Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D17908gna 1ON51851824390.0
TDEL0A08030singletonON51451219440.0
Kwal_23.4026singletonON53447513371e-180
KLLA0E16281gna 1ON6054999301e-118
TPHA0M00130singletonON6115069251e-117
Smik_6.473na 1ON6065039181e-116
CAGL0A01199gna 1ON6135019171e-116
YPL265W (DIP5)na 1ON6085039151e-116
Skud_16.12na 1ON6075009081e-115
KAFR0B06430singletonON5935029041e-114
NCAS0D02260na 1ON5974989041e-114
Kpol_358.3na 1ON5754998981e-114
SAKL0G14916gna 1ON5814988911e-113
Suva_16.40na 1ON6064968901e-112
Kwal_33.15545na 1ON5765148871e-112
Ecym_2480na 1ON5865038851e-112
KNAG0L02460singletonON5885008801e-111
TBLA0A07060na 1ON6254898691e-109
NDAI0I02660na 1ON5944988561e-107
KNAG0L02470singletonON6384978581e-107
KLTH0B01166gna 1ON5774878461e-106
KAFR0D039401.83ON5975008371e-104
Ecym_10871.83ON5704828351e-104
ACL135Wna 1ON5885028341e-104
Ecym_10881.84ON5674898321e-104
SAKL0C02662g1.83ON5485168271e-103
SAKL0C02640gsingletonON5484808251e-103
Kwal_33.134111.84ON5604828241e-103
KLTH0F02420g1.84ON6214778251e-102
SAKL0C02684gsingletonON5884768181e-102
KNAG0F004801.84ON5974898181e-102
KLTH0F02398g1.83ON5554968061e-100
SAKL0C02728g1.84ON5624768061e-100
Kpol_2000.641.84ON6104938091e-100
NDAI0F041901.84ON5994758071e-100
CAGL0J08162g1.84ON5974808022e-99
TDEL0C061701.84ON5734897975e-99
ZYRO0F16632g1.84ON6074977996e-99
TBLA0A054601.84ON6084977953e-98
NCAS0A006101.84ON6074967928e-98
AFR667C1.84ON5634847881e-97
TPHA0B044701.84ON5994937831e-96
Skud_5.261.83ON5904767831e-96
Smik_14.681.84ON6114907823e-96
AFR668W1.83ON5564787774e-96
YNL268W (LYP1)1.84ON6114937806e-96
Skud_14.711.84ON6124937762e-95
Kwal_33.134011.83ON5594807696e-95
Smik_5.241.83ON5904767709e-95
Ecym_80357.44ON5634807671e-94
Suva_5.41.83ON5904767682e-94
KLLA0C02365g1.84ON5794817662e-94
NDAI0A006101.83ON5654937626e-94
YEL063C (CAN1)1.83ON5904767639e-94
KNAG0C05920singletonON5994577604e-93
NDAI0F042001.83ON5664937565e-93
Suva_14.751.84ON6114937562e-92
NCAS0B085701.83ON5324937451e-91
ZYRO0F16654g1.83ON5804987472e-91
KNAG0C007901.83ON5794807472e-91
KAFR0D007001.83ON5745017453e-91
TPHA0B044801.83ON6034927464e-91
NCAS0A006001.83ON5444967354e-90
Kpol_2000.651.83ON5954747386e-90
TBLA0A054501.83ON6064777387e-90
KLLA0C02343g1.83ON5814927351e-89
TDEL0C061801.83ON5834917314e-89
Skud_14.701.83ON5734937236e-88
AFR156W7.44ON5584807216e-88
SAKL0F09790gsingletonON5584987217e-88
CAGL0J08184g1.83ON5724927227e-88
Smik_14.671.83ON5734937183e-87
Smik_6.482na 2ON5584817164e-87
TDEL0E05750singletonON5484817042e-85
TPHA0H028507.44ON6014817064e-85
TDEL0H040707.44ON5775057001e-84
YOR348C (PUT4)7.44ON6274786944e-83
YNL270C (ALP1)1.83ON5735136904e-83
Suva_14.731.83ON4974616836e-83
Kwal_26.69407.44ON5704786817e-82
Smik_15.5327.44ON6314786867e-82
KNAG0E003907.44ON5994816821e-81
Skud_15.5157.44ON6265016831e-81
SAKL0B10956g7.44ON5725046756e-81
Suva_8.4027.44ON6834786828e-81
KLTH0D01474g7.44ON6244766725e-80
CAGL0E05632g7.44ON5984806681e-79
Skud_2.2603.397ON5985026645e-79
Suva_13.517singletonON5474926597e-79
KLLA0F23419g7.44ON5735306601e-78
KLLA0B14685gna 3ON5714926591e-78
Skud_16.2na 2ON4964186504e-78
YBR132C (AGP2)3.397ON5964986541e-77
ZYRO0C18502g7.44ON5755036512e-77
Kpol_526.103.397ON5804996495e-77
Kpol_367.77.44ON5844856488e-77
TDEL0D00200singletonON5674876461e-76
SAKL0F16544gsingletonON5674946433e-76
KLTH0A00308gsingletonON5414816404e-76
Smik_2.2723.397ON5974986436e-76
Suva_11.2731.244ON6014086411e-75
TPHA0B010901.244ON6064086402e-75
KNAG0C02140singletonON5984956383e-75
Suva_4.3813.397ON5904876374e-75
Kwal_27.126811.244ON5934086356e-75
TDEL0C00930singletonON5954096357e-75
Kwal_23.2817na 3ON5805036331e-74
TDEL0C053403.397ON5754996312e-74
KLTH0F04048gsingletonON5834986303e-74
AFR230C1.244ON6044076314e-74
AAR038W3.397ON5665046284e-74
Smik_11.3021.244ON5534086267e-74
KLTH0B00154gna 4ON5564946267e-74
Skud_11.2751.244ON6024086297e-74
ZYRO0D03762g1.244ON6004086288e-74
SAKL0B08734g3.397ON5584906241e-73
Ecym_47895.158ON5884096252e-73
NDAI0E038007.44ON6214836254e-73
YKR039W (GAP1)1.244ON6024086234e-73
Kwal_8.590na 4ON6294936212e-72
KAFR0C051607.44ON5845176182e-72
CAGL0L03267g1.244ON5974126183e-72
TBLA0C025203.397ON5805046155e-72
SAKL0G14014g5.158ON6054126157e-72
SAKL0D04664g1.244ON5935006147e-72
TPHA0A024503.397ON5835006148e-72
TBLA0C01240singletonON6294786151e-71
KLTH0E15642g1.244ON5964186112e-71
KLLA0A06886gsingletonON5874106085e-71
ZYRO0C17182g3.397ON5784896076e-71
KLTH0B02046g5.158ON5894126042e-70
Ecym_34303.397ON5594916013e-70
Ecym_60211.244ON6004946025e-70
Kwal_33.154075.158ON5874115991e-69
KLLA0C15873g3.397ON5685045953e-69
KAFR0E018505.158ON5604115943e-69
NCAS0I008503.397ON5845015954e-69
CAGL0C00539g3.397ON5935095931e-68
NCAS0E022607.44ON5934835931e-68
Suva_2.716singletonON6034085931e-68
KAFR0D00510na 5ON6174975932e-68
TBLA0B077605.158ON6584095952e-68
NCAS0B079001.244ON6194085922e-68
TPHA0A002405.158ON6034815903e-68
KAFR0D005001.50ON6174235897e-68
NDAI0B052201.244ON6114085852e-67
Suva_7.4855.158ON6034125824e-67
Kwal_33.14276na 6ON5964095816e-67
KAFR0K013603.397ON5825055798e-67
Suva_3.1891.50ON6335235811e-66
CAGL0B03773g5.158ON6054125791e-66
AGR319W5.158ON6264125783e-66
Smik_3.531.50ON6334975783e-66
NDAI0G060301.368ON5994205754e-66
Skud_7.5255.158ON6034125754e-66
NCAS0A004201.50ON6795155795e-66
Smik_16.1155.158ON6034125755e-66
YGR191W (HIP1)5.158ON6034125746e-66
AEL030W1.368ON5824075728e-66
NCAS0A089201.368ON5994805739e-66
YCL025C (AGP1)1.50ON6334975741e-65
SAKL0D00836gna 6ON6014095721e-65
Smik_4.7901.50ON6634255761e-65
SAKL0C01232gsingletonON6134865721e-65
Skud_3.381.50ON6334975731e-65
KAFR0D04120na 7ON6484245742e-65
CAGL0K05753g1.50ON6604175732e-65
NDAI0D021605.158ON5874115693e-65
Suva_2.6881.50ON6614225724e-65
KAFR0D00520na 7ON5984255684e-65
CAGL0B01012g1.50ON6234975695e-65
KLTH0H13398g1.368ON5874105675e-65
Skud_4.7841.50ON6634255707e-65
TBLA0F032403.397ON5854985667e-65
YDR508C (GNP1)1.50ON6634255708e-65
NDAI0A006401.50ON6414935698e-65
KNAG0G009005.158ON6134095661e-64
Kpol_543.791.244ON6054085651e-64
NCAS0D018705.158ON5954745642e-64
KLLA0A11770g5.158ON5814125632e-64
NDAI0F043901.50ON6674885655e-64
TPHA0A047005.158ON5694105596e-64
KLTH0F01606gna 7ON6044765608e-64
TDEL0C065101.50ON6424925619e-64
NCAS0A071105.158ON5924125581e-63
Sklu_YGOB_Anc_1.3681.368ON5414075542e-63
CAGL0D02178g1.368ON5775015543e-63
NCAS0J00140na 8ON5585105533e-63
Kwal_34.16254singletonOFF4814105474e-63
Kwal_YGOB_34.162541.368ON4914105475e-63
KNAG0B012703.397ON5925065528e-63
NDAI0C029505.158ON6094115521e-62
KLLA0A10813g1.368ON5844105492e-62
Kpol_543.78singletonON6054095467e-62
Kpol_1010.325.158ON5994095458e-62
Kwal_23.38473.397ON5794815449e-62
NDAI0A081903.397ON5865005449e-62
YOL020W (TAT2)1.368ON5924805441e-61
KLTH0F11286g3.397ON5824695422e-61
KAFR0D041401.50ON6375105443e-61
KLLA0A06930g1.244ON5874105395e-61
Kwal_33.13215na 7ON5984825396e-61
Kpol_2000.921.50ON6374095409e-61
SAKL0C01650g1.50ON6134865372e-60
KNAG0H011503.284ON6174115353e-60
TBLA0C012101.368ON6004775343e-60
Skud_15.1381.368ON5924835334e-60
Ecym_27161.368ON5924075334e-60
Kpol_534.221.368ON5924835325e-60
TPHA0E036601.50ON6474975348e-60
Ecym_26643.285ON5754975291e-59
KNAG0L00110na 8ON5714825281e-59
NCAS0A106803.284ON5934095292e-59
Smik_15.1461.368ON5934805282e-59
KLLA0C01606g1.50ON6204145292e-59
AFR698C1.50ON6095005274e-59
KLTH0C05170g3.284ON5984285265e-59
NCAS0B085801.50ON6274955275e-59
KAFR0D04130na 5ON6444975252e-58
Suva_15.1481.368ON5924235222e-58
TDEL0F02830na 9ON5614955193e-58
SAKL0D02948gna 10ON5944405203e-58
TPHA0B047501.50ON6394925223e-58
CAGL0M00154gsingletonON5504835174e-58
Ecym_10561.50ON6064855204e-58
TBLA0A051801.50ON6764105225e-58
KAFR0F02250singletonON5544915157e-58
Suva_4.3073.284ON6094135179e-58
KNAG0C005901.50ON6344955191e-57
KNAG0F002701.50ON6344135181e-57
TBLA0A05190na 7ON6674145182e-57
Suva_2.2033.284ON6044745143e-57
NDAI0A056203.284ON5714095097e-57
NCAS0I015303.284ON5954085108e-57
TPHA0A025001.368ON5904845108e-57
KAFR0A011203.284ON5924205091e-56
Kwal_27.105383.284ON6024385091e-56
TPHA0M012003.284ON6074085091e-56
Ecym_26623.284ON5894095082e-56
ZYRO0G12342g3.284ON6204145083e-56
TBLA0I020103.285ON6284115083e-56
YDR046C (BAP3)3.284ON6044115056e-56
ZYRO0F17446g1.50ON6334975066e-56
KLTH0F01584g1.50ON5964155047e-56
YBR068C (BAP2)3.284ON6094135031e-55
AGR039Cna 10ON5864125011e-55
Kpol_2002.441.50ON6274965022e-55
Smik_4.2843.284ON6044114984e-55
NDAI0A074903.284ON5964124968e-55
SAKL0D02970g3.284ON6014134969e-55
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D17908g
         (518 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   944   0.0  
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            753   0.0  
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   519   e-180
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   362   e-118
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     360   e-117
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   358   e-116
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   357   e-116
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   357   e-116
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   354   e-115
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   352   e-114
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              352   e-114
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   350   e-114
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   347   e-113
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   347   e-112
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   346   e-112
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   345   e-112
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             343   e-111
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   339   e-109
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   334   e-107
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             335   e-107
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   330   e-106
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   327   e-104
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   326   e-104
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   325   e-104
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   325   e-104
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   323   e-103
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   322   e-103
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   322   e-103
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   322   e-102
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   319   e-102
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                319   e-102
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   315   e-100
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   315   e-100
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   316   e-100
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   315   e-100
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   313   2e-99
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   311   5e-99
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   312   6e-99
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   310   3e-98
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              309   8e-98
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   308   1e-97
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   306   1e-96
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   306   1e-96
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   305   3e-96
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   303   4e-96
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   305   6e-96
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   303   2e-95
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   300   6e-95
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   301   9e-95
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   300   1e-94
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   300   2e-94
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   299   2e-94
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   298   6e-94
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   298   9e-94
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            297   4e-93
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            295   5e-93
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   295   2e-92
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            291   1e-91
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   292   2e-91
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              292   2e-91
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   291   3e-91
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   291   4e-91
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   287   4e-90
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   288   6e-90
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   288   7e-90
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   287   1e-89
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   286   4e-89
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   283   6e-88
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   282   6e-88
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   282   7e-88
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   282   7e-88
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   281   3e-87
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   280   4e-87
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            275   2e-85
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   276   4e-85
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   274   1e-84
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   271   4e-83
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   270   4e-83
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   267   6e-83
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   266   7e-82
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   268   7e-82
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   267   1e-81
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   267   1e-81
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   264   6e-81
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   267   8e-81
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   263   5e-80
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   261   1e-79
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   260   5e-79
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   258   7e-79
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   258   1e-78
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   258   1e-78
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   254   4e-78
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   256   1e-77
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   255   2e-77
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   254   5e-77
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   254   8e-77
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                253   1e-76
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   252   3e-76
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   251   4e-76
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   252   6e-76
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   251   1e-75
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   251   2e-75
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   250   3e-75
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   249   4e-75
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   249   6e-75
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   249   7e-75
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   248   1e-74
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   247   2e-74
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   247   3e-74
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   247   4e-74
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   246   4e-74
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   245   7e-74
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   245   7e-74
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   246   7e-74
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   246   8e-74
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   244   1e-73
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   245   2e-73
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     245   4e-73
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   244   4e-73
