E QECL KL++++D+  +  +     P ++NV+     + + YSP            M
Sbjct: 597  IVEAQECLEKLIESMDINLYNKYAHKLLPFLINVINECNQTGYSYSPLLSLALEFINILM 656

Query: 657  KRKPLDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSI 716
            + +P D +L   IC  +F PL++IL  S+++E LQ ATEA  +L++N++ +VI P+L+ I
Sbjct: 657  RNRPDDISLPTYICEQLFSPLRHILMVSQEDETLQLATEAFSFLLFNSQTDVIFPYLEEI 716

Query: 717  VNILDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQ 776
            +N+L  LLS  + D AA +VGSL VTIF+KFS ++Q LIP IL+A   +   A NI+T+Q
Sbjct: 717  INVLSRLLSMDISDTAAMNVGSLVVTIFTKFSEQVQELIPGILRATTDKFINAKNISTSQ 776

Query: 777  NLLSVFCFVTSADAQQTVDFLFNTTISN--QNGLNLVMSKWLESFDVVRGEKRTKENIIT 834
            NL+SVFC +   D  +T+DFL+N  I    Q+ L LV++KWLESF+++RGEK+ KENI+ 
Sbjct: 777  NLVSVFCLLVCTDPARTIDFLYNLEIGTPPQSSLPLVLTKWLESFEIIRGEKKIKENILA 836

Query: 835  LSKLFFLNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELE 894
            LSK++FL D R++S++VNGD+IPY  D+IITRSMAK MPD+YT+VSVY KI+KLF +EL 
Sbjct: 837  LSKIYFLKDSRVSSIEVNGDIIPYTGDLIITRSMAKSMPDKYTRVSVYQKIVKLFVAELG 896

Query: 895  FQGKHQDPQLL----MAGTYGIXXXXXXXXXXXXXXXXXXXXGPLEYERLQHYVEEDETD 950
            FQ K QDP  L    +    GI                      L+YE+LQ Y+++D+ +
Sbjct: 897  FQTKEQDPSDLVDSKLKQELGIPQQMGAAHGDDDDDDWEDVDDVLDYEKLQEYIDDDDEE 956

Query: 951  DR--GEELDEQCLADNLDSRSVHQLLVDFFKEVAAKNISGFQSIY 993
            +   G E  E    + + +++  +LL++FFKE A+K+I+ FQ IY
Sbjct: 957  EYVGGPESQEITGIEEV-TQTTKELLIEFFKEAASKDINSFQEIY 1000

>YGL241W Chr7 (45445..48459) [3015 bp, 1004 aa] {ON}
            KAP114Karyopherin, responsible for nuclear import of
            specific proteins; cargoes include Spt15p, Sua7p,
            histones H2A and H2B, and Nap1p; amino terminus shows
            similarity to those of other importins, particularly
            Cse1p; localization is primarily nuclear; function is
            regulated by sumoylation
          Length = 1004

 Score =  767 bits (1980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/1009 (42%), Positives = 614/1009 (60%), Gaps = 8/1009 (0%)

Query: 3    DAPSLILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALLTL 62
            D   LI+ AQS   + R+ +E +LLQ CD                    L SRQFALL+L
Sbjct: 2    DINELIIGAQSADKHTREVAETQLLQWCDSDASQVFKALANVALQHEASLESRQFALLSL 61

Query: 63   RKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAV 122
            RKL+TMYW+PGFES+R TS V+++ +  IR+VLL+LCL++++ +KI+NGASY +VQISAV
Sbjct: 62   RKLITMYWSPGFESYRSTSNVEIDVKDFIREVLLKLCLNDNENTKIKNGASYCIVQISAV 121

Query: 123  DFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHVMN 182
            DFPDQWP+LL ++Y+AI   HSL AM LLNEIYDDV+S            T++IVF V+N
Sbjct: 122  DFPDQWPQLLTVIYDAISHQHSLNAMSLLNEIYDDVVSEEMFFEGGIGLATMEIVFKVLN 181

Query: 183  SYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNKTI 242
            +  +   AK+AAL LL  C+LQMS+ N      RK    +     LQ+    LT     +
Sbjct: 182  TETSTLIAKIAALKLLKACLLQMSSHNEYDEASRKSFVSQCLATSLQILGQLLTLNFGNV 241

Query: 243  SETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENSSQ 302
                QL   + IY+ L  +KN+FS+K  + ++  QF+ + ++DLEN + I   +    S+
Sbjct: 242  DVISQLKFKSIIYENLVFIKNDFSRKHFSSELQKQFKIMAIQDLENVTHINANVETTESE 301

Query: 303  DQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSFVS 362
              L+ +++ ++ I+EFL+S+C ++F+ EE+  ++  L+ LC L+ +T + W +DFN+FVS
Sbjct: 302  PLLETVHDCSIYIVEFLTSVCTLQFSVEEMNKIITSLTILCQLSSETREIWTSDFNTFVS 361

Query: 363  KETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFXXXXXXXXXX 422
            KETGL AS+ +RDQA E  +S  +   + +  ++ ++I   +   +              
Sbjct: 362  KETGLAASYNVRDQANEFFTSLPNPQLSLIFKVVSNDIEHST--CNYSTLESLLYLLQCI 419

Query: 423  XXXXXXXXXXFMDAVTRIFTK-LQSILEKSLSCVFVNCRXXXXXXXXXXXXMDSFPNVRD 481
                       +D   +I  K L++IL        +  R            +D+ P+++ 
Sbjct: 420  LLNDDEITGENIDQSLQILIKTLENILVSQEIPELILARAILTIPRVLDKFIDALPDIKP 479

Query: 482  LVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLIAQ 541
            L   FL  SL+ AL  D ELIKSATLI+FTYY YFAEL SVLGP+ C + Q+K +++I Q
Sbjct: 480  LTSAFLAKSLNLALKSDKELIKSATLIAFTYYCYFAELDSVLGPEVCSETQEKVIRIINQ 539

Query: 542  LYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIELQ 601
            +  +AE+DT+G LMEVL  VI  N +       I+Q EFHLVFTISS+DP+N+Q  ++ Q
Sbjct: 540  VSSDAEEDTNGALMEVLSQVISYNPKEPHSRKEILQAEFHLVFTISSEDPANVQVVVQSQ 599

Query: 602  ECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXXXXXXXXXXMKRKPL 661
            ECL KLL N+++  +  + E+C P  +NV+  +  +++ YSP            +K+KP 
Sbjct: 600  ECLEKLLDNINMDNYKNYIELCLPSFINVLDSNNANNYRYSPLLSLVLEFITVFLKKKPN 659

Query: 662  DPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNILD 721
            D  L   I   +FEPL  +L  S ++E LQ ATEA  YLI+NT+   + P L  I+ +L+
Sbjct: 660  DGFLPDEINQYLFEPLAKVLAFSTEDETLQLATEAFSYLIFNTDTRAMEPRLMDIMKVLE 719

Query: 722  ALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLLSV 781
             LLS  V D AA +VG L V IF++FS EIQ LI  IL+A   RL +  NI+T QNLLSV
Sbjct: 720  RLLSLEVSDSAAMNVGPLVVAIFTRFSKEIQPLIGRILEAVVVRLIKTQNISTEQNLLSV 779

Query: 782  FCFVTSADAQQTVDFLFNTTISNQNGLNLVMSKWLESFDVVRGEKRTKENIITLSKLFFL 841
             CF+T  D +QTVDFL +  I N + L LVM KW+E+F+V+RGEKR KENI+ LS LFFL
Sbjct: 780  LCFLTCNDPKQTVDFLSSFQIDNTDALTLVMRKWIEAFEVIRGEKRIKENIVALSNLFFL 839

Query: 842  NDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGKHQD 901
            ND+RL  + VNG+LIPYE D+IITRSMAK+MPDRY QV +Y KIIKLF SEL FQ K  +
Sbjct: 840  NDKRLQKVVVNGNLIPYEGDLIITRSMAKKMPDRYVQVPLYTKIIKLFVSELSFQSKQPN 899

Query: 902  PQLLMAGTYGIXXXXXXXXXXXXXXXXXXXXGPLEYERLQHYVEEDETDDRGEELDEQCL 961
            P+ L+  T  I                      L+Y++L+ Y+++D       + D   +
Sbjct: 900  PEQLI--TSDIKQEVVNANKDDDNDDWEDVDDVLDYDKLKEYIDDDVD--EEADDDSDDI 955

Query: 962  ADNLDSR-SVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL 1009
               +D + SV QLLV FFKEVA+K++SGF  IYE LSD+E+++LSE LL
Sbjct: 956  TGLMDVKESVVQLLVRFFKEVASKDVSGFHCIYETLSDSERKVLSEALL 1004

>KAFR0J00190 Chr10 (30537..33575) [3039 bp, 1012 aa] {ON} Anc_3.564
            YGL241W
          Length = 1012

 Score =  746 bits (1926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 429/1032 (41%), Positives = 625/1032 (60%), Gaps = 48/1032 (4%)

Query: 3    DAPSLILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALLTL 62
            D   LI +AQSP +++R+ +E++LLQ CD                   +L +RQFALL+L
Sbjct: 4    DISQLISQAQSPDNSLREHAEQQLLQSCDSNASLIFQALTDVAINNSNKLAARQFALLSL 63

Query: 63   RKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAV 122
            RKL+T YW+PGFES+R TS + L+ +  +R+ L+QL LD++Q SKI++ ASY V QISAV
Sbjct: 64   RKLITFYWSPGFESYRNTSQIDLDTKSSLRNYLIQLALDDNQDSKIKSSASYCVTQISAV 123

Query: 123  DFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHVMN 182
            DFPDQWPELL+I+Y  I + +SL+A+KLLNEIYDD++S            TL IV+ ++ 
Sbjct: 124  DFPDQWPELLSILYGCITQHYSLSAIKLLNEIYDDIVSEEMFFEGNIGLETLSIVYQLLE 183

Query: 183  SYD-ANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNKT 241
            S D  + +A++A ++LL+  I QM+ V+ + T KRK+L  E+    L +  N L   ++ 
Sbjct: 184  SGDNVSIQARIALVDLLNATITQMTNVDSNLTEKRKQLLSESIPRALGLLSNILEMSHRD 243

Query: 242  ISETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENSS 301
            IS T  L    KIY+ L L+KNE  KK  +      ++ I +  L      Y  M E  +
Sbjct: 244  IS-TDSLTFIGKIYEILVLIKNELPKKFFSAQTRDAYKRITLNTLSLLQNKYASMTE-PA 301

Query: 302  QDQLDAINEYAVNILEFLSSLC-DVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSF 360
            + +L++ +E A++ LEFL+SL  +  FTEEE   +L  L  LC L+  T ++W  DFN F
Sbjct: 302  ETELESFSECAIHTLEFLTSLSYNTNFTEEERTIILNSLLVLCSLDPVTKETWLADFNHF 361

Query: 361  VSKETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFXXXXXXXX 420
            VSKETGL+ S+TIRDQ+ E L+S   Q++     L++  I Q       + F        
Sbjct: 362  VSKETGLLPSYTIRDQSFEFLTSLIDQNFQ----LILKSIFQ-------YFFTLISSSSP 410

Query: 421  XXXXXXXXXXXXFMDAV---------------TRIFTKLQSILEKSLSCVFVNCRXXXXX 465
                         + ++               T +   L S+L      + V+ R     
Sbjct: 411  SVDPSQLETTFYLLQSILSNDDDIENVNNEEITSVLRVLPSLLTNVHDSLMVS-RIILAL 469

Query: 466  XXXXXXXMDSFPNVRDLVQNFLFLSLDFALSQDNE-LIKSATLISFTYYSYFAELPSVLG 524
                   MD  P+V+ +VQ FL  S + AL    + +IKS+ LISFT Y YFAELPSVLG
Sbjct: 470  PKILEKFMDDLPDVKAMVQTFLVQSTELALRLSGDYIIKSSVLISFTSYCYFAELPSVLG 529