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   243   2e-72
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   242   2e-72
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   242   3e-72
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   241   5e-72
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   241   7e-72
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   241   7e-72
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   241   8e-72
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   241   1e-71
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   239   2e-71
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   238   5e-71
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   238   6e-71
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   237   2e-70
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   236   3e-70
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   236   5e-70
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   235   1e-69
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   233   3e-69
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   233   3e-69
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   233   4e-69
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   233   1e-68
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     233   1e-68
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   233   1e-68
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      233   2e-68
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   233   2e-68
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   232   2e-68
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   231   3e-68
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      231   7e-68
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   229   2e-67
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   228   4e-67
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   228   6e-67
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   227   8e-67
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   228   1e-66
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   227   1e-66
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   227   3e-66
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   227   3e-66
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   226   4e-66
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   226   4e-66
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   227   5e-66
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   226   5e-66
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   225   6e-66
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   224   8e-66
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   225   9e-66
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   225   1e-65
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   224   1e-65
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   226   1e-65
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   224   1e-65
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   225   1e-65
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   225   2e-65
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   225   2e-65
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    223   3e-65
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   224   4e-65
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   223   4e-65
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   223   5e-65
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   223   5e-65
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   224   7e-65
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   222   7e-65
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   224   8e-65
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   223   8e-65
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   222   1e-64
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   222   1e-64
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   221   2e-64
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   221   2e-64
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   222   5e-64
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   219   6e-64
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   220   8e-64
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   220   9e-64
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   219   1e-63
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   218   2e-63
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   218   3e-63
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      217   3e-63
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   215   4e-63
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   215   5e-63
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   217   8e-63
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    217   1e-62
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   216   2e-62
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   214   7e-62
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   214   8e-62
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   214   9e-62
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   214   9e-62
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   214   1e-61
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   213   2e-61
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              214   3e-61
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   212   5e-61
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   212   6e-61
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   212   9e-61
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   211   2e-60
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              210   3e-60
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   210   3e-60
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   209   4e-60
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   209   4e-60
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   209   5e-60
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   210   8e-60
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   208   1e-59
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   207   1e-59
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   208   2e-59
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   207   2e-59
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   208   2e-59
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   207   4e-59
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   207   5e-59
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   207   5e-59
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              206   2e-58
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   205   2e-58
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   204   3e-58
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   204   3e-58
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   205   3e-58
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   203   4e-58
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   204   4e-58
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   205   5e-58
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              202   7e-58
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   203   9e-58
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   204   1e-57
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   204   1e-57
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   204   2e-57
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   202   3e-57
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            200   7e-57
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              201   8e-57
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   201   8e-57
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   200   1e-56
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   200   1e-56
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   200   1e-56
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   200   2e-56
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   200   3e-56
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   200   3e-56
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   199   6e-56
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   199   6e-56
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   198   7e-56
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   198   1e-55
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   197   1e-55
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   197   2e-55
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   196   4e-55
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   195   8e-55
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   195   9e-55
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   195   1e-54
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   198   1e-54
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   194   2e-54
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   194   2e-54
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   193   2e-54
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              193   2e-54
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   194   3e-54
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   192   4e-54
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   193   5e-54
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   192   8e-54
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   192   1e-53
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   191   2e-53
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   192   2e-53
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   194   3e-53
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                191   3e-53
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   190   4e-53
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   190   5e-53
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   189   6e-53
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   190   7e-53
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   190   1e-52
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   189   2e-52
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   188   2e-52
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   189   2e-52
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   187   2e-52
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   188   4e-52
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              189   4e-52
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   187   6e-52
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   190   8e-52
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   186   9e-52
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   186   2e-51
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    185   2e-51
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   186   2e-51
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   186   3e-51
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   184   4e-51
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   188   5e-51
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   183   1e-50
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   184   1e-50
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    184   1e-50
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   183   1e-50
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   184   2e-50
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              183   3e-50
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   186   4e-50
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   182   1e-49
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   182   5e-49
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      178   8e-49
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   178   1e-48
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   181   2e-48
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   176   4e-48
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                176   7e-48
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   176   7e-48
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   175   3e-47
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   174   5e-47
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   176   6e-47
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   176   1e-46
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   172   1e-46
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   172   2e-46
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   172   2e-45
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              169   2e-45
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   172   2e-45
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   172   3e-45
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   168   3e-45
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                168   6e-45
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   167   1e-44
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   167   2e-44
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   169   2e-44
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   166   2e-43
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   166   2e-43
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   166   2e-43
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   163   3e-43
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   162   6e-43
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   162   1e-42
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      162   1e-42
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   161   1e-42
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   159   2e-42
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   158   2e-41
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   159   8e-41
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   158   1e-40
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   156   1e-40
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   155   1e-39
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   153   1e-39
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   151   4e-39
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   151   3e-38
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     144   7e-38
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     143   7e-38
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   147   2e-37
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              142   8e-36
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   127   9e-31
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)          97   2e-21
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...    93   1e-20
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          83   1e-17
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      83   6e-17
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     82   3e-16
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      75   7e-16
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          65   1e-11
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    65   1e-11
Skud_12.5 Chr12 (6025..6258,6262..6279,6283..6312,6359..6424,642...    43   0.001
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    41   0.004
ZYRO0B08030g Chr2 complement(626820..628556) [1737 bp, 578 aa] {...    36   0.19 
TPHA0B01060 Chr2 complement(241062..242822) [1761 bp, 586 aa] {O...    35   0.40 
NCAS0J01180 Chr10 (204451..206208) [1758 bp, 585 aa] {ON} Anc_4....    34   0.91 
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    34   0.99 
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    33   1.6  
TDEL0E01790 Chr5 (343205..344911) [1707 bp, 568 aa] {ON} Anc_4.1...    33   1.6  
TBLA0D02060 Chr4 complement(519297..521225) [1929 bp, 642 aa] {O...    32   5.4  
AEL125C Chr5 complement(387763..389490) [1728 bp, 575 aa] {ON} S...    32   5.8  
Smik_6.139 Chr6 (225355..227079) [1725 bp, 574 aa] {ON} YGR055W ...    31   7.5  
CAGL0B02838g Chr2 complement(274984..276693) [1710 bp, 569 aa] {...    31   7.6  
KAFR0A06250 Chr1 complement(1262105..1263832) [1728 bp, 575 aa] ...    31   7.8  
TPHA0A04960 Chr1 (1115122..1121355) [6234 bp, 2077 aa] {ON} Anc_...    31   8.3  