Query: 525  PDNCIQVQQKTLKLIAQLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVF 584
            P+ C  +Q+  L L+ Q+  E+EDDT+G+L EVL+N+I+CNS N   +  I+QTEF L+F
Sbjct: 530  PELCASIQKSILTLMKQVSNESEDDTNGLLTEVLNNIIECNSTNT--SQEILQTEFSLLF 587

Query: 585  TISSKDPSNIQTTIELQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPX 644
            +ISSKDPSN+Q  +E QE L KLL NV  K ++ + +I  PP +N++  ++ +S+ YSP 
Sbjct: 588  SISSKDPSNVQIVVESQESLEKLLTNVTEKVYLEYIQIYLPPFINIIHANSTTSYRYSPL 647

Query: 645  XXXXXXXXXXXMKRKPLDPT-LSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYN 703
                       MK+KP D   L  +I  ++F+PL +IL  S ++E LQ  T+A  Y+IYN
Sbjct: 648  LSLVLEFITIFMKKKPSDSKILPESIIANLFQPLVDILTTSTEDETLQLTTDAFTYIIYN 707

Query: 704  TEAEVILPHLKSIVNILDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAA 763
            T++E ++P+L+++VNILD LLS  V D AA +VG+L VTIF+KFS +I +LIP IL AA 
Sbjct: 708  TDSEKVMPYLETVVNILDRLLSLDVTDTAAMNVGTLIVTIFTKFSAQISSLIPTILNAAV 767

Query: 764  ARLGQATNITTTQNLLSVFCFVTSADAQQTVDFLFNTTISNQNGLNLVMSKWLESFDVVR 823
             RL    NI+T QNL+S+ CF+  ++ Q+TVDFLFN  +  QN +  V+ KW ESF+++R
Sbjct: 768  NRLIDCKNISTQQNLVSLLCFLFYSNTQETVDFLFN--LPQQNIVRDVLIKWFESFEIIR 825

Query: 824  GEKRTKENIITLSKLFFLNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYH 883
            GEK+ KENII L KL+ L+D++L S++VNGD+IPYE D+IITRS AK +PD+YTQ++++ 
Sbjct: 826  GEKKIKENIIALGKLYCLHDEKLFSIKVNGDIIPYEGDLIITRSRAKSLPDKYTQITIFE 885

Query: 884  KIIKLFTSELEFQGKHQDPQLLMAGTYGIXXXXXXXXXXXXXXXXXXXXGPLEYERLQHY 943
            KIIKLF +EL FQ K    + LM                            L+Y++L+ Y
Sbjct: 886  KIIKLFIAELGFQNKQPAIENLMTN-----ETTALGDSNENDDEWEDVDDVLDYDKLKEY 940

Query: 944  V-EEDETD-----DRGEELDEQCLADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLS 997
            V +EDE D     + GE  +E+       S++V +L++ FFK+V +KN++ FQSIY+ LS
Sbjct: 941  VNDEDELDGEDSREYGEGDEEEITGLGDVSQTVTELIIGFFKDVTSKNVNNFQSIYDTLS 1000

Query: 998  DNEKQILSENLL 1009
            +NEK IL++ L+
Sbjct: 1001 ENEKMILTQYLV 1012

>Suva_7.20 Chr7 (40012..43038) [3027 bp, 1008 aa] {ON} YGL241W (REAL)
          Length = 1008

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/1010 (41%), Positives = 605/1010 (59%), Gaps = 6/1010 (0%)

Query: 3    DAPSLILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALLTL 62
            D   LI  AQS  ++ R+++E +LLQ CD                    L SRQFALL+L
Sbjct: 2    DISHLITGAQSADNHTREAAEAQLLQWCDSDASQVFTSLASVALHHQTSLQSRQFALLSL 61

Query: 63   RKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAV 122
            RKL+TMYW+PGFES+R TS V L  +  IR+ LL LCL+ ++ +KI+NGASY +VQISAV
Sbjct: 62   RKLITMYWSPGFESYRSTSNVDLNVKESIREALLNLCLNANENTKIKNGASYCIVQISAV 121

Query: 123  DFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHVMN 182
            DFPDQWP+LL ++Y+AI + HS+ AM LLNEIYDDV+S            T++I+F V+ 
Sbjct: 122  DFPDQWPQLLTVIYDAISQHHSINAMSLLNEIYDDVVSEEMFFEGGIGLETVEIIFKVLT 181

Query: 183  SYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNKTI 242
            +  +N  AK+AAL L   C+ QMS+ +  +   R     +     LQ     LT      
Sbjct: 182  TEASNLVAKIAALKLFKACLSQMSSHDKHNDESRNNFINQCLSTSLQTLGQLLTLDLVNE 241

Query: 243  SETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENSSQ 302
              T Q    + IY+ L  +KN FSKK    +   QF+ + ++DL+N + + +      ++
Sbjct: 242  DVTCQSKFRSIIYENLVFIKNNFSKKHFPKEFQVQFKLVAIKDLKNIASMNVNDGPTENE 301

Query: 303  DQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSFVS 362
            D L+ +   +V I+EFL+++C + FT EE++ +++ L+ LC ++ DT   W  DFN FVS
Sbjct: 302  DSLETVQTCSVYIVEFLTTVCSIPFTIEEMKMIIQSLTALCRVDSDTTQLWIGDFNYFVS 361

Query: 363  KETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFXXXXXXXXXX 422
            KETGL AS+ +RDQ +E  +S    + + +  ++  +I Q +  +   +           
Sbjct: 362  KETGLAASYNVRDQVSEFFTSLSDPNLSLMFDIVSQDIVQNTS-NHQTLESLLYLLQCIL 420

Query: 423  XXXXXXXXXXFMDAVTRIFTKLQSILEKSLSCVFVNCRXXXXXXXXXXXXMDSFPNVRDL 482
                       + +   +   L+S L  S        R            +D  P+++ L
Sbjct: 421  LNDDEITGQNIIQSSQSLIENLRSELVSSELNEVTLARLILIIPKVLDKFIDVLPDIKSL 480

Query: 483  VQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLIAQL 542
              +FL  SLD AL    EL++SA LI+FTYY YFAEL SVLGP+ C +VQQ  +++I ++
Sbjct: 481  TSSFLKASLDLALKYHQELVESAVLIAFTYYCYFAELDSVLGPEACTEVQQNIIQIINEI 540

Query: 543  YPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIELQE 602
              +AE+DT+G +MEVL+ VI CN++    +  ++Q EFHLVF+ISSKDP+N+Q  ++ QE
Sbjct: 541  SDDAEEDTNGTIMEVLNEVISCNTKGPHHSEEVLQAEFHLVFSISSKDPANVQVVVQSQE 600

Query: 603  CLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXXXXXXXXXXMKRKPLD 662
            CL KLL N+ +  ++++ E+C P  +NV+  +  ++++Y+P            +K+KP  
Sbjct: 601  CLEKLLDNITMGNYMSYIELCLPSFINVLEANRPNNYKYTPLLSLVLEFITVFLKKKPSS 660

Query: 663  PTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNILDA 722
              L   I   +FEPL  +L  S ++E LQ ATEA  YLI+NT+ +V+ P L  I+ +L+ 
Sbjct: 661  EFLPSEIDQHLFEPLAKVLAYSTEDETLQLATEAFSYLIFNTDTQVMEPRLMDIMKVLER 720

Query: 723  LLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLLSVF 782
            LLS  V D AA +VGSL VTIF++FS EIQ L+  ILQA   RL +A NI+T QNL SV 
Sbjct: 721  LLSLEVSDSAAMNVGSLVVTIFTRFSGEIQPLVERILQAVVIRLVKAQNISTQQNLFSVL 780

Query: 783  CFVTSADAQQTVDFLFNTTISNQNGLNLVMSKWLESFDVVRGEKRTKENIITLSKLFFLN 842
            CF+T  D +QTVDFL +  I N + L+LVM KW+ESF+VVRGE+R KENII L KLF L+
Sbjct: 781  CFLTCNDPKQTVDFLCSFQIDNMDALSLVMPKWMESFEVVRGERRIKENIIALIKLFLLD 840

Query: 843  DQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGKHQDP 902
            D RL+ + VNGDLIPY+ D+IITRSMAK+MPD+Y QV +Y KIIKLF SEL FQ K  +P
Sbjct: 841  DARLHKLMVNGDLIPYDGDLIITRSMAKKMPDKYVQVPLYTKIIKLFVSELGFQNKQPNP 900

Query: 903  QLLMAGTYG--IXXXXXXXXXXXXXXXXXXXXGPLEYERLQHYVEEDETDDRGEELDEQC 960
            + L+                              L+YE+L+ Y+ +D      ++ ++  
Sbjct: 901  EQLITTDIAKDAANNDNDDDNDADNDDWEDVDDVLDYEKLKDYIGDDVDGGEEDDSED-- 958

Query: 961  LADNLDSR-SVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL 1009
            +   +D + SV Q+LV FFKEVA+K++SGF  IYE LS+NE+++LSE LL
Sbjct: 959  ITGLMDVKESVVQILVGFFKEVASKDVSGFHRIYESLSENERKVLSEALL 1008

>Skud_7.26 Chr7 (49585..52632) [3048 bp, 1015 aa] {ON} YGL241W (REAL)
          Length = 1015

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/1010 (41%), Positives = 608/1010 (60%), Gaps = 9/1010 (0%)

Query: 3    DAPSLILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALLTL 62
            D   LI++AQS  ++ R+ +E +LLQ CD                    L SRQFALL+L
Sbjct: 12   DINQLIIQAQSADNHTREVAEAQLLQWCDSDASQMFTALVNAALQQQSALQSRQFALLSL 71

Query: 63   RKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAV 122
            RKL+TMYW+PGFES+R TS V ++ +  IR+ LL+LCL++++ ++I+NGASY +VQISAV
Sbjct: 72   RKLITMYWSPGFESYRSTSNVDVKVKEFIREALLKLCLNDNENTRIKNGASYCIVQISAV 131

Query: 123  DFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHVMN 182
            DFPDQWP+LL+++Y+ I + HSL AM LLNEIYDDV+S            T +I+F V+ 
Sbjct: 132  DFPDQWPQLLSVIYDGISRQHSLNAMFLLNEIYDDVVSEEMFFEGGIGLETAEIIFKVLV 191

Query: 183  SYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNKTI 242
            +  ++  AK+AAL LL  C+LQMS+ NG     RK+   +     LQ     LT      
Sbjct: 192  AETSSLVAKIAALKLLKACLLQMSSHNGHYEESRKDFVSQCISTSLQRLGQLLTLNFDNE 251

Query: 243  SETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVEN--S 300
                QL   + IY+ L  +KN+FSKK  A  +   F+ + +RDL+N S I      +   
Sbjct: 252  DVISQLKLKSIIYENLVFIKNDFSKKHFAEKLQDHFKLVAIRDLKNISLIDTNDDGDYPE 311

Query: 301  SQDQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSF 360
            S++ +  +++ +V I+EFL+S+C + FT EE+  ++  L+ LC +  D  + W +DFN F
Sbjct: 312  SENFVKTVHDCSVYIVEFLTSVCTISFTIEEISVIIGALTTLCKVGSDASELWISDFNEF 371

Query: 361  VSKETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFXXXXXXXX 420
            VSKETGL AS+ IRDQA E  +S  +   + +  ++   I    + S+   F        
Sbjct: 372  VSKETGLAASYNIRDQACEFFTSLSNPQLSLIFGVVSKNIDL--NTSNHQTFESLLYLLQ 429

Query: 421  XXXXXXXXXXXXFMD-AVTRIFTKLQSILEKSLSCVFVNCRXXXXXXXXXXXXMDSFPNV 479
                         ++ ++  +   LQ+ L  S        R            +D  P++
Sbjct: 430  CILLNDDEISSQNINQSLQNLLGILQNALTSSEIHELTLARVILVIPKLLDKFIDVLPDI 489