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  944 bits (2439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/518 (92%), Positives = 478/518 (92%)

Query: 1   MLEKKGTVVLERPASGXXXXXXXXXXXKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGS 60
           MLEKKGTVVLERPASG           KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGS
Sbjct: 1   MLEKKGTVVLERPASGEDECESEEIDEKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGS 60

Query: 61  ALAKGGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWN 120
           ALAKGGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWN
Sbjct: 61  ALAKGGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWN 120

Query: 121 YFLKYAIVLSANLTAFGLVIGYWRPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTV 180
           YFLKYAIVLSANLTAFGLVIGYWRPD                 NFLAVKYFGEIEALLTV
Sbjct: 121 YFLKYAIVLSANLTAFGLVIGYWRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTV 180

Query: 181 FKLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGALPYLVGGGTGKFLGWWACVVQSI 240
           FKLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGALPYLVGGGTGKFLGWWACVVQSI
Sbjct: 181 FKLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGALPYLVGGGTGKFLGWWACVVQSI 240

Query: 241 FGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAH 300
           FGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAH
Sbjct: 241 FGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAH 300

Query: 301 STDANASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKI 360
           STDANASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKI
Sbjct: 301 STDANASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKI 360

Query: 361 FLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYIN 420
           FLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYIN
Sbjct: 361 FLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYIN 420

Query: 421 YDRAIKAKGISIDDIPFRMWFQPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIG 480
           YDRAIKAKGISIDDIPFRMWFQPYAAY            NGYNAFIIKFHYKTFITSYIG
Sbjct: 421 YDRAIKAKGISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFIIKFHYKTFITSYIG 480

Query: 481 VFANILMVIGYKLYFKTKFVKPSEISFRTRNEHEGEEA 518
           VFANILMVIGYKLYFKTKFVKPSEISFRTRNEHEGEEA
Sbjct: 481 VFANILMVIGYKLYFKTKFVKPSEISFRTRNEHEGEEA 518

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/512 (72%), Positives = 422/512 (82%), Gaps = 1/512 (0%)

Query: 1   MLEKKGTVVLERPA-SGXXXXXXXXXXXKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSG 59
           M E K TV +  P  S                LSREL P VVSLLTLGSAVGTGLIIGSG
Sbjct: 1   MFEIKNTVTVVEPTLSDSASSRDEGGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSG 60

Query: 60  SALAKGGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGW 119
           +ALA+GGPIS+F+AYLFTGS+L VVIFSLSEMA+F PMD+GFSGYL +YVDPAFGFAAGW
Sbjct: 61  TALARGGPISIFLAYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGW 120

Query: 120 NYFLKYAIVLSANLTAFGLVIGYWRPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLT 179
           NYFLKYAIVLSANLTAFGLVIGYWRPD                 NFLAV+YFG++EA +T
Sbjct: 121 NYFLKYAIVLSANLTAFGLVIGYWRPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMT 180

Query: 180 VFKLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGALPYLVGGGTGKFLGWWACVVQS 239
           V KL +L++++I CL+ITCGG P+HTT GFRYWRESG LPYLV G TGKFLGWWACV+QS
Sbjct: 181 VAKLTILLLIFIVCLVITCGGGPDHTTIGFRYWRESGFLPYLVKGNTGKFLGWWACVIQS 240

Query: 240 IFGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHA 299
           IFGFMGSEMIGI+YGETANP+KTIPK+S NV  RI   Y+FGVF+LGLA+SP N+KLVHA
Sbjct: 241 IFGFMGSEMIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHA 300

Query: 300 HSTDANASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPK 359
           HSTDANASPFVIAIS+SGIKVLP+FVNA LLVFI SSA TDIYICSRQLYGLAKDGAAPK
Sbjct: 301 HSTDANASPFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPK 360

Query: 360 IFLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYI 419
           IFL +N+ K+P+VGCV GSLLGFLAYMNTKKSAATVF YITSTVSVFGILNWFYIL+AYI
Sbjct: 361 IFLRLNKHKIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYI 420

Query: 420 NYDRAIKAKGISIDDIPFRMWFQPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYI 479
           +YDR +K+ G+ +D+IPFRM FQPYAAY            NGY+AFI+KF+YK FITSYI
Sbjct: 421 HYDRVVKSHGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFILKFNYKLFITSYI 480

Query: 480 GVFANILMVIGYKLYFKTKFVKPSEISFRTRN 511
           G+FAN+L+V+GYKLY+KTK+VKP EI+F  + 
Sbjct: 481 GIFANVLLVLGYKLYYKTKWVKPEEITFEKKQ 512

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  519 bits (1337), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 250/475 (52%), Positives = 330/475 (69%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L R  K R V +L +  A+GTGL+IG+G+AL +GGP SL IA++FTGSLL  V+ SL+E
Sbjct: 45  TLQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAE 104

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           MASFAPMDK FSGY  RYVDPA GFA GWNYFLKYAI L++ L+A GL++ YWR D    
Sbjct: 105 MASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALASELSAIGLLVQYWREDLSIA 164

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        NF+ +K++GE+E    + K LVL+I ++T L++TCGG P+  T GFR
Sbjct: 165 IFIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGFR 224

Query: 211 YWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNV 270
           YWRE   +PYLV G TG+FLGWWACV+QS + ++GSE IG+V+GE  NPKKTIP ++ NV
Sbjct: 225 YWREYAFVPYLVKGTTGRFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATRNV 284

Query: 271 FFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAALL 330
            FRI   Y+ GV ILGL ISP +  L +A ++DA+ SPFVIA +++GIK LP+F+NA L+
Sbjct: 285 IFRITGFYIVGVLILGLIISPHDKTLANAKTSDASGSPFVIAFTNAGIKGLPSFINAMLI 344

Query: 331 VFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKK 390
           +FI S+ANT +Y+CSR  YGLAKDG APKIFL  NR+ VP  GC+   L+  L++MN   
Sbjct: 345 MFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISN 404

Query: 391 SAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAYXXX 450
           S++ +F Y+TS+V+VFG LNW  +LI+YI Y+RA     +  D IPFRMWFQPY+AY   
Sbjct: 405 SSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCL 464

Query: 451 XXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSEI 505
                    NGY+AFI  F YK+FI SYIG+   I   + +K + K+   +P ++
Sbjct: 465 FFVSLIIFFNGYSAFIAGFKYKSFIVSYIGIAVFIGNTLFWKFWKKSAATRPEDL 519

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  362 bits (930), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 201/499 (40%), Positives = 298/499 (59%), Gaps = 14/499 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + L+ R VS++ +G ++GTGL+IG+GS+LA  GP ++ IAY F G L+  V+  L E
Sbjct: 78  RLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFVMSCLGE 137

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RPDXX 148
           MA++ P+D GF+ Y  RY DPA GFA G+ Y  KY I++   LTA  LVI YW  R    
Sbjct: 138 MAAYIPLD-GFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVN 196

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          NFL V++FGEIE  ++  K+ V++ + I  L++ CGG PNH   G
Sbjct: 197 PGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGPNHEVLG 256

Query: 209 FRYWRESGALPYL---VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           F+YW+  GA       + G  G+F+ + +  V ++F ++G+E+ GIV  E  NP+K +PK
Sbjct: 257 FKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPK 316

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHS--TDANASPFVIAISSSGIKVLPN 323
           +     +RI   Y+  +F+LG+ +   +  L+ A S  T A+ASPFV+AI ++GI VLP+
Sbjct: 317 AIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAGIPVLPH 376

Query: 324 FVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFL 383
            +NA +L+F+ S+AN+D+Y+ SR LYGLA D  AP+IF   N+  VP    + G L   L
Sbjct: 377 IMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALL 436

Query: 384 AYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQP 443
           AYMN    ++ VF+Y  + VS+FG+L+W  ILI YI +D+A + +GI    + ++   QP
Sbjct: 437 AYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQP 496

Query: 444 YAAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKP 502
           Y A+              + AF+   F YK+FIT YIG+   I+  IGYKL++KTK + P
Sbjct: 497 YGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYKTKII-P 555

Query: 503 SE----ISFRTRNEHEGEE 517
           SE    +SF+   + E EE
Sbjct: 556 SEEVDLVSFKEAVDLEEEE 574

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  360 bits (925), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 207/506 (40%), Positives = 297/506 (58%), Gaps = 24/506 (4%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L ++LK R +S++ +G ++GTGL+IG+G+AL   GP S+ IAY F G+L+   + +L E
Sbjct: 81  RLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLVFFTMAALGE 140

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RPDXX 148
           MA++ P+D GF+ Y +RY DPA GFA G++Y  KY I+    LTA  LVI YW  R    
Sbjct: 141 MAAYIPLD-GFTSYASRYCDPALGFAVGYSYLFKYFIITPNQLTAAALVIQYWVDRDTVN 199

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          N + VKYFGE E  L+ FK++V++ V I   +I  GG PNH   G
Sbjct: 200 PGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLGGGPNHDRLG 259

Query: 209 FRYWRESGAL-PYL-----VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKT 262
           FRYW+  GA  PY      + G TGKF+ +    V ++F ++G E+ GIV  E  NP++ 
Sbjct: 260 FRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVAAEAENPRRN 319

Query: 263 IPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANA--SPFVIAISSSGIKV 320
           IP++     +RI F YV  +F+LG+ ++  +  L+ A +   +A  SPFV+AI +SG+ V
Sbjct: 320 IPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVVAIQNSGVDV 379

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVP---VVGCVTG 377
           LP+  N  +L+F+ S+ N+D+Y+ +R LY LA DG APKIF   NR+ VP   + GCV  
Sbjct: 380 LPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPYNAMGGCV-- 437

Query: 378 SLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
            L   LAYMN    +A +F+Y  + VS+FG+L+W  ILI +I +DRA++A+GI      +
Sbjct: 438 -LFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGIDRSTFAY 496

Query: 438 RMWFQPYAAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFK 496
              FQPY +Y              ++ F+  +F YKTFIT YIG+       IGYKLY+K
Sbjct: 497 VAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIGYKLYYK 556

Query: 497 TKFVKPSEISFRT------RNEHEGE 516
           TK VKP E    +      R E EG+
Sbjct: 557 TKTVKPHEADLNSYKAAVDREEEEGK 582

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  358 bits (918), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 209/503 (41%), Positives = 292/503 (58%), Gaps = 15/503 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +N  L +ELK R +S++ +G ++GTGL+IG+G+AL  GGP+++ IAY F G L+   +  
Sbjct: 76  ENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFFTMAC 135

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RP 145
           L EMAS+ P+D GF+ Y +RYVDPA GFA G+ Y  KY I+    LTA  LVI YW  R 
Sbjct: 136 LGEMASYIPLD-GFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 194

Query: 146 DXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHT 205
                             N + VK+FGE E  L+ FK++V++ + +   II  GG P+H 
Sbjct: 195 RVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHD 254

Query: 206 TTGFRYWRESGALPYL---VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKT 262
             GFRYWR+ GA       + G TGKF  + A  V S+F + G E+ GIV  E  NP+K+
Sbjct: 255 RLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 314

Query: 263 IPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLV--HAHSTDANASPFVIAISSSGIKV 320
           +PK+     +RI   Y+  VF+LG+ ++  + +L+     S  A ASPFV+AI +SGIKV
Sbjct: 315 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIKV 374

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LP+  NA +LVF+ S+ N+D+Y+ SR LY LA DG APKIF   +++ VP    +   L 
Sbjct: 375 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYNALILSVLF 434

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMW 440
             LAYMN    +A +F+Y  + VS+FGIL+W  ILI YI +D+A +A+GI      +   
Sbjct: 435 CCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 494

Query: 441 FQPYAAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKTKF 499
            Q Y AY              +  F+  KF YKTFIT YIG+   IL   GYKL +KTK 
Sbjct: 495 GQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSWAGYKLIYKTKV 554

Query: 500 VKPSEISFRT------RNEHEGE 516
           +K +++   T      R E EG 
Sbjct: 555 IKSTDVDLYTFKEIYDREEEEGR 577

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  357 bits (917), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 198/501 (39%), Positives = 294/501 (58%), Gaps = 12/501 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           ++  L ++LK R +S++ +G ++GTGL+IG+G++L   GP+S+FIAY F G L+   + +
Sbjct: 82  EHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYAFVGVLVFFTMAA 141

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RP 145
           L EMAS+ P+D GF+ Y +RY DPA GFA G+ Y  KY I+    LTA  LVI YW  R 
Sbjct: 142 LGEMASYIPLD-GFTSYASRYCDPALGFAVGYAYLCKYLILPPNQLTAAALVIQYWLDRE 200

Query: 146 DXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHT 205
                             NF+ VK+FGE E  L+ FK++V++ + I   +I  GG P H 
Sbjct: 201 QVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILLFVIMLGGGPTHD 260

Query: 206 TTGFRYWRESGAL-PYL--VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKT 262
             GFR++   GA  PY   + G  GKF+ + A +V ++F ++G E+ GIV  E ANP+K+
Sbjct: 261 RLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGIELTGIVAAEAANPRKS 320

Query: 263 IPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHS--TDANASPFVIAISSSGIKV 320
           IPK+     +RI   Y+  +F+LG+ ++  +  L  A +  T A ASP+V+AI +SGIK 
Sbjct: 321 IPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAASPYVVAIINSGIKA 380

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LP+  NA +L+F+ S+ N+D+Y+ SR LYGLA D  APKIF + NR+ VP    +  S  
Sbjct: 381 LPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWGVPYYSLLMSSCF 440

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMW 440
             LAYM+    +A +F+Y  + VS+FG+L+W  ILI Y+ + RA+KA+ +      +R  
Sbjct: 441 CLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQNVDRSRFAYRAP 500

Query: 441 FQPYAAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKTKF 499
           FQPY +Y              +  F+   F YK FIT YIG+   ++   GYK   KTK 
Sbjct: 501 FQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYIGIPVFVISYFGYKFVKKTKI 560

Query: 500 VKPSEI---SFRTRNEHEGEE 517
            KP E+   +F+   + E E+
Sbjct: 561 WKPEEVDLYTFKAAIDEEEEQ 581

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  357 bits (915), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 208/503 (41%), Positives = 293/503 (58%), Gaps = 15/503 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +N  L ++LK R +S++ +G ++GTGL+IG+G+AL  GGP+++ IAY F G L+   +  
Sbjct: 78  ENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAFVGLLVFYTMAC 137

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RP 145
           L EMAS+ P+D GF+ Y +RYVDPA GFA G+ Y  KY I+    LTA  LVI YW  R 
Sbjct: 138 LGEMASYIPLD-GFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWISRD 196

Query: 146 DXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHT 205
                             N + VK+FGE E  L+ FK++V++ + +   II  GG PNH 
Sbjct: 197 RVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPNHD 256

Query: 206 TTGFRYWRESGALPYL---VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKT 262
             GFRYWR+ GA       + GG GKF+ + A  V S+F + G E+ GIV  E  NP+K+
Sbjct: 257 RLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGIVCSEAENPRKS 316