Query: 480  RDLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLI 539
            + +   FL  SLD AL  D ELIKSA LI+F YY YFAEL SVLGP  C ++Q+K +++I
Sbjct: 490  KSVTSRFLAKSLDLALKCDQELIKSAALIAFPYYCYFAELDSVLGPQLCTELQEKVIQII 549

Query: 540  AQLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIE 599
             ++  +AE+DT+G +MEVL+ VI  NS+       ++Q E HLVFTISSKDP+N+Q  ++
Sbjct: 550  NEISNDAEEDTNGTIMEVLNQVISYNSKGPYSKKEVLQAEVHLVFTISSKDPANVQVVVQ 609

Query: 600  LQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXXXXXXXXXXMKRK 659
             QECL KLL ++++  +  + E+C P  +NV+  +  ++++YSP            +K++
Sbjct: 610  SQECLEKLLDDINMDNYKNYIELCLPSFINVLNANDENNYKYSPLLSLVLEFIAVFLKKR 669

Query: 660  PLDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNI 719
            P D  L   I   +FEPL  +L  S ++E LQ ATEA  YLI+NT+ + +   L  I+ I
Sbjct: 670  PNDGYLPDEINQYLFEPLAKVLVYSTEDETLQLATEAFSYLIFNTDTQTMQTRLMDIMKI 729

Query: 720  LDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLL 779
            L+ LLS  V D AA +VGSL V IF++FS E+Q L+  ILQA   RL +A NI+T QNLL
Sbjct: 730  LERLLSLEVSDSAAMNVGSLVVAIFTRFSKEVQPLVGRILQAVVVRLVKAQNISTQQNLL 789

Query: 780  SVFCFVTSADAQQTVDFLFNTTISNQNGLNLVMSKWLESFDVVRGEKRTKENIITLSKLF 839
            SV CF+T  D +QTVDFL +  I ++  L+LVMSKW+E+F+V+RGE++ KE+I+ LSK F
Sbjct: 790  SVLCFLTCNDTKQTVDFLSSFRIDDKEALSLVMSKWMEAFEVIRGERKIKESIVALSKFF 849

Query: 840  FLNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGKH 899
            FLND RL+ + VNGD+IPYE D+IITRSMAK+MPD+Y QV +Y KIIKLF SEL FQ K 
Sbjct: 850  FLNDPRLHKLMVNGDMIPYEGDLIITRSMAKKMPDKYVQVPLYTKIIKLFISELGFQAKQ 909

Query: 900  QDPQLLMAGTYGIXXXXXXXXXXXXXXXXXXXXGPLEYERLQHYVEEDETDDRGEELDEQ 959
             DP+ L+A +                         L+YE+L+ Y+++D   +  ++ D+ 
Sbjct: 910  LDPEQLVASS---IQESANANNDDETGDWEDVDDVLDYEKLKEYIDDDVDGEEEDDRDDI 966

Query: 960  CLADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL 1009
                ++   SV Q+LV FF+EVA KN+S F  IYE LSD+E++ LSE LL
Sbjct: 967  TGLTDV-KESVVQILVSFFREVATKNVSDFHLIYETLSDSERKTLSEALL 1015

>TPHA0G03630 Chr7 complement(770678..773746) [3069 bp, 1022 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1022

 Score =  717 bits (1852), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/1027 (39%), Positives = 607/1027 (59%), Gaps = 23/1027 (2%)

Query: 1    MFDAPSLILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALL 60
            M D   LI  AQS  +NVR+++E  LLQ CDE                   L SRQF +L
Sbjct: 1    MPDVHLLIAHAQSADNNVRENAESELLQKCDENASVVFNSLIELANNINEPLSSRQFCIL 60

Query: 61   TLRKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQIS 120
            +L+KL+TMYW+PGF+S+RGTS V+ E +  +RD LL+LCL+  Q SKI++ +SY +VQIS
Sbjct: 61   SLKKLITMYWSPGFDSYRGTSNVQEETKEFLRDSLLKLCLNTEQDSKIKSSSSYCIVQIS 120

Query: 121  AVDFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHV 180
            A+DFPD WP LL ++YNAI+K HS+ AM LLNEIYDDVIS            T+K +F +
Sbjct: 121  AIDFPDLWPNLLVVIYNAILKDHSIEAMSLLNEIYDDVISEEMFFEGGVGEETIKTIFAI 180

Query: 181  MNSYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNK 240
              S + N +AKVAA  LLH  +LQMS ++ S + KRK+   +   ++L + +  L   + 
Sbjct: 181  FTSPETNIKAKVAASKLLHSTVLQMSILDNSMSFKRKDFVSQCITKLLDILLTILPHLDV 240

Query: 241  TISE-TLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVE- 298
              SE  LQL      Y+ LT +K EF KK+    +   F+ I ++DLE     Y+Q ++ 
Sbjct: 241  NQSEDALQL--KTNFYEELTTIKTEFPKKLFHNSLVTNFKAISLKDLEIIGSSYLQFIDS 298

Query: 299  NSSQDQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFN 358
            ++S  QL  INEY V++++F+SSL    F + +L  ++  L  LCCL+ +T +SW++DFN
Sbjct: 299  DASGSQLQLINEYGVHLIDFISSLSVQGFDKVDLTRIVSSLVMLCCLDNNTYESWESDFN 358

Query: 359  SFVSKETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFXXXXXX 418
            +F+SKE GL+A++TIRDQ  +  S  +   Y+    +++ E+++  +  + W        
Sbjct: 359  TFISKEAGLLANYTIRDQTMQFFSDLEKPTYSIAYGIILEELNKSMENYNNWKLQESLLY 418

Query: 419  XXXXXXXXXXXXXXFMDAVTR-IFTKLQSILEKSLSCVFVNCRXXXXXXXXXXXXMDSFP 477
                           +   T  +   L  +L    S + V  R            M+S+ 
Sbjct: 419  TLQSIISSEEEFNSELLGYTENVLNSLGKLLMDPSSNIMVKSRCLLLCPKYLEKFMESYT 478

Query: 478  NVRDLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLK 537
             V+ + +  L  SL+ +L+  +E++KS+ LI+F+YY+ +A+L SVLG  +CI +QQ  LK
Sbjct: 479  AVKPMTKELLSTSLNLSLNTSSEILKSSMLIAFSYYASYADLSSVLGSADCISIQQGLLK 538

Query: 538  LIAQLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTT 597
            +I  +  +AE+DT  + +E + NVID NS     +  +   EF+++  IS KDP NIQ +
Sbjct: 539  IIKDIANDAEEDTYAICVETISNVIDNNSSGTG-SDEVRDNEFNILLEISFKDPGNIQLS 597

Query: 598  IELQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXXXXXXXXXXMK 657
            +E QECL KLL  +D+  +I + E   P ++ ++   A ++++YSP            MK
Sbjct: 598  VESQECLEKLLDGMDISLYIYYAEKVIPLLIKIIADHASTNYDYSPLLSLTLDFLMTFMK 657

Query: 658  RKPLDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIV 717
            +KP+D TL + I   VF P+  +L  S +EE +Q ATEA  +L++N++  ++   L++IV
Sbjct: 658  KKPVDSTLPVEISKLVFNPVCEVLLSSNEEETIQLATEAFSFLVFNSDVSLMQTVLENIV 717

Query: 718  NILDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQN 777
            N+L  LLS  + D AA +VG+L +TIFSKFS +IQ L+P ILQA   +   A NI T+QN
Sbjct: 718  NVLSKLLSLNISDTAAMNVGTLIITIFSKFSQQIQELLPAILQATTQKFVNAKNIITSQN 777

Query: 778  LLSVFCFVTSADAQQTVDFLFNTTISNQ---NGLNLVMSKWLESFDVVRGEKRTKENIIT 834
            LL VFCF+  +D QQTVDFL+N ++ +Q   N L LV+ KWLE FD++RGEKR KENII 
Sbjct: 778  LLMVFCFLICSDPQQTVDFLYNLSLEDQQEENTLTLVLKKWLELFDIIRGEKRIKENIIA 837

Query: 835  LSKLFFLNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELE 894
            LSK++ L D+R+  + VNGD+IPY  D IITRSMAK +PD++TQ+ +Y KI+KLF  EL 
Sbjct: 838  LSKIYLLLDKRIELVIVNGDIIPYSGDKIITRSMAKSIPDQFTQMPIYEKIVKLFLGELA 897

Query: 895  FQGKH-QDPQL----LMAGTYGIXXXXXXXXXXXXXXXXXXXXGPLEYERLQHYVEEDE- 948
             Q K+  D  L    +                             L+YE+LQ YV++D+ 
Sbjct: 898  SQSKNISDANLHSIDIQKLARAEENQVEQKLDSSEDDDWEDVEDVLDYEKLQEYVDDDDD 957

Query: 949  ------TDDRGEELDEQCLADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQ 1002
                  +D+  +    Q + D   ++SV +L+++FFKEV +KNI+ FQ IY  LS++EK+
Sbjct: 958  ELANYTSDEDNDTPTGQIIGD--INQSVSELIINFFKEVTSKNINSFQDIYSSLSEDEKK 1015

Query: 1003 ILSENLL 1009
            +L+  L+
Sbjct: 1016 LLANALV 1022

>SAKL0F00880g Chr6 (76850..79879) [3030 bp, 1009 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1009

 Score =  691 bits (1784), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/1023 (38%), Positives = 590/1023 (57%), Gaps = 41/1023 (4%)

Query: 7    LILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALLTLRKLV 66
            L+++AQS     R+++E  LLQ   +                   L SRQF+LL LR+LV
Sbjct: 8    LVIQAQSADKKEREAAESSLLQFSAQEPESMFLSLIDIACNSY-PLTSRQFSLLFLRRLV 66

Query: 67   TMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAVDFPD 126
            TMYW+ GFES+ G   V    + ++R+ LL+L LD+ Q  K +N +SY VVQISAVDFPD
Sbjct: 67   TMYWSAGFESYVGPPGVGSRGKSIVRESLLRLSLDDSQDIKTKNSSSYCVVQISAVDFPD 126

Query: 127  QWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHVMNSYDA 186
            +WP+LL  +Y AI++ +SL+AM LL EI+DDV+S            T++IV  V+ S  +
Sbjct: 127  EWPDLLIRIYEAIVEHYSLSAMSLLTEIFDDVVSEEMFFQGGIGWQTIQIVSQVLTSSTS 186

Query: 187  NWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVN---FLTTQNKTIS 243
            + E+K AAL+L H C+LQ+ +   +ST +RK    E  K++L +++    F  +    I 
Sbjct: 187  SVESKSAALDLYHACVLQLQSPQATSTIERKHAIAEHIKQMLGLFIQLLQFYQSSQDEIQ 246

Query: 244  ETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENSSQD 303
             TL L   A IY+ L +LK+ FSK+    +  +  + +V++DL   S IY + + N+   
Sbjct: 247  PTL-LKLKASIYENLGMLKSNFSKQFFPEEEKNILKGLVLKDLNAISNIYYRSLNNTDDK 305

Query: 304  QLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSFVSK 363
             +D+++E A++I+ FLSSL ++ F+  E   +L  L+++CCL       W   FN FV+K
Sbjct: 306  DIDSLDECAIHIIVFLSSLHELVFSPTETPVLLDSLTKVCCLTDTQTSDWDNYFNIFVTK 365

Query: 364  ETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEI--SQISDFSDGWIFXXXXXXXXX 421
            ETGL AS++ RD++ +  S+    +Y  +L  L   +  S I D    W +         
Sbjct: 366  ETGLAASYSARDESFQFFSNLTGTNYTNLLAFLTQNVHASGIED----WKYQESLMYLME 421

Query: 422  XXXXXXXXXXXFMDAVTRIFTKLQSILEKSLSCVFVNCRXXXXXXXXXXXXMDSFPNVRD 481
                           V +       +L    +  FV  R            MDS  +++ 
Sbjct: 422  AAVNNDEEITNDFQPVLQTLDAFSELLASCETNEFVKVRVILILPKILEKFMDSLEDIKL 481