Query: 263 IPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLV--HAHSTDANASPFVIAISSSGIKV 320
           +PK+     +RI   Y+  VF+LG+ ++  + +L+     S  A ASPFV+AI +SGI+V
Sbjct: 317 VPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPFVVAIQNSGIEV 376

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LP+  NA +LVF+ S+ N+D+Y+ SR LY LA DG APKIF   +R+ VP    +   L 
Sbjct: 377 LPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGVPYNALILSVLF 436

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMW 440
             LAYMN    +A +F+Y  + VS+FGIL+W  ILI YI +D+A +A+GI      +   
Sbjct: 437 CGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAP 496

Query: 441 FQPYAAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKTKF 499
            Q Y AY              +  F+  KF YKTFIT YIG+   I+   GYKL +KTK 
Sbjct: 497 GQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISWAGYKLIYKTKV 556

Query: 500 VKPSEISFRT------RNEHEGE 516
           +K +++   T      R E EG 
Sbjct: 557 IKSTDVDLYTFKEIYDREEEEGR 579

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  354 bits (908), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 206/500 (41%), Positives = 293/500 (58%), Gaps = 15/500 (3%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L ++LK R +S++ +G ++GTGL+IG+G+AL  GGP+++ IAY F G L+   +  L E
Sbjct: 80  RLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAFVGLLVFFTMACLGE 139

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RPDXX 148
           MAS+ P+D GF+ Y +RYVDPA GFA G+ Y  KY I+    LTA  LVI YW  R    
Sbjct: 140 MASYIPLD-GFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVN 198

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          N + VK+FGE E  L+ FK+LV++ + +   II  GG P+H   G
Sbjct: 199 PGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLFIIMLGGGPDHDRLG 258

Query: 209 FRYWRESGALPYL---VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           FRYWR+ GA       +GGG GKF+ + A  V S+F + G E+ GIV  E  NP+K++PK
Sbjct: 259 FRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGIVCSEAQNPRKSVPK 318

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLV--HAHSTDANASPFVIAISSSGIKVLPN 323
           +     +RI   Y+  VF+LG+ ++  + +L+     +  A ASPFV+AI +SGIKVLP+
Sbjct: 319 AIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPFVVAIQNSGIKVLPH 378

Query: 324 FVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFL 383
             NA +LVF+ S+ N+D+Y+ SR LY LA DG APKIF   N++ VP    +   L   L
Sbjct: 379 IFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGVPYNALIFSVLFCCL 438

Query: 384 AYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQP 443
           AYMN    +A +F+Y  + VS+FGIL+W  ILI YI +D+A +A+GI      +    Q 
Sbjct: 439 AYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQGIDKSKFAYVAPGQR 498

Query: 444 YAAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKP 502
           Y AY              +  F+  KF YKTFIT YIG+   +   +GYKL +KTK +K 
Sbjct: 499 YGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVYVFSWVGYKLIYKTKVIKS 558

Query: 503 SEISFRT------RNEHEGE 516
           +++   T      R E +G+
Sbjct: 559 TDVDLYTFKEIYDREEEQGK 578

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  352 bits (904), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 197/502 (39%), Positives = 289/502 (57%), Gaps = 18/502 (3%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L + LK R VS++ +G ++GTGL+IG+G++LA  GP SLFI Y F G L+   +  L EM
Sbjct: 64  LKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTMSCLGEM 123

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RPDXXX 149
           A+F P+D GF+ Y +RYVDPA GFA G++Y  KY I+ +  LTA  +V+ YW  R     
Sbjct: 124 AAFIPLD-GFTSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVDRDTLNP 182

Query: 150 XXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGF 209
                         N   VK FGE E  L+ FK+LV++ + +   II  GG PNH   GF
Sbjct: 183 GVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNHDRLGF 242

Query: 210 RYWRESGAL-PYLVGGG-----TGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTI 263
           RYWR+ G+  PY          TGKF+ + +C V ++F ++G E+ GIV  E  NP+K I
Sbjct: 243 RYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQNPRKNI 302

Query: 264 PKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHA--HSTDANASPFVIAISSSGIKVL 321
           PK+     +RI   YV  + +L + ++  +  L+ A   ST A ASPFV+AI +SGI +L
Sbjct: 303 PKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIENSGINIL 362

Query: 322 PNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLG 381
           P+  N  +L F++S+AN+D+Y+ SR LY LA D  APK F   N++ +P       +   
Sbjct: 363 PHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAFSTAFS 422

Query: 382 FLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWF 441
            LAYMN   SA+ VF+Y  + VS+FG+++W  IL+ YI++D+A KA+G+   +  +   +
Sbjct: 423 CLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFTYVAPW 482

Query: 442 QPYAAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV 500
           QPY AY              +  F+  +F YK FIT YIG+    +  +GYK+ +KTK  
Sbjct: 483 QPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKIVYKTKTH 542

Query: 501 KPSEISFRT------RNEHEGE 516
           +P E+   T      + E +G+
Sbjct: 543 RPEEVDLVTLKALIDQEEEDGK 564

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  352 bits (904), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/498 (40%), Positives = 289/498 (58%), Gaps = 12/498 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + L+ RVVS++ +G ++GTGL+IG+G++LA  GP+S+ IAY F G L+   + SL E
Sbjct: 70  RLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFTMASLGE 129

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RPDXX 148
           MAS+ P+D GF+ Y  RY DPA GFA G+ Y  KY I+    LTA  LVI YW  R    
Sbjct: 130 MASYIPLD-GFTSYATRYADPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWIPREKVN 188

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          N L V++FGE E  L+ FK+LV+  + I   I+  GG PNH   G
Sbjct: 189 PGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILLFILMLGGGPNHDRLG 248

Query: 209 FRYWRESGALPYL---VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           FR+W+  GA       + G TGKF+ + +  V + F ++G+E++GIV GE  NP+K++PK
Sbjct: 249 FRHWKHPGAFNNYSPAITGDTGKFVAFVSVFVYATFAYLGTELVGIVVGEARNPRKSVPK 308

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAH--STDANASPFVIAISSSGIKVLPN 323
           +     +RI   Y+  + +LG+ +   +  L+ A   ST A ASPFV+AI +SGIKVLP+
Sbjct: 309 AIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGIKVLPH 368

Query: 324 FVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFL 383
             NA +LVF+ S+ N+D+Y+ SR LY LA D  APKIF   NR+ +P        L   L
Sbjct: 369 IFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSVLFCLL 428

Query: 384 AYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQP 443
           AYM+    +A +F+Y  + VS+FG+L+W  IL+ Y+ +DRA++A+GI      +    Q 
Sbjct: 429 AYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYVAPGQR 488

Query: 444 YAAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKP 502
           Y AY              +  F+  +F YKTFIT YIG+    +   GYKL +KTK + P
Sbjct: 489 YGAYFALFFCSLIALIKNFTVFLGHQFDYKTFITGYIGIPVFFISYFGYKLIYKTKIIDP 548

Query: 503 SEI---SFRTRNEHEGEE 517
            E+   +F+   + E E+
Sbjct: 549 LEVDLYTFKAAIDQEEED 566

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  350 bits (898), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 200/499 (40%), Positives = 287/499 (57%), Gaps = 14/499 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L +ELK R +S++ +G ++GTGL+IG+G+AL  GGP S+ IAY F G L+  V+  L E
Sbjct: 49  RLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILVFFVMACLGE 108

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RPDXX 148
           MA++ P+D GF+ Y  RY DPA GFA G+ Y  KY I+    LTA  LVI YW  R    
Sbjct: 109 MATYIPLD-GFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVN 167

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          N + V+YFGE E  L+ FK++V+  V +   II  GG PNH   G
Sbjct: 168 PGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLG 227

Query: 209 FRYWRESGAL-PYL--VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           FRYW+  GA  PY   + G  GKF+ + A  V ++F ++G E+ GIV  E  NP++ IP+
Sbjct: 228 FRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPR 287

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANAS--PFVIAISSSGIKVLPN 323
           +     +RI   Y+  +F+LG+ ++  + +L+ A     +A+  PFV+AI +SG++ LP+
Sbjct: 288 AIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQNSGVRALPH 347

Query: 324 FVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFL 383
             N  +L+F+ S+ N+D+Y+ +R LY LA DG APK+F   NR+ VP        L   L
Sbjct: 348 IFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGCFLFCLL 407

Query: 384 AYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQP 443
           AYMN    +A +F+Y  + VS+FGIL+W  ILI YI + RA  A+ +  +   +R  FQP
Sbjct: 408 AYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQP 467

Query: 444 YAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPS 503
           Y AY              +  FI +F YK+FIT YIG+   ++   GYK+ +KTK VK  
Sbjct: 468 YGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAE 527

Query: 504 EI---SFR---TRNEHEGE 516
           E    SF+    R E EG+
Sbjct: 528 EADLYSFKEAIDREEAEGK 546

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  347 bits (891), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 195/498 (39%), Positives = 293/498 (58%), Gaps = 12/498 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L +EL+ R VS++ +G ++GTGL+IG+G++L+  GP+S+ IAY F G L+ +V+  L E
Sbjct: 54  RLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGE 113

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RPDXX 148
           MA++ P+D GF+ Y +RY DPA GFA G++Y  KY I+    LTA  LV+ YW  R    
Sbjct: 114 MATYIPLD-GFTSYASRYCDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVN 172