Query: 482  LVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLIAQ 541
            LV+ FLF +     +   +++K A+LISFTYYS FAEL SVLG +   Q+++  LK+I +
Sbjct: 482  LVKKFLFQTFTLVSAPTKDILKVASLISFTYYSSFAELDSVLGTETYQQLKEAVLKIINE 541

Query: 542  LYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIELQ 601
            +Y +AEDDT  +L+E L+ +I   S N +  +S+   E  L+  IS+KDPSNIQ  +E Q
Sbjct: 542  IYEDAEDDTPALLLETLNQIIGSTS-NAEVIASVRFDELQLILKISAKDPSNIQVVLEAQ 600

Query: 602  ECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXXXXXXXXXXMKRKPL 661
            ECL  LLKN+ ++ ++ + E+  P  VNV+ GS  S FEYSP            MK+KP 
Sbjct: 601  ECLQNLLKNISLEIYLKYAEMAIPSFVNVLEGSNSSGFEYSPILSLSLELLTVFMKKKPT 660

Query: 662  DPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNILD 721
            + TL   I + VF+PL   L  S+D+E+LQ  T+   +LI N+E   I PHL +I+++L+
Sbjct: 661  NGTLPPRITDFVFQPLSETLVGSQDDEVLQLTTDIYSFLINNSENSQIAPHLNTILSVLE 720

Query: 722  ALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLLSV 781
             LLS    D AA +VGSL + IF K S+++Q  IP IL+AAA RL Q  NI T +NL+ V
Sbjct: 721  KLLSINTSDSAAMNVGSLIIAIFCKLSDQLQETIPTILEAAAKRLVQVHNIATAENLIFV 780

Query: 782  FCFVTSADAQQTVDFLFNTTISNQ--NGLNLVMSKWLESFDVVRGEKRTKENIITLSKLF 839
            FC++TS +  QTVDFL +  + ++  + L L++ KWLESF+++RGEKR KENI+ LSKLF
Sbjct: 781  FCYLTSTNPNQTVDFLSSLVLDSEGNSALKLILPKWLESFEIIRGEKRIKENILALSKLF 840

Query: 840  FLNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQG-- 897
            FLND+R++S+ VNGD IPY+ D++ITRSM+K MP++YTQ+S Y KI+KLF +EL FQG  
Sbjct: 841  FLNDERISSIIVNGDSIPYDGDLVITRSMSKIMPEKYTQISAYEKIVKLFVAELSFQGNQ 900

Query: 898  -----------KHQDPQLLMAGTYGIXXXXXXXXXXXXXXXXXXXXGPLEYERLQHYVEE 946
                       K  D Q + A                           LEYE+LQ YV++
Sbjct: 901  PGLEKYIPHDLKKYDDQAIKAAN------------DANDDDWEDVDDVLEYEKLQEYVDD 948

Query: 947  DETDDRGEELDEQCLADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSE 1006
            +      ++ +   +      +S  +LL+ FF+E AAKN+SGFQ IY  L+DNEK++L+E
Sbjct: 949  ESD--LEDDEEGDVIGVQELHQSTRELLIQFFREAAAKNVSGFQEIYNHLNDNEKRVLTE 1006

Query: 1007 NLL 1009
            NL+
Sbjct: 1007 NLV 1009

>TBLA0E00240 Chr5 (36791..39823) [3033 bp, 1010 aa] {ON} Anc_3.564
            YGL241W
          Length = 1010

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/1023 (37%), Positives = 588/1023 (57%), Gaps = 32/1023 (3%)

Query: 3    DAPSLILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALLTL 62
            D  SLI +AQSP  ++R+ +E  LL+ C+                    L SRQ++LL L
Sbjct: 4    DIDSLIKQAQSPETSLREHAENSLLEWCEHDACSAFAALANVAANNTEILSSRQYSLLAL 63

Query: 63   RKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAV 122
            RKL+TMYW+PGFES+  TS +    +  +R  +LQL LD++Q SKIR   SY +VQ+SAV
Sbjct: 64   RKLITMYWSPGFESYHLTSNLNETVKAHVRHTILQLALDKNQDSKIRKSGSYCIVQVSAV 123

Query: 123  DFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHVMN 182
            DFPD WPELL  +Y +I+++HSL A+ +LNEIYDD+IS            T++++F++++
Sbjct: 124  DFPDLWPELLVTLYKSILETHSLEALSILNEIYDDIISEEMFFEEGIGLETMRVIFNILD 183

Query: 183  SYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMW---VNFLTTQN 239
               A  E K+AA  L + C++QMS V+ +S+ KR  L +++ KEI+  W   + F     
Sbjct: 184  DKTAPVETKIAAAKLFYPCLMQMSVVSPTSSLKRMNLVIDSLKEIISKWEQILQFPLEDA 243

Query: 240  KTIS---ETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQM 296
              IS     L+      IY+GL  + + FSKKI+  +  + FR   ++DL  AS +Y+ M
Sbjct: 244  LLISPEEAILEWKFRGSIYEGLAFVHSNFSKKILPMNFLNVFRKCSLQDLTPASTLYINM 303

Query: 297  VENSSQDQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTD 356
            + +      +A+N+Y ++I E+LS++    +  EEL  +L  + +LCCL+   V++W ++
Sbjct: 304  I-SGDNIAFNALNKYIIHIFEYLSNISRANYEREELILILESIYKLCCLDNLIVETWNSN 362

Query: 357  FNSFVSKETGLVASFTIRDQAAELLSSFDSQDYATVL---------VLLVHEISQISDFS 407
            FN FVSKE GL+AS+++RDQ ++ L S  S ++  +           L++ +  Q+   S
Sbjct: 363  FNEFVSKEFGLMASYSLRDQISDFLISLSSNNFNIIFKEFITNLNNCLIIEDWRQLE--S 420

Query: 408  DGWIFXXXXXXXXXXXXXXXXXXXXFMDAVTRIFTKLQSILEKSLSCVFVNCRXXXXXXX 467
              +IF                     + ++ + F          ++   +  R       
Sbjct: 421  MLYIFQSLLINDEDILNVANLNIENLLSSLAKNF-------HHYITNTILFSRLILLIPK 473

Query: 468  XXXXXMDSFPNVRDLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDN 527
                 MD   N++ +   FL  SL   L   N LIKS+ L+    Y  FAEL +VLG   
Sbjct: 474  ILEKFMDDIENIKLITCEFLKQSLAIGLDNYNALIKSSCLLMVNSYCSFAELLTVLGDKT 533

Query: 528  CIQVQQKTLKLIAQLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTIS 587
            C +VQQ TLK+I Q+  ++EDDT G++MEV++N+IDCN  N D    I Q EF+L+ +I+
Sbjct: 534  CQEVQQITLKIILQILDDSEDDTYGMIMEVINNLIDCNLPN-DKLGEIPQQEFNLILSIT 592

Query: 588  SKDPSNIQTTIELQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXX 647
            S+DPSN+Q T+E QECL KLL+ ++   +  + E+CFP MV V+IGS+ + ++YS     
Sbjct: 593  SRDPSNVQMTVESQECLKKLLEGLNTFEYSHYIEMCFPSMVKVLIGSSVTQYKYSALLSL 652

Query: 648  XXXXXXXXMKRKPLDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAE 707
                    MK+KP D  L + IC  +F PL+++L  S ++E LQ +++A  YLIYNT+  
Sbjct: 653  ALEFITIFMKKKPNDGYLPLEICKFIFNPLKDVLLVSNEDETLQLSSDAFSYLIYNTDPI 712

Query: 708  VILPHLKSIVNILDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLG 767
            V++  L  I+ ++D LLS  V D AA + GSL VT+F+ F NEI+  +  IL     RL 
Sbjct: 713  VMVESLPGILEVMDRLLSLDVTDSAAMNAGSLVVTVFTHFENEIKPYMKQILSGTTKRLI 772

Query: 768  QATNITTTQNLLSVFCFVTSADAQQTVDFLFNTTISNQNGLNLVMSKWLESFDVVRGEKR 827
            QA NI+T QNL+SV C++  ++ + T++ L     +  + L LV++KW+ +F+++RGE+R
Sbjct: 773  QAKNISTIQNLISVICYLICSNTEDTINLLSRLG-TEGDILKLVLNKWISNFEIIRGERR 831

Query: 828  TKENIITLSKLFFLNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIK 887
             K+NI+ L+KL+ LN+  +  + V+ +LIPY+ D IITRSMAKEMPDRYTQ+ VY KIIK
Sbjct: 832  IKQNILALNKLYCLNNSNIKHIMVDDELIPYDGDRIITRSMAKEMPDRYTQIPVYSKIIK 891

Query: 888  LFTSELEFQGKHQDPQLLMAGTYGIXXXXXXXXXXXXXXXXXXXXGPLEYERLQHYVEED 947
            LF  EL  Q K  +  L +  T                         L+YE+LQ YV +D
Sbjct: 892  LFIQELSEQMKQPEHNLKIEET---VETIGDGNAAAADDDWEDVEDVLDYEKLQEYV-DD 947

Query: 948  ETDDRGEELDEQCLADNLDSR-SVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSE 1006
            E D+     DE  +   +D    V +LL+   KE A+KN+S F  IY  LS++EK+ILSE
Sbjct: 948  EDDELHFGEDEDDILGTMDIEIDVKELLIRILKENASKNVSDFDKIYTTLSEDEKRILSE 1007

Query: 1007 NLL 1009
             L+
Sbjct: 1008 CLV 1010

>KNAG0D02940 Chr4 complement(529102..532131) [3030 bp, 1009 aa] {ON}
            Anc_3.564 YGL241W
          Length = 1009

 Score =  667 bits (1721), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/1015 (38%), Positives = 591/1015 (58%), Gaps = 23/1015 (2%)

Query: 7    LILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXE-LPSRQFALLTLRKL 65
            LI   QSP ++VR  +E  L+ + DE                  + L  RQFALL++RKL
Sbjct: 6    LIALLQSPDNSVRTQAESNLMTVSDEDASHVLQSLINVALNSAEKPLTERQFALLSMRKL 65

Query: 66   VTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAVDFP 125
            +T YW+P FES+R T+T+ L  +  +RD LLQL L++ Q +KI+  ASY +VQISAVDFP
Sbjct: 66   ITFYWSPAFESYRNTATLDLLTKQYVRDSLLQLSLNDSQDTKIKKSASYCIVQISAVDFP 125

Query: 126  DQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHVMNSYD 185
            D+WP+LL  +Y AI   HSL+A+ LLNEIYDDVIS            TL+I+F +++S  
Sbjct: 126  DEWPKLLEELYGAITNFHSLSAISLLNEIYDDVISEEMFFEGGIGLETLQIIFQLLSSDA 185

Query: 186  ANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNKTISET 245
            +  EAK+AA+NL H  +LQMSTV+  +T ++++  V  C  I    +  L      I+  
Sbjct: 186  STIEAKLAAINLFHATLLQMSTVDSHTTQEKRKEMVRNCVPICLDTLRTLLEGLADINSA 245

Query: 246  LQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENSSQDQ- 304
            L L     IY+ L  +KN+F  ++        F+   +RDL     + +Q+ ++S  D  
Sbjct: 246  LPLQLKGSIYKSLEFIKNKFPTQLFPSQFVEYFKIQAVRDL-----VALQINQDSFADDT 300

Query: 305  -LDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSFVSK 363
             ++A NE A++++E +SS+    +  E+   +L+ L  L  L+ +T +SW TDFN FVSK
Sbjct: 301  VVEAFNECAIHVIELISSIEITEYGTEDQHAILKALLSLSRLDANTKESWTTDFNDFVSK 360

Query: 364  ETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQI-SDFSDGWIFXXXXXXXXXX 422
            ETGL ASFTIRDQ A+ L +       T+   ++  +S I S  +D              
Sbjct: 361  ETGLAASFTIRDQVADYLGTPTGAQSQTMFENILQLVSDILSSNADPTTIESSLFLLQSV 420