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          N + VK+FGE E  L+ FK+LV++ + +   +I  GG P+H   G
Sbjct: 173 PGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLG 232

Query: 209 FRYWRESGAL-PY--LVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           FR++++ GA  PY   + G  GKF+ + A  V ++F ++G+E+ GIV  E  NP++ +P+
Sbjct: 233 FRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAH--STDANASPFVIAISSSGIKVLPN 323
           +     +RI   Y+  +F+LG+ ++  +  L+ A   ST A ASPFV+AI ++GI VLP+
Sbjct: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPH 352

Query: 324 FVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFL 383
             NA +L+F+ S+ N+D+Y+ SR LYGLA D  APKIF   N++ VP    +   L   L
Sbjct: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412

Query: 384 AYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQP 443
           AYMN    +A VF+Y  + VS+FG+++W  ILI YI +DRA++A+G+    + +      
Sbjct: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472

Query: 444 YAAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKP 502
             AY              +  F+  KF YK FIT YIG+   I+   GYK    TKFVKP
Sbjct: 473 KGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKP 532

Query: 503 SEI---SFRTRNEHEGEE 517
            E    +F+   + E EE
Sbjct: 533 EEADLYTFKELIDLEEEE 550

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  347 bits (890), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/496 (40%), Positives = 289/496 (58%), Gaps = 10/496 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L ++LK R +S++ +G ++GTGL+IG+G+AL  GGP+S+ IAY F G L+   +  L E
Sbjct: 79  RLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGFVGLLVFFTMACLGE 138

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RPDXX 148
           MAS+ P+D GF+ Y +RYVDPA GFA G+ Y  KY I+    LTA  LVI YW  R    
Sbjct: 139 MASYIPLD-GFTSYASRYVDPALGFAIGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVN 197

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          N + V++FGE E  L+ FK++V++ + +   II  GG P+H   G
Sbjct: 198 PGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLFIIMLGGGPDHDRLG 257

Query: 209 FRYWRESGALPYL---VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           FRYWR+ GA       + G  GKF+ + +  V S+F + G E+ GIV  E  NP+K++PK
Sbjct: 258 FRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGIVCSEAKNPRKSVPK 317

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLV--HAHSTDANASPFVIAISSSGIKVLPN 323
           +     +RI   Y+  VF+LG+ ++  + +L+     +  A ASPFV+AI +SGIKVLP+
Sbjct: 318 AIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPFVVAIQNSGIKVLPH 377

Query: 324 FVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFL 383
             N  +LVF+ S+ N+D+Y+ SR LY LA DG APKIF   +++ VP    +   L   L
Sbjct: 378 IFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGVPYYALMVSVLFCCL 437

Query: 384 AYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQP 443
           AYMN    +A +F+Y  + VS+FGIL+W  ILI YI +DRA +A+G+      +    Q 
Sbjct: 438 AYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQGVDKSKFAYVAPGQR 497

Query: 444 YAAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKP 502
           Y AY              +  F+   F YKTFIT YIG+   +   +GYKL +KTK VKP
Sbjct: 498 YGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYIGLPIYVFSWVGYKLIYKTKVVKP 557

Query: 503 SEISFRTRNE-HEGEE 517
           ++    T  E ++ EE
Sbjct: 558 ADADLYTLKEIYDREE 573

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  346 bits (887), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 195/514 (37%), Positives = 297/514 (57%), Gaps = 9/514 (1%)

Query: 4   KKGTVVLERPASGXXXXXXXXXXXKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALA 63
           ++G V LE                +   L +EL+ R VS++ +G ++GTGL+IG+GS+LA
Sbjct: 22  EEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLA 81

Query: 64  KGGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFL 123
             GP+S+ I+Y F G L+  V+  L EMA+F P+D GF+ Y +RYVDPA GFA G++Y  
Sbjct: 82  SAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPLD-GFTSYASRYVDPAVGFAVGYSYLF 140

Query: 124 KYAIVLSANLTAFGLVIGYW--RPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVF 181
           KY IV    LTA  +V+ +W  R                   N + V++FGE E  L+  
Sbjct: 141 KYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSV 200

Query: 182 KLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGAL-PY--LVGGGTGKFLGWWACVVQ 238
           K+LV++ + +   II  GG PNH  TGFR+WR+ GA  PY   + G  GKF+ + +    
Sbjct: 201 KVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPYSEAISGSKGKFVSFASVFAL 260

Query: 239 SIFGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVH 298
           ++F + G+E+ GIV  E  NP++++P++     +RI   YV  + +LG+ ++  + +L+ 
Sbjct: 261 ALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLK 320

Query: 299 AH--STDANASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGA 356
           A   +T A ASPFV+AI ++ I VLP+  N  +LVF+ S+ N+D+Y+ SR LYGLA DG 
Sbjct: 321 AKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGK 380

Query: 357 APKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILI 416
           AP+IF   N++ VP        L   LAYMN    +A VF+Y  + VS+FG+L+W  ILI
Sbjct: 381 APRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILI 440

Query: 417 AYINYDRAIKAKGISIDDIPFRMWFQPYAAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFI 475
            YI +D+AI+ +      + +   FQP++ Y              Y  F+  KF YKTFI
Sbjct: 441 TYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFI 500

Query: 476 TSYIGVFANILMVIGYKLYFKTKFVKPSEISFRT 509
           + YIG+   ++  +GYK+ ++TK +KP ++   T
Sbjct: 501 SGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYT 534

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  345 bits (885), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 196/503 (38%), Positives = 295/503 (58%), Gaps = 14/503 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K   L ++L+ R VS++ +G ++GTGL+IG+GSAL++ GPI++ IAY   G ++  V+  
Sbjct: 54  KGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFTVMSC 113

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RP 145
           L EMA++ P+D GF+ Y  RY DPA GFA G+ Y  KY ++    LTA  LV+ YW  R 
Sbjct: 114 LGEMAAYIPLD-GFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWVGRG 172

Query: 146 DXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHT 205
                             N + VK+FGE E  L+ FK+LV++ V    L++  GG P+H 
Sbjct: 173 KVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGPSHN 232

Query: 206 TTGFRYWRESGAL-PYL----VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPK 260
             GFRYW++ G   PY     + GG GKF+ + +  V ++F ++G+E+ GIV  E  NP+
Sbjct: 233 RLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECKNPR 292

Query: 261 KTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHS--TDANASPFVIAISSSGI 318
           + +P++     +RI   Y+  VF+LGL+++  +  L+      T A ASP+V+AI ++GI
Sbjct: 293 RNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKNAGI 352

Query: 319 KVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGS 378
            VLP+  NA +L F+ S+ N+D+Y+ SR LYGLA D  APKIF   N + VP       +
Sbjct: 353 PVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLALCT 412

Query: 379 LLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
           L   LAYMN   SA T+FSY  +  S+FG+L+W  ILI YI++DRA + +GI  + + ++
Sbjct: 413 LFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTLSYQ 472

Query: 439 MWFQPYAAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKT 497
             FQP  A+              +  F+   F YKTFIT YIG+   IL  + YK+  KT
Sbjct: 473 APFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIVHKT 532

Query: 498 KFVKPSEI---SFRTRNEHEGEE 517
           K++K + +   +++T  + E EE
Sbjct: 533 KWIKSANVDLFTYKTAIDLEEEE 555

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  343 bits (880), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 198/500 (39%), Positives = 284/500 (56%), Gaps = 12/500 (2%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           +  L ++LK R VS++ +G ++GTGL+IG+G++LA  GP+S+ I+Y F G L+  V+  +
Sbjct: 59  DQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYSFVGVLVFFVMSCI 118

Query: 89  SEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RPD 146
            EMA++ P+D GF+ Y +RY DPA GFA G+ Y +KY I+    LTA  LVI YW  R  
Sbjct: 119 GEMAAYIPLD-GFTSYASRYCDPALGFAVGYAYLVKYFILPPNQLTAAALVIQYWIPREK 177

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N   VK+FGE E  L+ FK++V++ + I   II  GG P H  
Sbjct: 178 VNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILMFIIMLGGTPTHDR 237

Query: 207 TGFRYWRESGALPYL---VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTI 263
            GFRYW+  GA       + G  G+F+ + +C V  +F ++G E+ GIV  E  NP+K I
Sbjct: 238 LGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTGIVAAEAENPRKNI 297

Query: 264 PKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAH--STDANASPFVIAISSSGIKVL 321
           PK+     +RI   Y+  +F+LG+ +S  +  L+ A   ST A ASPFV+AI +SGI+ L
Sbjct: 298 PKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASPFVVAIVNSGIEAL 357

Query: 322 PNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLG 381
           P+  NA +L+F+ S+ N+D+Y+ SR LY LA D  APKIF   NRF +P        L  
Sbjct: 358 PHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFGIPYNSLGVAVLFC 417

Query: 382 FLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWF 441
            LAYM+    +A +F+Y  + VS+ G+L W  ILI YI +DRA++A+GI      +    
Sbjct: 418 LLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQGIDKSTFAYVAPL 477

Query: 442 QPYAAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV 500
           QPY AY              +  F+  KF Y+ FIT YIG+    +   GYK   KTK  
Sbjct: 478 QPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYIGLPLFFICYFGYKFVKKTKIR 537

Query: 501 KPSEI---SFRTRNEHEGEE 517
           KP E+   SF+   + E E+
Sbjct: 538 KPEEVDLFSFKAAIDQEEED 557

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  339 bits (869), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 193/489 (39%), Positives = 279/489 (57%), Gaps = 9/489 (1%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L + L+ R VS++ +G ++GTGL+IG+G++L+  GP S+FIAY F G L+   + ++ EM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RPDXXX 149
           AS+ PMD GF+ Y +RYVDPA GFA G+ Y  KY I+    LTA  LVI YW  R     
Sbjct: 159 ASYIPMD-GFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217

Query: 150 XXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGF 209
                         N   VK+FGE E  L+ FK+LV++ + +   I+  GG P+H   GF
Sbjct: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGF 277

Query: 210 RYWRESGAL-PY--LVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
           RYW+  GA  PY   + G  GKF+ + +  V ++F ++G E+ GIV  E  NP+K++P++
Sbjct: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHS--TDANASPFVIAISSSGIKVLPNF 324
                +RI   Y+  +F+LG+ ++  + +L+ A    T A ASPFV+AI +SGI+VLP+ 
Sbjct: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHI 397

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L+F+ S+ N+D+Y+ SR LY LA DG AP IF     + +P        L   LA
Sbjct: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           YMN    +A VF+Y  + VS+FG+L+W  I I YI + RA+K +G+      +   FQPY
Sbjct: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517

Query: 445 AAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPS 503
             Y              +  F+   F YK FIT YIG+   ++   GYK   KTK VK  
Sbjct: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSH 577

Query: 504 EISFRTRNE 512
           E+   T  E
Sbjct: 578 EVDLFTGKE 586

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  334 bits (856), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 192/498 (38%), Positives = 284/498 (57%), Gaps = 12/498 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + LK R VS++ +G ++GTGL+IG+G++LA  GP+S  IAY F G L+   +  L E
Sbjct: 67  RLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFTMACLGE 126

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RPDXX 148
           MA++ P+D GF+ Y +RY DPA GFA G+ Y  KY I+    LTA  LVI YW  +    
Sbjct: 127 MATYIPLD-GFTSYASRYCDPALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVN 185

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          N   V++FGE E  L+ FK+LV++ + +   I+  GG P+H   G
Sbjct: 186 PGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGPDHDRLG 245

Query: 209 FRYWRESGALPY---LVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           FRYWR  G+       + G TG+F+ + +  V + + ++G E+ GIV  E  NP+K+IPK
Sbjct: 246 FRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPK 305

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAH--STDANASPFVIAISSSGIKVLPN 323
           +     +RI   Y+  +F+LG+ ++  +  L+ A   ST A ASPFV+AI +SGI  LP+
Sbjct: 306 AIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASPFVVAIINSGINALPH 365

Query: 324 FVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFL 383
            +NA +LVF+ S+ N+D+Y+ SR LY LA D  APKIF   NR+ +P        L   L
Sbjct: 366 IINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLL 425

Query: 384 AYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQP 443
           AYM    ++A +F+Y  + VS+FGIL+W  ILI YI +DRA++A+G+      +   FQP
Sbjct: 426 AYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQP 485

Query: 444 YAAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKP 502
           Y A+              +  F+  +F YK FIT YIG+        GYK  +KTK + P
Sbjct: 486 YGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDP 545

Query: 503 SEI---SFRTRNEHEGEE 517
            ++   +F+   + E E+
Sbjct: 546 LKVDLYTFKAAIDQEEED 563

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  335 bits (858), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/497 (37%), Positives = 274/497 (55%), Gaps = 12/497 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L ++LK R +S++ +G ++GTGL+I +G +L   GP+S  IAY F G ++   +  L E
Sbjct: 64  RLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTMACLGE 123

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           MA+F P+D GF+ Y +RY DPA GFA G+ Y +KY I+    LTA  +V+ YW P     
Sbjct: 124 MATFIPLD-GFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWVPRDTVN 182

Query: 151 --XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          N   V++FGE E  L+  K+L+++ + I   +I  GGA +H   G
Sbjct: 183 PGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAGSHDRLG 242

Query: 209 FRYWRESGALPYL---VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           FRYW+  GA       + G  GKF+ + A +V  +F ++G E+ GIV  E +NP++++PK
Sbjct: 243 FRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNPRRSVPK 302

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFV 325
           +    F+RI   YV  +F+LG+ +   + KLV  +     ASPF IAI ++GI VLP+  
Sbjct: 303 AIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAILNAGITVLPDIF 362

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           N  LL+F+ S+AN+D+Y+ SR LY LA D  APKIF   NR+ +P        L   LAY
Sbjct: 363 NGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLFCLLAY 422

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYA 445
           M    S+A VF Y  + VS+ G+L W  ILI YI +DRA++A+ +      +   FQPY 
Sbjct: 423 MTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYVAPFQPYG 482

Query: 446 AYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKP--- 502
           AY              +  F+  F YKTFIT YIG+   +L   GYK+  K++       
Sbjct: 483 AYVSLFFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCYFGYKITCKSEIRSARYV 542

Query: 503 ---SEISFRTRNEHEGE 516
              S+ S   R + E E
Sbjct: 543 DLVSQKSLVDREQVEYE 559

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  330 bits (846), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/487 (38%), Positives = 281/487 (57%), Gaps = 9/487 (1%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + L+ R VS++ +G ++GTGL+IG+GS+LA  GP S+ I+Y F G L+  V+  L E
Sbjct: 50  RLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVMACLGE 109

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--RPDXX 148
           MA+F P+D GF+ Y +RYVDPA GFA G+ Y  KY IV    LTA  +V+ YW  R    
Sbjct: 110 MAAFIPLD-GFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVSREKVN 168

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          N + V++FGE E  L+  K+LV++ + +   II  GG PNH  TG
Sbjct: 169 PGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTG 228

Query: 209 FRYWRESGAL-PY--LVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           FRYWR+ GA  PY   + G  GKF+ + +    ++F + G+E+ GIV  E  NP++++P+
Sbjct: 229 FRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPR 288

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAH--STDANASPFVIAISSSGIKVLPN 323
           +     +RI   YV  + +LG+ ++  +  L+ A   ST A ASPFV+AI ++GI VLP+
Sbjct: 289 AIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAGIPVLPH 348

Query: 324 FVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFL 383
             NA +L+F+ S+ N+D+Y+ SR LYGLA D  APKIF   N + VP        L   L
Sbjct: 349 IFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVSVLFCLL 408

Query: 384 AYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQP 443
           AYMN    +A +F+Y  + VS+FG+L+W  ILI Y+ + +A+ A+        +   FQP
Sbjct: 409 AYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSYTAPFQP 468

Query: 444 YAAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKP 502
           ++ +              Y  F+   F YKTFI+ YIG+    +  +GYKL  ++K +KP
Sbjct: 469 WSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHRSKLIKP 528

Query: 503 SEISFRT 509
            ++   T
Sbjct: 529 EDVDLYT 535

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  327 bits (837), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 173/500 (34%), Positives = 275/500 (55%), Gaps = 10/500 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           ++  + RELK R + ++ LG  +GTGL +G  + LA  GP+   IAY+F GS++  V  +
Sbjct: 80  EDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYIFMGSIVYFVTQA 139

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+    + +  R++ PAFG A G+ Y+  +AI  +  ++  G VI YW    
Sbjct: 140 LGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIQYWTDAV 199

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  VK +GE+E  +   K++ +V   +  LII CGG+      
Sbjct: 200 PLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALIIVCGGSKKQGPI 259

Query: 208 GFRYWRESGAL---------PYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETAN 258
           GFRYWR  GA          P       G+FLGW A ++ + F + G+E++GI  GE AN
Sbjct: 260 GFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGTELVGITAGEAAN 319

Query: 259 PKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGI 318
           P+KT+P++   V FRI   Y+  +F +GL +   +S+L    +T   +SPFVI+I ++G 
Sbjct: 320 PRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRL-SDDTTVIASSPFVISIENAGT 378

Query: 319 KVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGS 378
           K+LP+  NA ++V ++S+AN+++Y+ SR LY LA    APKIF  V R  VP +G +  S
Sbjct: 379 KILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQGVPFMGVICTS 438

Query: 379 LLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
           LLG LA++    +A T F+++    ++ G+  W +I +A++ + + +K +GIS DD+PF+
Sbjct: 439 LLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQRGISRDDLPFK 498

Query: 439 MWFQPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTK 498
             F P+ +Y             G+ AF   F   TF T YI +    ++ IG +LY++ +
Sbjct: 499 AKFMPWGSYYAAFWVFVIIFVQGFQAFSPHFDVTTFFTDYISLILLAVVFIGAQLYYRCR 558

Query: 499 FVKPSEISFRTRNEHEGEEA 518
           F+   E      +  E E+A
Sbjct: 559 FLWKLEDVDIDSDRREIEDA 578

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  326 bits (835), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 170/482 (35%), Positives = 275/482 (57%), Gaps = 8/482 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            + ++ R+LKPR +S+++LG  +GTGL +G  S +   GP+   +AYLF G++   V  S
Sbjct: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   F+ Y  R++ PA G A G+ Y+  + +  +  L+  G +I YW    
Sbjct: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N + V+++GEIE  +   K+L +    I  L++ CGG+ +    
Sbjct: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGS-SEGAL 236