Query: 423  XXXXXXXXXXFMDAVTRIFTKL---QSILEKSLSCVFVNCRXXXXXXXXXXXXMDSFPNV 479
                          + ++ + L   Q+I   + S   +  R            MDS PN+
Sbjct: 421  LAEDTDFSVSSPQTLVQLISALIGPQTINTHNDS--ILRSRIILTIPKILDVFMDSLPNI 478

Query: 480  RDLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLI 539
            + L ++ L  +L  ALS  +ELI  +TLI+FTYY YFAELPSVLG ++C ++Q+  L ++
Sbjct: 479  KQLTKDLLLKTLQDALSSTDELIFCSTLIAFTYYVYFAELPSVLGSESCRELQEAVLGIV 538

Query: 540  AQLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIE 599
              +  EAE+DT+G+L+EVL++VI CN  + D    ++Q E   + +ISSKDPSNI+ ++E
Sbjct: 539  NHVASEAEEDTNGLLIEVLNHVISCNVASTD--FKLLQKELTAMLSISSKDPSNIEVSVE 596

Query: 600  LQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXXXXXXXXXXMKRK 659
             QECL KLL N++ + +  F  IC P  VN++ G+    ++Y+P            MK+K
Sbjct: 597  SQECLEKLLDNINTERYNKFISICLPSFVNIIKGNQPLKYKYNPLLSLILEFVRIFMKKK 656

Query: 660  PLDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNI 719
            P +  L       +   L +IL +S+++E LQ AT A  +L+ NT+  +++ HL  ++ +
Sbjct: 657  PTNGMLPRNFSEGIIALLVDILERSEEDETLQLATAAFSHLLNNTDPTIVIQHLTVVIKV 716

Query: 720  LDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLL 779
            L  LLS  V D AA +VG+L VT+F+K+S E+ NLIP IL++A  RL  A N+TT +NL+
Sbjct: 717  LKRLLSMFVSDTAAQNVGTLIVTLFNKYSKELTNLIPDILESAIYRLIDAKNVTTQENLI 776

Query: 780  SVFCFVTSADAQQTVDFLFNTTISNQNGL-NLVMSKWLESFDVVRGEKRTKENIITLSKL 838
            S+ C+VT  D  Q V+FLF  + S +  + +L+ +KW E+F++VRGE++ K+NII LSK+
Sbjct: 777  SLICYVTCCDPLQMVNFLFKFSESERRDIPSLMFNKWFETFEIVRGERKIKDNIIALSKI 836

Query: 839  FFLNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGK 898
            FFL+D RL  ++VNGDL+PYE D IITRSMAKEMPDRYTQ+ VY KI+K+F +EL+F+ K
Sbjct: 837  FFLSDFRLTYVKVNGDLLPYEGDRIITRSMAKEMPDRYTQIDVYSKIVKVFVTELQFRNK 896

Query: 899  HQDPQLLMAGTYGIXXXXXXXXXXXXXXXXXXXXGPLEYERLQHYVE----EDETDDRGE 954
              D + L+                            L+YE+L+ +V+     +++   G 
Sbjct: 897  QPDAERLITSDIK-HSDELAAAEGNDDDGWEDVDDVLDYEKLKEFVDDDDDREDSVGLGN 955

Query: 955  ELDEQCLADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL 1009
            + DE    D +  +S  QLL  FFKE    N++GFQ +Y  LS++E+ ILS+ LL
Sbjct: 956  DADEITGIDAV-PQSATQLLTAFFKEAMTNNVNGFQEMYNALSESERTILSQCLL 1009

>CAGL0H07777g Chr8 (757134..760199) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241w KAP114
          Length = 1021

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/1027 (38%), Positives = 592/1027 (57%), Gaps = 38/1027 (3%)

Query: 7    LILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALLTLRKLV 66
            LI +AQSP + VR+ +E +LL  CD                    L SR F+LL+LRK +
Sbjct: 9    LIEQAQSPDNAVREGAETQLLNACDTNADEVFQSLIELGENNQTPLASRLFSLLSLRKFI 68

Query: 67   TMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAVDFPD 126
            TMYW+PGFES+RGTS V+L  +  IRDVLL+L LD+ Q +K+RN +SY VVQISAVDFPD
Sbjct: 69   TMYWSPGFESYRGTSNVQLGTKERIRDVLLKLSLDDQQSNKVRNSSSYCVVQISAVDFPD 128

Query: 127  QWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHVMNSYDA 186
            +WP+LL+ +YNAI ++HSL AM LLNEIYDDVIS            TL+I+F ++ +   
Sbjct: 129  EWPQLLSTLYNAITQNHSLNAMSLLNEIYDDVISEEMFFEGGIGYETLQIIFTLLTNAQV 188

Query: 187  NWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNK------ 240
               +K +AL L   CI QMS ++ +S+ KRK L  E   + LQ  +  L  Q +      
Sbjct: 189  RLASKTSALKLFGACISQMSVLDNNSSQKRKLLVSECLGQALQT-IKLLLEQCEIIQSDL 247

Query: 241  -TISETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVEN 299
             +I+ETL+      +Y  +  +K  F +K    D+      I +RDL+  + +Y +  ++
Sbjct: 248  TSINETLEF--KDNLYDDINSIKENFPRKFFPEDVNLYVTNIAVRDLDQLAGLYQESFKD 305

Query: 300  SSQDQLDAINEYAV-NILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFN 358
            +  +Q  +I E  V ++L+FL++        E +  +L     LC  +  T DSW++DFN
Sbjct: 306  NFDEQSMSIFENCVIHLLDFLANPIS-PLNNELISNILTASITLCEQSALTKDSWESDFN 364

Query: 359  SFVSKETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQIS-----DFSDGWIFX 413
             F SKETGL ASFTIRD+ AEL+++F+     T   L+V  +S  S     D  +  ++ 
Sbjct: 365  EFASKETGLSASFTIRDEVAELVNAFEIPQLETSFELIVGYLSNNSSHLSADKIESALYL 424

Query: 414  XXXXXXXXXXXXXXXXXXXFMDAVTRIFTKLQSILEKSLSCVFVNCRXXXXXXXXXXXXM 473
                                ++ +  + ++  ++ + S        R            M
Sbjct: 425  LQCLMNVEDDFSNTSLVPSLIEFIKSMLSQQNNLDQMS------QIRLLLLIPKTLAKFM 478

Query: 474  DSFPNVRDLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQ 533
            D  PNV+ L    L   L  A + ++ LI  + LISFTY++ +AE+ SVLG D  + VQ 
Sbjct: 479  DILPNVKQLTAETLNEILSMATNSNSHLIIISALISFTYFASYAEILSVLGNDQTLLVQN 538

Query: 534  KTLKLIAQLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSN 593
            KTL LI ++  E+ +DT+G+LMEVL+ VIDCN +NV +   + + EF L+  IS KDP+N
Sbjct: 539  KTLHLIQEISEESTEDTNGLLMEVLNCVIDCNDKNVANME-LFKFEFKLILVISGKDPAN 597

Query: 594  IQTTIELQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXXXXXXXX 653
            IQ +IE QECL KLL NV+   +++F +IC P  +N++  S  +++ YSP          
Sbjct: 598  IQVSIESQECLEKLLLNVNTNDYLSFVDICIPSFINIIKSSEVTNYSYSPLLSLVLEFIT 657

Query: 654  XXMKRKPLDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHL 713
              MK KP +  L  ++   VF+PL + L +S +EE+LQ ATEA  Y+I+N+  +VI P L
Sbjct: 658  VFMKNKPQEALLPSSVSEYVFDPLVSCLLKSTEEELLQIATEAFSYMIHNSSKDVITPKL 717

Query: 714  KSIVNILDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNIT 773
            ++IVNILD LLS  + D AA +VG+L + + +++S  +  L+P I+ AA  +L  + NIT
Sbjct: 718  ETIVNILDRLLSSNISDSAAMNVGTLILALITEYSEPMNPLLPSIISAAVRKLVVSNNIT 777

Query: 774  TTQNLLSVFCFVTSADAQQTVDFLFNTTISNQNG----LNLVMSKWLESFDVVRGEKRTK 829
            T QNL+++ CF+   D +QTVDFL   TI N  G    L +++ KWL++F VVRGE R K
Sbjct: 778  TQQNLVTLLCFLVCHDPKQTVDFLCELTIKNDKGEQVALPVIIQKWLDTFAVVRGENRIK 837

Query: 830  ENIITLSKLFFLNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLF 889
            ENI+ LS+LF L D R+N ++VNG++IPY+ D+IITRSMAK MPDRYT VS   KI+K+F
Sbjct: 838  ENIVALSQLFLLGDDRVNEVKVNGEIIPYDGDLIITRSMAKSMPDRYTTVSAPEKIVKMF 897

Query: 890  TSELEFQGKHQDPQLLMA----GTYGIXXXXXXXXXXXXXXXXXXXXGPLEYERLQHYV- 944
              EL FQG++++P+ L+        G+                      ++YE+LQ Y+ 
Sbjct: 898  LGELGFQGRNKNPEELLTTDDMKGMGLKPNQQSNNDEGDDDWEDVDDV-VDYEKLQEYID 956

Query: 945  --EEDETDDRGEELDEQCLADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQ 1002
              ++ + +  GE   E         +S+ +LL DFF   A KN++GFQ IY  LS+ E++
Sbjct: 957  DEDDLDDNSVGEL--ETITGQQHIPQSIPELLKDFFNTAAQKNVAGFQEIYNNLSEEERK 1014

Query: 1003 ILSENLL 1009
             +SE +L
Sbjct: 1015 CISELIL 1021

>Ecym_2594 Chr2 complement(1155746..1158805) [3060 bp, 1019 aa] {ON}
            similar to Ashbya gossypii AFR269W
          Length = 1019

 Score =  629 bits (1621), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/1010 (35%), Positives = 560/1010 (55%), Gaps = 15/1010 (1%)

Query: 3    DAPSLILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALLTL 62
            D   LIL AQSP+ + R+S+E  LL +C                    E+ S+QF L+++
Sbjct: 14   DLSELILHAQSPVKDQRESAETALLSLCSSDPGSVFVSLINIASDPSAEVASKQFCLVSI 73

Query: 63   RKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAV 122
            RKL+TMYW  GFES+ G   V   A+ ++R+ LL+L L + Q SKI + +SY +VQI+AV
Sbjct: 74   RKLITMYWNAGFESYCGPPGVNEGAKEVVRENLLKLVLGDSQNSKIVSASSYCIVQIAAV 133

Query: 123  DFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHVMN 182
            DFPD+WP LL+ VY+AI   +S  A+ LL+EI+DDV+S            T++IVF +++
Sbjct: 134  DFPDEWPSLLDTVYDAITYDYSANALSLLHEIFDDVVSEEMFFQGGIGWKTVQIVFSLLS 193

Query: 183  SYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNKTI 242
            +  +++  K AA+ L H C+LQ+ + +   + + +    +   E L +++  L   N   
Sbjct: 194  NTSSSFGIKDAAMKLYHSCLLQLLSPHALESDENRSQIAQHVNETLHIFLQLLGNHNLAD 253

Query: 243  SETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENSSQ 302
                 L   A  Y+ LTLLK +F KK+   D+   F+T+ ++DL+   + Y Q++ +  +
Sbjct: 254  PSNELLDLKAHTYENLTLLKTQFPKKLFPDDLKGSFKTVALKDLDTLGKYYSQILASVDE 313

Query: 303  DQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSFVS 362
              L +++E A+NI+ FLSSL +      E+  +L  L +LC L     D    D NSFVS
Sbjct: 314  ALLQSVDESAINIIGFLSSLHECELEGPEVNNLLESLVQLCSLPMHQADDLTNDLNSFVS 373

Query: 363  KETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFXXXXXXXXXX 422
            KETG+   +TIRD+  + LS     +Y  +   L+ +   +      W            
Sbjct: 374  KETGVSGVYTIRDEVFQFLSDMIGTNYRNIFQTLLEQAGSVMHLD--WEKQESMLYLLQS 431

Query: 423  XXXXXXXXXXFMDAVTRIFTKLQSILEKSLSCVFVNCRXXXXXXXXXXXXMDSFPNVRDL 482
                          +  +  +LQ+ILE       V  R            +    N++ +
Sbjct: 432  CQGNTEEFEVNSQGLVELLLRLQNILESQNIHCLVWSRLSITIAKILEKFVCKLENIKLI 491

Query: 483  VQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLIAQL 542
            V+ F+F +L  A S  N  +K+ +LIS+  YS F  L SVLG ++C +++++ L +I  +
Sbjct: 492  VKEFIFKTLTIASSSPNSTMKAGSLISYKCYSSFVALGSVLGVEDCEKLERQVLDIINDI 551

Query: 543  YPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIELQE 602
            Y E +DDT G L+EVL  VI  N E+ +   S+  +E   V  +S+ DP ++Q  +E Q+
Sbjct: 552  YAEVDDDTPGFLLEVLSGVIASNPESTN--KSLKASELEFVLKLSTSDPYSVQVVVEAQD 609

Query: 603  CLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXXXXXXXXXXMKRKPLD 662
            CL  LL+ V    +I + E+C P  V+V+       F Y+P            +K+ P D
Sbjct: 610  CLSSLLQKVRSDDYIYYAELCIPSFVSVLRADGTHGFAYTPLVSLSLELLTVFLKKNPSD 669

Query: 663  PTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNILDA 722
              L  ++   VFEPL +++  S+D+E+LQ +TEA  +L+ N++ + I  HL++ + IL+ 
Sbjct: 670  GFLPQSVVEYVFEPLTSLIMSSEDDELLQLSTEAFAFLLANSKKDDISSHLQTAIMILER 729

Query: 723  LLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLLSVF 782
            LL+      A++ VGSL +++ +KF+++IQ+++P +L+AAA RL Q  NI T +NL+ VF
Sbjct: 730  LLASDTSYSASSKVGSLLLSVLTKFADQIQDIMPKLLEAAARRLVQVNNIHTVENLILVF 789

Query: 783  CFVTSADAQQTVDFLFNTTISN--QNGLNLVMSKWLESFDVVRGEKRTKENIITLSKLFF 840
            C +TS D +QTVDFL +  + +   + L L++ KWL+SF+++RGEK+ KENI+ LSKLFF
Sbjct: 790  CHLTSVDVKQTVDFLSSLILDSDGHSALQLIIPKWLDSFEIIRGEKKIKENIVALSKLFF 849

Query: 841  LNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGKHQ 900
            LND R+ ++ VNGDLIPY+ D+IITRSMAK +PD+YT++S Y KIIKL  +EL FQ    
Sbjct: 850  LNDSRVANILVNGDLIPYDGDLIITRSMAKSLPDKYTRISAYEKIIKLMVTELMFQYNQP 909

Query: 901  DPQLLMAG-----TYGIXXXXXXXXXXXXXXXXXXXXGPLEYERLQHYVEEDETDDRGEE 955
            DP   M+      T                         LEYE+LQ Y+E  + DD  ++
Sbjct: 910  DPDKYMSSQSEKLTKTNQDNKSNSGNADHDDDWEDIDDVLEYEKLQEYIEGSDIDDDDDD 969

Query: 956  LDEQCLADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILS 1005
            L       N    +  +LL  FFKE   K+ISGF+ IY +L++ EK+ LS
Sbjct: 970  LLIM----NNIQETTSELLSQFFKEAVIKDISGFKDIYTRLNEQEKRCLS 1015

>AFR269W Chr6 (916446..919499) [3054 bp, 1017 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGL241W (KAP114)
          Length = 1017

 Score =  612 bits (1579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/1005 (35%), Positives = 543/1005 (54%), Gaps = 13/1005 (1%)

Query: 3    DAPSLILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALLTL 62
            D   L+L AQS     R+S+E+ LL+ C                    EL SRQF L TL
Sbjct: 20   DLRQLVLAAQSAGKIERESAEQSLLEACRADPAAVCVGLVKMATQENTELASRQFCLYTL 79

Query: 63   RKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAV 122
            RKL+TMYW  GFES+ G   V+ +A+  +RD LL++ +   Q SKI + ++Y VVQI+A 
Sbjct: 80   RKLITMYWNAGFESYCGPPGVREDAKETVRDALLRMAVSRTQDSKIISASAYCVVQIAAF 139

Query: 123  DFPDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHVMN 182
            DFPD+WP LL  VY +I    SLAA+ LL+EI+DDV+S            T++I+F ++ 
Sbjct: 140  DFPDEWPGLLKSVYESITGERSLAALGLLHEIFDDVVSEEMFFQGGVGWQTIRIIFELLG 199

Query: 183  SYDANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNKTI 242
              D     K AA+ L H C+LQ++          +        E L+++   L       
Sbjct: 200  D-DGPVALKDAAMKLYHSCLLQLAAPQALEEADTRAAVGAHVHEALELFAQLLEHCRSLE 258

Query: 243  SETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENSSQ 302
                 L   A  Y+ L L+K +  K+     +       V+RDL      Y Q +    +
Sbjct: 259  PHADLLQFQAHTYENLVLIKTQLPKRFFPGALREALLDAVLRDLVLLGAYYEQHLAEGDE 318

Query: 303  DQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSFVS 362
            + L A+ E A++++ FLSS+ + +   E +  +L  L+RL CL+    ++W  D+NSF+S
Sbjct: 319  ELLKAVAESAIHMVIFLSSVHECKLNTERMCMLLGSLARLSCLSAIQTEAWDVDYNSFIS 378

Query: 363  KETGLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFXXXXXXXXXX 422
            KETGL +S+T RD+  + LS     +Y   L +L  ++ Q+   S  W            
Sbjct: 379  KETGLTSSYTPRDEIFQYLSDLGGHNYREFLRVLFEQLLQVE--SMAWRSQESLLFLLQS 436

Query: 423  XXXXXXXXXXFMDAVTRIFTKLQSILEKSLSCVFVNCRXXXXXXXXXXXXMDSFPNVRDL 482
                          V  +  K Q +L        V CR            MDS PNV+DL
Sbjct: 437  CQLNSEGPQFDEQTVAGLLEKSQRLLRSGDVHPLVRCRVAMTVPRLLEKYMDSLPNVKDL 496

Query: 483  VQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLIAQL 542
            V+ F+FL+ +  ++ +N+L+ ++ LI+FTYYS F +  SVLG     ++++  L  I  +
Sbjct: 497  VREFVFLTFNTTVTSENQLLSASALIAFTYYSSFVDFGSVLGVQTAEELEKLVLSTIKNI 556

Query: 543  YPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIELQE 602
                ++DT G L+EVL  V  CN E+ +    +   E  LV  +++ DPSNIQ  +E QE
Sbjct: 557  LDGIDEDTPGFLLEVLSGVTGCNKESRNRELKLY--ELQLVQNVATADPSNIQVVVEAQE 614

Query: 603  CLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXXXXXXXXXXMKRKPLD 662
            CL  LL+  D + ++ + E+C P  + V+   +   + Y+P            M++KP+D
Sbjct: 615  CLKNLLQ-YDPENYLQYAELCIPSFLEVLRADSSHGYAYTPLVSLSLELLVVFMRKKPVD 673

Query: 663  PTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNILDA 722
              L  ++ + +F+PL ++L  ++D+E+LQ +TEA   L+ ++  + +L  +  I+ IL+ 
Sbjct: 674  SALPRSMVDYIFDPLSSMLLNAEDDELLQLSTEAFTALLASSLTDDLLGRIPVIITILEK 733

Query: 723  LLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLLSVF 782
            LLS      AA + G+L + + +KF+N+IQ+++P IL+AAA RL Q  N+ T +NLL VF
Sbjct: 734  LLSARTSHSAAINAGTLLIAVLTKFANQIQDIMPKILEAAAKRLVQIKNLHTAENLLFVF 793

Query: 783  CFVTSADAQQTVDFLFNTTI--SNQNGLNLVMSKWLESFDVVRGEKRTKENIITLSKLFF 840
            C++TS DA+QTVDFL +T I    +  L  ++ +WLE+F+V+RGE + KENI++LSKLFF
Sbjct: 794  CYLTSIDARQTVDFLSSTIIDEGGRTALQAIVPRWLEAFEVLRGEHKIKENILSLSKLFF 853

Query: 841  LNDQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGKHQ 900
            L D R+  + VNGDLIP++ DIIITRSMAK+MPD+YTQ+S   KI+KLF +EL FQ    
Sbjct: 854  LEDPRIAGITVNGDLIPHDGDIIITRSMAKKMPDKYTQISAAEKIVKLFVAELAFQQNQP 913

Query: 901  DPQLLMAGTYGIXXXXXXXXXXXXXXXXXXXXGPLEYERLQHYVEEDETDDRGEELDEQC 960
            DP        G                       L+YE+LQ Y ++ + DD G+ L    
Sbjct: 914  DPGRYPKDGSG-PADPHDSEGDSADEDWEDVDDILDYEKLQEYADDSDIDDTGDSL---L 969

Query: 961  LADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILS 1005
               N++  +   LL  FFKE  A+N SGFQ IY +L++ EK+ LS
Sbjct: 970  FTSNIEEDAT-TLLTQFFKEAVARNASGFQEIYSRLTEQEKKSLS 1013

>Kwal_47.19258 s47 complement(1156969..1160004) [3036 bp, 1011 aa]
            {ON} YGL241W (KAP114) - Kap114p [contig 344] FULL
          Length = 1011

 Score =  605 bits (1559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/1013 (35%), Positives = 565/1013 (55%), Gaps = 21/1013 (2%)

Query: 8    ILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALLTLRKLVT 67
            I  AQSP    R+  E  + ++C E                   + +R F+LL+LRKL+T
Sbjct: 9    IASAQSPDKQTREQGEACIWKLCSEDPSFSCACLVQLACRQDYRIENRLFSLLSLRKLIT 68

Query: 68   MYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAVDFPDQ 127
            MYW+ GFES+RG   V  + + +IR+ LL+L LD+ Q ++I+ G+SY +VQI+AVDFPD+
Sbjct: 69   MYWSAGFESYRGPPGVNEDCKELIRNSLLELGLDDAQDTRIQKGSSYCIVQIAAVDFPDE 128

Query: 128  WPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHVMNSYDAN 187
            WP L+ IVYNAI++SHS++A+ +LNEI+DDV+S            T++++ +++N    +
Sbjct: 129  WPGLIEIVYNAILRSHSVSALYVLNEIFDDVVSEEMFFNQGVGWQTIQLISNILNDPGCS 188

Query: 188  WEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQNKTISETLQ 247
              AK +A  L   C+LQ+ +   SST + +       +E  +M +N L   +    E + 
Sbjct: 189  ILAKHSAAKLYQACLLQLQSPAASSTPELRSALTNHIQESTKMLLNLLQAYSNIQDEAID 248

Query: 248  LMA-GAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENSSQDQLD 306
            L+     + + LT ++  F KK+ +  +  +  T++   +EN +++     +N+ +++  
Sbjct: 249  LLRLHQTVLKCLTTIRTGFPKKLSSDTIGRELTTVL---IENFTRVAALSNDNTEEEKSS 305

Query: 307  AINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSFVSKETG 366
             INE  + ++  L+++ D       L  V+       CL  +  ++W++DFN FVSKE G
Sbjct: 306  EINEVGIQMVSLLATIPDRYLGGPALSKVVEDFVLASCLGTEEEEAWESDFNHFVSKEVG 365

Query: 367  LVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFXXXXXXXXXXXXXX 426
            L +S+ IRD+ ++ L       Y ++  +LV  +S++      W                
Sbjct: 366  LASSYYIRDECSQFLQEISGARYQSIFEILVSALSKVDPLE--WRLKEAVFYLIQSLCIN 423

Query: 427  XXXXXXFMD-AVTRIFTKLQSILEKSLSCVFVNCRXXXXXXXXXXXXMDSFPNVRDLVQN 485
                  F +  V  +  +L+  +E     + V  R            MD   NV+D+V+ 
Sbjct: 424  EDEVTVFNNNEVFDLLNELRQNMEGQNLQLHVRTRAILALPKVVEKFMDRLENVKDIVKE 483

Query: 486  FLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLIAQLYPE 545
             LF +L+ A   ++  +K++ LI+F+ Y+ FAEL SVLG +   + +   L LI  +  +
Sbjct: 484  LLFATLNGACEDNDPTLKASALIAFSSYASFAELDSVLGLEAFQEARCLVLNLIQDVLED 543

Query: 546  AEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIELQECLG 605
            +EDDT  VL+E L+  +   S    DT    Q   +LV  IS+KDPSN+Q  +E Q+C+ 
Sbjct: 544  SEDDTPAVLLEALNPALAKQSNTTKDTL-FYQQALNLVLKISAKDPSNLQVVLEAQDCIS 602

Query: 606  KLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXXXXXXXXXXMKRKPLDPTL 665
             LL     ++++   + C P  VN++     +++ Y+P            MK+KP D  L
Sbjct: 603  ALLSGESTESYVELSKSCIPLFVNILGTMKANNYIYAPIVSLSLELLTVFMKKKPSDGFL 662

Query: 666  SITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNILDALLS 725
               I + VFEPL +IL  S D+EILQ A++AL YL+ N++A  + P L ++++IL+ LLS
Sbjct: 663  PSNISSYVFEPLSDILINSSDDEILQVASDALTYLMSNSQASDLEPLLPTVLSILEKLLS 722

Query: 726  PGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLLSVFCFV 785
                D  A +VGSL V    K+S ++Q + P IL+AA  R   A N+ TT+NL+ VFC++
Sbjct: 723  VNTSDSGAMNVGSLVVITLEKYSYQLQEVYPKILEAATKRFVSAKNVATTENLVFVFCYL 782

Query: 786  TSADAQQTVDFLFNTTISNQNG--LNLVMSKWLESFDVVRGEKRTKENIITLSKLFFLND 843
            TS +  + ++FL + TI+ + G  LN V+ KWLESF+V+RGE+R KENI+ LSK+FF +D
Sbjct: 783  TSINPAEAINFLSSFTINEKEGNSLNYVLPKWLESFEVLRGERRIKENIVALSKIFFQSD 842

Query: 844  QRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGKHQDPQ 903
             R+ S+ VNGD +PY+ DII+TRSMAK+MP  YT+++ + KI+KLF +ELEFQ     P 
Sbjct: 843  PRVGSVIVNGDPLPYKGDIIVTRSMAKKMPIEYTRITAHEKIVKLFVAELEFQSSQ--PS 900

Query: 904  L-----LMAGTYGIXXXXXXXXXXXXXXXXXXXXGP-LEYERLQHYVEEDETDDRGEELD 957
            L     + A  +                         LEY++LQ +V ED   +R +  D
Sbjct: 901  LDKFLPVNARKFDTSSSFNNNAEDEQDDGEWEDVDDVLEYDQLQQFVVED--GERNDSDD 958

Query: 958  EQCLADNLD-SRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL 1009
            E  LA+  D  +S  +LL+DFFKE AAKNI+  + +YE LS++EK+ILSENL+
Sbjct: 959  EDSLANIQDIQQSTKELLIDFFKEAAAKNINNLRDLYENLSEHEKKILSENLM 1011

>KLTH0G00792g Chr7 (53588..56653) [3066 bp, 1021 aa] {ON} similar to
            uniprot|P53067 Saccharomyces cerevisiae YGL241W
          Length = 1021

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/1010 (35%), Positives = 544/1010 (53%), Gaps = 16/1010 (1%)

Query: 8    ILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALLTLRKLVT 67
            I+ AQS    VR++SE  L  +C E                   +  R F+LL+LRKL+T
Sbjct: 20   IVGAQSTNGQVRENSENALWSLCSENPSATCTSLMQLACGIENAVEDRIFSLLSLRKLIT 79

Query: 68   MYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAVDFPDQ 127
            MYW+ GFES+RG   +  E + MIR+ LL L LD+ Q ++++N +SY +VQI+AVDFPD+
Sbjct: 80   MYWSAGFESYRGPPGIGDEGKRMIRESLLNLGLDDSQDTRLKNCSSYCIVQIAAVDFPDE 139

Query: 128  WPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHVMNSYDAN 187
            WP L++ +++AI++  SL+A+ +LNEI+DDV+S            T++++F ++++ D++
Sbjct: 140  WPTLVDSIFDAILQRQSLSALYVLNEIFDDVVSEEMFFHRGIGWQTIQLIFRILSNSDSS 199

Query: 188  WEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMWVNFLTTQN--KTISET 245
             +AK A+  L   C+LQ+ +   +ST   K       +E + + +  L   +  K I+ T
Sbjct: 200  TQAKTASAKLYQACLLQLQSPMATSTQDYKYALSNHIQESVLLLIKVLKEHHIAKGIN-T 258

Query: 246  LQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQMVENSSQDQL 305
              L     +   L  +K  FSKK+   +   +    +  +    +++ + +  +   D  
Sbjct: 259  SALNLQQVLLSCLNTIKTGFSKKLFTIESAQELIEFLFENFRKIAELCIDVTIDP--DMK 316

Query: 306  DAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVDSWQTDFNSFVSKET 365
             A NE  + ++   ++L D     +    ++        ++ +  + W  DFN F SKET
Sbjct: 317  LAANEVGIQMVSLFATLMDTLTENQNWNFIVESFVIAGMISDEDAECWDNDFNVFASKET 376

Query: 366  GLVASFTIRDQAAELLSSFDSQDYATVLVLLVHEISQISDFSDGWIFXXXXXXXXXXXXX 425
            GL  SFT+RD+  + +       Y +V   L   +  I + S  W               
Sbjct: 377  GLSTSFTVRDECEQFMQGLSGFAYNSVFNALTSAL--IYNESPNWKVQESILFFIQALCG 434

Query: 426  XXXXXXXF-MDAVTRIFTKLQSILEKSLSCVFVNCRXXXXXXXXXXXXMDSFPNVRDLVQ 484
                   F  +    +   L+ ILE   S + V  R            M++  +V+ LV+
Sbjct: 435  NEDDEVSFNFEKTQSLLNTLRQILELEDSHILVKTRSLIALPKVIERFMETLESVKALVK 494

Query: 485  NFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDNCIQVQQKTLKLIAQLYP 544
            + LF S   A    +  +K   LISFTYY+ FAEL SVLGP    + Q+    +I +L  
Sbjct: 495  DSLFHSFSLARQTPSYTVKIGCLISFTYYASFAELDSVLGPGFYGEAQRSVSAIIQELLE 554

Query: 545  EAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTIELQECL 604
            EAE+DT  +L+E L   +  N +  + T S  Q    L+  ISSK PSNIQ  +E Q+CL
Sbjct: 555  EAEEDTPSILLEALAPTLSSNHKTTE-TISFYQLALQLILKISSKHPSNIQVGLEAQDCL 613

Query: 605  GKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXXXXXXXXXXMKRKPLDPT 664
              LLK+   + ++T+ + C P   NV+ G   + F Y+P            +KRKP D  
Sbjct: 614  SNLLKSTSTEEYVTYSKTCIPLFANVLNGMIENKFAYAPIVCLSLEMLTVFIKRKPRDGC 673

Query: 665  LSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAEVILPHLKSIVNILDALL 724
            L   I + VF PL +IL  S D+EI+Q  ++AL YLI N+E   + PHL  ++  L+ LL
Sbjct: 674  LPSDITSYVFNPLSDILINSSDDEIMQLTSDALVYLISNSEPHQLFPHLNVVLCDLEKLL 733

Query: 725  SPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLGQATNITTTQNLLSVFCF 784
            S    D  A HVG+L V +  KFS ++Q + P IL+AA  +   A N+ TT+NL +VFC+
Sbjct: 734  SAETSDSGAIHVGNLVVVVLEKFSKQLQEIYPRILEAATKKFLGAHNVFTTENLANVFCY 793

Query: 785  VTSADAQQTVDFL--FNTTISNQNGLNLVMSKWLESFDVVRGEKRTKENIITLSKLFFLN 842
            + S +  + ++FL  F+     Q+ L  V+SKWLESF+V+RGEKR KENI+ LSKLFF  
Sbjct: 794  LVSLNPAEVINFLSSFSIDQQEQSVLCPVLSKWLESFEVLRGEKRIKENIMALSKLFFQA 853

Query: 843  DQRLNSMQVNGDLIPYESDIIITRSMAKEMPDRYTQVSVYHKIIKLFTSELEFQGKHQDP 902
            D R++ + VNGD IPY  D+IITRSMAK MP++YT+++ Y KI+KLF +EL+FQ    D 
Sbjct: 854  DSRIDKIYVNGDPIPYSGDMIITRSMAKSMPEKYTRITAYQKIVKLFVAELDFQTSQTDL 913

Query: 903  Q--LLMAGTYGIXXXXXXXXXXXXXXXXXXXXGPLEYERLQHYVEEDE-TDDRGEELDEQ 959
            +  + M+                           LEYE+LQH+V++D  + DR EE D  
Sbjct: 914  EKYIPMSAKKTECSTIANAEAGQEESDWEDVDDVLEYEQLQHFVDQDTFSSDRDEE-DVI 972

Query: 960  CLADNLDSRSVHQLLVDFFKEVAAKNISGFQSIYEQLSDNEKQILSENLL 1009
                N+  +S  +LL+ FFKE A++NI+ F++IY+ LS+NEK+ILSENL+
Sbjct: 973  PGIKNVQ-QSTRELLISFFKEAASQNINDFKTIYDNLSENEKRILSENLV 1021

>KLLA0A00803g Chr1 (76350..79208) [2859 bp, 952 aa] {ON} similar to
           uniprot|P53067 Saccharomyces cerevisiae YGL241W KAP114
           Karyopherin, responsible for nuclear import of Spt15p,
           histones H2A and H2B, and Nap1p; amino terminus shows
           similarity to those of other importins, particularly
           Cse1p; localization is primarily nuclear
          Length = 952

 Score =  254 bits (648), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 218/860 (25%), Positives = 373/860 (43%), Gaps = 46/860 (5%)

Query: 5   PSLILEAQSPLDNVRKSSEERLLQMCDEXXXXXXXXXXXXXXXXXXELPSRQFALLTLRK 64
           P L+   QSP    R+ +E  LL+ C                       +RQ ALL LRK
Sbjct: 4   PYLLEGIQSPQKEEREDAENSLLERCATDPPDTFIELIDTATNNNASASTRQLALLCLRK 63

Query: 65  LVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAVVQISAVDF 124
             TMYW+ GF SF G   V  + + ++R  LL L  +E    K+ +  +Y +VQI AVDF
Sbjct: 64  FTTMYWSAGFPSFVGPPGVGEQGKDLVRRGLLSLLANEDTEKKVISTVTYCIVQICAVDF 123

Query: 125 PDQWPELLNIVYNAIMKSHSLAAMKLLNEIYDDVISXXXXXXXXXXXXTLKIVFHVMNSY 184
           PD+WP LL+ +   I+  HS  A+ LL E+  D+I+             +  V   +N  
Sbjct: 124 PDEWPGLLDYLNENILNYHSENAISLLTELVQDIITNEMFFDNHSGAKIVNTVLLALNDD 183

Query: 185 DANWEAKVAALNLLHCCILQMSTVNGSSTTKRKELTVEACKEILQMW-VNFLTTQNKTIS 243
               +AK   L L H CI Q+  V+   T+           E++  W +  L   N  I 
Sbjct: 184 TLRLQAKSKLLQLYHHCISQLRNVSMFVTS-----------ELMSEWLIPHLKAMNDCID 232

Query: 244 ETLQLMAGAKIYQGLTLLKNEF----------SKKIVAP--DMYHQFRTIVMRDLENASQ 291
           + L+   G  +   +  LK E           ++ I+    D+ ++ R I +  +++ + 
Sbjct: 233 KLLE-SYGNNMESEVIGLKGELFMALSKLFDLNQSILGSNGDLSYRLR-ITLDAIKSNAN 290

Query: 292 IYMQMVENSSQDQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLCCLNQDTVD 351
            Y + + N+ + +L+ IN   +N +++L+ +         L        +LC L +D   
Sbjct: 291 SYARALTNNDELRLEIINSSCINTVQYLAYIPSDLIENPTLPDFTEDFIKLCLLPEDYFK 350

Query: 352 SWQTDFNSFVSKETGLVASFTIRDQAAELLSSFDSQDYA----TVLVLLVHEISQISDFS 407
              +DFN F+SKETGL AS+  RD+  + +SS   + Y     +VL   +   S  + + 
Sbjct: 351 --LSDFNEFISKETGLSASYNARDEIGQYVSSCSDEIYRHITDSVLQKCLQVTSNEAQYQ 408

Query: 408 DGWIFXXXXXXXXXXXXXXXXXXXXFMDAVTRIFTKLQSILEKSLSCVFVNCRXXXXXXX 467
           +  +F                       AV         IL+      FV  R       
Sbjct: 409 EACLFLFQELCSNETSMNVPRYQDFLSLAVM--------ILDDDACPTFVKSRTILTIPK 460

Query: 468 XXXXXMDSFPNVRDLVQNFLFLSLDFALSQDNELIKSATLISFTYYSYFAELPSVLGPDN 527
                M++ P ++ LVQ FL  +++  +S +++ + ++ +ISFTYY+ FAEL S+L    
Sbjct: 461 FFENNMETLPEIKQLVQQFLVKTVNCTISAEDDFLLASLVISFTYYTSFAELGSILDYQT 520

Query: 528 CIQVQQKTLKLIAQLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTIS 587
            + +QQ  LK I  LY ++E+D+ G+L+E +  ++       D  +   Q   +L+  +S
Sbjct: 521 SMILQQSLLKAIKTLYVDSEEDSLGLLLEAMHEIVKTWHFQQDLHTK--QEILNLLLKLS 578

Query: 588 SKDPSNIQTTIELQECLGKLLKNVDVKTFITFWEICFPPMVNVMIGSAHSSFEYSPXXXX 647
           S +PSN++   E    L  LL++++   +    E CFP  +  M     S   YSP    
Sbjct: 579 SSEPSNVRIVFESVRSLPYLLRDINCTDYTRLCESCFPSFIEAMSTFLQSQQTYSPLVVL 638

Query: 648 XXXXXXXXMKRKPLDPTLSITICNDVFEPLQNILNQSKDEEILQYATEALGYLIYNTEAE 707
                   +K  P+   +S  +   V  P+   + Q  DE I + A +A  YL  N+  +
Sbjct: 639 ALEFLSVFLKNPPVGNHISDEVAEYVLNPIVQFIKQCPDENIAETALQAFVYLACNSNPK 698

Query: 708 VILPHLKSIVNILDALLSPGVPDQAATHVGSLTVTIFSKFSNEIQNLIPMILQAAAARLG 767
                  S+ ++   +  P         V  + +             I  I++   ++L 
Sbjct: 699 F---WKDSMFDLCSLVFDPERSLYKTIDVAPIMLLSLRVTQPHENRFIGQIMEYTISKLV 755

Query: 768 QATNITTTQNLLSVFCFVTSADAQQTVDFLFNTTISNQNGL-NLVMSKWLESFDVVRGEK 826
               +    + + + C V   D Q  + ++F+  IS +  + N ++ +  + F+  R + 
Sbjct: 756 DPNKLHPVDSFIIISCEVILKDIQSFLAYIFSIPISAEESIPNKLIRELFDCFEENRSKN 815

Query: 827 RTKENIITLSKLFFLNDQRL 846
             KE  ++LS+LFF NDQRL
Sbjct: 816 MLKEVALSLSELFFSNDQRL 835

>KAFR0H02700 Chr8 (512455..515580) [3126 bp, 1041 aa] {ON} Anc_8.624
           YPL125W
          Length = 1041

 Score = 37.0 bits (84), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 44/92 (47%), Gaps = 7/92 (7%)

Query: 52  LPSRQFALLTLRKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNG 111
           L  R  A++  +  +  YW     S R  +  K E + +IR  L +L  +++    I+N 
Sbjct: 62  LQVRWLAVIQFKNGIDKYW----RSTRVHAISK-EEKSLIRSRLFELIDEQNNQLTIQNA 116

Query: 112 ASYAVVQISAVDFPDQWPELLNIVYNAIMKSH 143
              A  +IS +DFP +WP L   + + +  +H
Sbjct: 117 Q--AASKISRLDFPGEWPNLFEQLEHLLKDNH 146

>Kpol_530.12 s530 (33954..37046) [3093 bp, 1030 aa] {ON}
           (33954..37046) [3093 nt, 1031 aa]
          Length = 1030

 Score = 35.4 bits (80), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 5/76 (6%)

Query: 60  LTLRKLVTMYWTPGFESF---RGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAV 116
           L +R +  + +  G E F     T+ +K + +  IR  L +L  +++    I+N  S A 
Sbjct: 58  LQIRWMAVIQFKNGIEKFWRSSRTNAIKKDEKASIRARLFELIDEQNNQLAIQN--SQAA 115

Query: 117 VQISAVDFPDQWPELL 132
            +I+ +DFP  WP L 
Sbjct: 116 AKIARLDFPVDWPNLF 131

>Ecym_8309 Chr8 complement(629689..632772) [3084 bp, 1027 aa] {ON}
           similar to Ashbya gossypii ACR159C
          Length = 1027

 Score = 34.7 bits (78), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/81 (22%), Positives = 36/81 (44%), Gaps = 7/81 (8%)

Query: 52  LPSRQFALLTLRKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNG 111
           L  R  A++  +     +W P        + +  + +  IRD L  +  +E+    I+N 
Sbjct: 59  LQVRWLAIIQFKNSTDKFWRPT-----RMNCISKDEKSSIRDRLFHMVNEENNQLAIQNA 113

Query: 112 ASYAVVQISAVDFPDQWPELL 132
             +A  +I+ +D+P  WP + 
Sbjct: 114 --HATAKIARLDYPQNWPNMF 132

>NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  silent
           copy of MATalpha2 gene at HMLalpha
          Length = 211

 Score = 33.5 bits (75), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 38/73 (52%), Gaps = 12/73 (16%)

Query: 539 IAQLYPEAEDDTDGVLMEVLDNVIDCNSENVDDTSSIIQTEFHLVFTISSKDPSNIQTTI 598
           I   +P A+++ DG     L N++          S++ Q+       ++SKD SNIQ T 
Sbjct: 32  ICSKFPTAKENVDGSYQIQLHNIVSF-------LSTLTQST-----NLTSKDCSNIQLTY 79

Query: 599 ELQECLGKLLKNV 611
           EL   LGK+LK++
Sbjct: 80  ELSSMLGKVLKDM 92

>CAGL0J06776g Chr10 (651309..654392) [3084 bp, 1027 aa] {ON} highly
           similar to uniprot|Q02932 Saccharomyces cerevisiae
           YPL125w KAP120 nuclear transport factor
          Length = 1027

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 26/103 (25%), Positives = 49/103 (47%), Gaps = 18/103 (17%)

Query: 52  LPSRQFALLTLRKLVTMYWTPGFESFRGT--STVKLEARGMIRDVLLQLCLDEHQPSKIR 109
           L  R  A++  +  V  YW       R T  +++  + +  IR  L  +  +++    I+
Sbjct: 60  LHVRWLAVIQFKNGVEKYW-------RATRINSIGKDEKASIRKRLFDVVDEQNNQLCIQ 112

Query: 110 NGASYAVVQISAVDFPDQWP-------ELLNIVYNAIMKSHSL 145
           N    A  +IS +DFP +WP       +LLNI +   +++H++
Sbjct: 113 NAQ--ATARISRIDFPVEWPNLFESIEQLLNINHRKEIQTHNI 153

>NDAI0E02170 Chr5 complement(445219..448308) [3090 bp, 1029 aa] {ON}
           Anc_8.624 YPL125W
          Length = 1029

 Score = 34.3 bits (77), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 39/81 (48%), Gaps = 7/81 (8%)

Query: 52  LPSRQFALLTLRKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNG 111
           L SR  A +  +  V  YW            +  + +  IR  L +L +DE Q +++   
Sbjct: 61  LQSRWLAAIQFKNGVDRYWRSS-----RVHAINKDEKASIRARLFEL-IDE-QNNQLGIQ 113

Query: 112 ASYAVVQISAVDFPDQWPELL 132
            + A+ +I+ +DFP +WP+L 
Sbjct: 114 YAQAIAKIARLDFPAEWPDLF 134

>TPHA0C01390 Chr3 (314359..317730) [3372 bp, 1123 aa] {ON} Anc_7.201
           YIL026C
          Length = 1123

 Score = 33.9 bits (76), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 25/111 (22%), Positives = 51/111 (45%), Gaps = 11/111 (9%)

Query: 237 TQNKTISETLQLMAGAKIYQGLTLLKNEFSKKIVAPDMYHQFRTIVMRDLENASQIYMQM 296
           T N+TISE   +    KI++   L+     ++     +Y  F   + + ++ A+ + +  
Sbjct: 191 TANETISELQMMFQQQKIHEAFLLVSKNNKRRSKYKPLYQNFVEFMSKLIQIANDMQLLF 250

Query: 297 VENSSQDQLDAINEYAVNILEFLSSLCDVRFTEEELQTVLRCLSRLC--CL 345
            E+   D     N++ +++L +LSSL   +         +RCL ++   CL
Sbjct: 251 TESEDSDSEIGPNQFVIDLLTWLSSLSVSK---------IRCLRQIATSCL 292

>Skud_16.155 Chr16 (284989..288087) [3099 bp, 1032 aa] {ON} YPL125W
           (REAL)
          Length = 1032

 Score = 33.9 bits (76), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 48/104 (46%), Gaps = 11/104 (10%)

Query: 55  RQFALLTLRKLVTMYWTPGFESFRGTSTVKLEARGMIRDVLLQLCLDEHQPSKIRNGASY 114
           R  A++  +  V  YW     S R  +  K E +  IR  L ++  +++    I+N    
Sbjct: 62  RWLAVIQFKNGVDKYW----RSTRINAISKDE-KASIRGRLFEMIDEQNNQLCIQNAQ-- 114

Query: 115 AVVQISAVDFPDQWPELL----NIVYNAIMKSHSLAAMKLLNEI 154
           A  +I+ +DFP +WP L     N++ N +++  S     +L  I
Sbjct: 115 AAARIARLDFPVEWPNLFEDLENLLNNEVIRKDSTKIYNILMHI 158

>Kwal_26.8595 s26 complement(855035..858139) [3105 bp, 1034 aa] {ON}
           YPL125W (KAP120) - karyopherin [contig 67] FULL
          Length = 1034

 Score = 33.9 bits (76), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 40/77 (51%), Gaps = 5/77 (6%)

Query: 60  LTLRKLVTMYWTPGFESF-RGT--STVKLEARGMIRDVLLQLCLDEHQPSKIRNGASYAV 116
           L +R L  + +  G E F R T  + ++ E +  IR  L  L  +++    I+N  S A 
Sbjct: 61  LNVRWLAIIQFKNGVEKFWRSTRVNAIRKEEKVSIRTRLFDLIDEKNNQLCIQN--SQAT 118

Query: 117 VQISAVDFPDQWPELLN 133
            +I+ +DFP +WP L +
Sbjct: 119 ARIARLDFPGEWPGLFD 135

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.134    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 91,621,949
Number of extensions: 3615615
Number of successful extensions: 13077
Number of sequences better than 10.0: 62
Number of HSP's gapped: 13323
Number of HSP's successfully gapped: 81
Length of query: 1009
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 889
Effective length of database: 39,721,479
Effective search space: 35312394831
Effective search space used: 35312394831
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)