Query: 208 GFRYWRESGALPYLVG-----GGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKT 262
           GFRYW+  G  P+ +G         +FLGW + ++++ F + G+E++GI  GE+ NP+KT
Sbjct: 237 GFRYWKNPG--PWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKT 294

Query: 263 IPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLP 322
           +PK+   VFFRI F Y+  +F +GL +   + +L     +D N SPFV+AI +SG KVLP
Sbjct: 295 VPKAINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLP 354

Query: 323 NFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGF 382
           +  N  +LV I+S+ N++IYI SR LYGL+K G AP +F   N+  VP    +T S+ G 
Sbjct: 355 SVFNGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGC 414

Query: 383 LAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQ 442
           LAY+N  ++A  VF ++ +  +V G   W  I +++I + + +K +GIS +D+PF+  F 
Sbjct: 415 LAYLNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFM 474

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKP 502
           P+ AY             G+++F  +F +  FI  YI VF  I+  +G+++ FKT+ +  
Sbjct: 475 PWGAYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILR 534

Query: 503 SE 504
            E
Sbjct: 535 KE 536

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  325 bits (834), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 190/502 (37%), Positives = 287/502 (57%), Gaps = 15/502 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L ++L+ R VS++ +G ++GTGL+IG+GS+L + GP S+ IAY   G ++  V+  L E
Sbjct: 58  RLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILIAYSIMGWVVFTVMSCLGE 117

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           MA++ P+D GF+ Y  RY DPA GFA GW Y  KY ++    LTA  LVI +W P     
Sbjct: 118 MAAYIPLD-GFTSYATRYADPALGFAVGWAYLFKYLVLTPNQLTAGALVIQFWIPAARVS 176

Query: 151 --XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          N + V++FGE E  L+ FK+LV++ V I  L++  GG P H   G
Sbjct: 177 PGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVMILLLVLALGGGPTHDRLG 236

Query: 209 FRYWRESGALPYL------VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKT 262
           FRYW + GA          + GG GKF+ + +  V ++F ++G+E+ GIV  E  +P++ 
Sbjct: 237 FRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYLGTELCGIVAAECKDPRRN 296

Query: 263 IPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANAS--PFVIAISSSGIKV 320
           +P++     +RI   Y+  +F+LG+ ++  +  L+ A S + +A+  P+V+AI ++ I V
Sbjct: 297 VPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEVSAAASPYVVAIENAVIPV 356

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LPN  NA +L F+ S+ N+D+Y+ SR LYGLA DG APK+F   N++ VP       +L 
Sbjct: 357 LPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFARTNKWGVPYNALACCTLF 416

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMW 440
             LAYM+  KSA T F Y  +  S+FG+++W  ILI YI +DRA +A+GI    + +   
Sbjct: 417 CCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFDRAFRAQGIPKSTLSYVAP 476

Query: 441 FQPYAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYFKTKF 499
            QPYA +              ++AFI K     TFIT YIG+   I   IGYK+  KTK+
Sbjct: 477 CQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYIGLPIYIFCFIGYKIVHKTKW 536

Query: 500 VKPSEI---SFRTRNEHEGEEA 518
           +   E+   +F+   + E EE 
Sbjct: 537 IPSKEVDLFTFKEAIDLEEEEC 558

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  325 bits (832), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 172/489 (35%), Positives = 278/489 (56%), Gaps = 9/489 (1%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            + R LK R +S++ LG  +GTGL I   S L   GP+   IAY+F G+++  +  SL E
Sbjct: 59  EVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYSITQSLGE 118

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           MA+F P+    + +  R++ PAFG A G+ Y+  +AI  +  L+  G +I YW       
Sbjct: 119 MATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIINYWTSVVPLG 178

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        NF  V+++GEIE  +   K++ +V   I   I+ CGG+ +    GFR
Sbjct: 179 AWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGS-SQGPIGFR 237

Query: 211 YWRESGALPYLVG-----GGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
            WR  G  P+  G         +FLGW + ++++ F + G+E++GI  GE+ NP+KT+PK
Sbjct: 238 NWRNPG--PWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPK 295

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFV 325
           +   VFFRI F Y+  +F +GL +   + ++ +   TD NASPFVI+I ++G K+LP+  
Sbjct: 296 AINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPFVISIRNAGTKILPDIF 355

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +LV ++S+AN+++YI SR +Y LA+ G APK F  VNR  VPV+G +  +L+G +A+
Sbjct: 356 NAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTALMGLMAF 415

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYA 445
           +    +A   F+++ +  ++ G+  W +I +A+I + + +K +GIS D +PF+  F P+A
Sbjct: 416 LVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFKAKFMPWA 475

Query: 446 AYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV-KPSE 504
           AY             GY AF  KF    F T+YI +   +++ IG ++Y+K +F+ K  +
Sbjct: 476 AYYAASFVFVIIFIQGYTAFSPKFDVTQFFTAYISLMLMLVVFIGCQIYYKCRFLWKLED 535

Query: 505 ISFRTRNEH 513
           I   T    
Sbjct: 536 IDIDTNRRE 544

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  323 bits (827), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 179/516 (34%), Positives = 279/516 (54%), Gaps = 7/516 (1%)

Query: 3   EKKGTVVLERPA-SGXXXXXXXXXXXKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSA 61
           EK G+ ++ +P+ +            K   + R LKPR +S++ LG  +GTGL I   + 
Sbjct: 12  EKDGSHLIIKPSIAEDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTP 71

Query: 62  LAKGGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNY 121
           L+  GP+   IAY+F G+L   V  SL EMA+F P+   F+ +  R++ PA G A G+ Y
Sbjct: 72  LSNAGPVGALIAYMFIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLY 131

Query: 122 FLKYAIVLSANLTAFGLVIGYWRPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVF 181
           +L +AI  +  L+  G +I +W                    N   VKY+GE+E  +   
Sbjct: 132 WLSWAITFALELSVVGQIIQFWTDAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACI 191

Query: 182 KLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQ 238
           K+L +V   I   I+ CG A      GFRYWR  G   P ++      G+FLGW + ++ 
Sbjct: 192 KVLAIVGFIIYAFIMVCG-AGKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLIS 250

Query: 239 SIFGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVH 298
           + F + G+E++GI  GE ANP+KT+P++   VFFRI F Y+  +  +GL + P N   + 
Sbjct: 251 AAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLV-PFNDPKLK 309

Query: 299 AHSTDANASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAP 358
           +  +  ++SPFVIAI +SG KVLP+  NA +L  IIS+ N+++Y+ SR  Y +A +G AP
Sbjct: 310 SEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAP 369

Query: 359 KIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAY 418
           K      +  +P    +T S+LGFLAY+ +   A+ VF+++ +  +V G   W  I I++
Sbjct: 370 KYLTWTTKSGIPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISH 429

Query: 419 INYDRAIKAKGISIDDIPFRMWFQPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSY 478
           I + +A+K +GIS DD+PF+  F P+ AY             G+ AF  KF    F T+Y
Sbjct: 430 IRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFKVSDFFTAY 489

Query: 479 IGVFANILMVIGYKLYFKTK-FVKPSEISFRTRNEH 513
           I V    +  IG++++F+   F+K  +I   T    
Sbjct: 490 ISVMLFFVFWIGFQIWFRGPLFIKTEDIDLDTDRRE 525

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  322 bits (825), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 174/480 (36%), Positives = 266/480 (55%), Gaps = 5/480 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K   + R LKPR +S++ LG  +GTGL I   + L+  GP+   IAY+F G+L  +V  S
Sbjct: 38  KETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMVSQS 97

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   F  +  R++ PA G A G+ YFL ++I  +  L+  G VI +W    
Sbjct: 98  LGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWTDAV 157

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VK++GE+E  +   K+L +V   I   I+ CG A      
Sbjct: 158 PLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 216

Query: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  G   P ++      G+FLGW + ++ + F + G+E++GI  GE ANP+KT+P
Sbjct: 217 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKTVP 276

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   VFFRI F Y+  +  +GL + P N   + +  +  ++SPFVIAI +SG KVLP+ 
Sbjct: 277 RAINKVFFRILFFYILSLLFIGLLV-PFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHI 335

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L  IIS+ N+D+YI SR LY +  +G APK      +  +P    +T SL+GFLA
Sbjct: 336 FNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLA 395

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           Y+ +   A+ VF ++ +  +V G   W  I +A+I + +A+K +GIS DD+PF+  F P+
Sbjct: 396 YLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMPW 455

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSE 504
            AY             G+ AF  KF+   F T+Y+ V     + IG++++F+    K +E
Sbjct: 456 GAYYAAFFIGVIIIIQGFTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKTE 515

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  322 bits (824), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 175/482 (36%), Positives = 273/482 (56%), Gaps = 9/482 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           + G + R LKPR VS++ LG  +GTGL +G  S L+  GP+   IAY+F GS++  V  S
Sbjct: 50  QEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVYFVTQS 109

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           + EMA+F P+    + + NR++ PAFG A G+ Y+  +AI  +  ++  G VI YW    
Sbjct: 110 MGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAV 169

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  V+++GE+E  +   K++ +V   +  LII CGG+      
Sbjct: 170 PLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGS-KQGPI 228

Query: 208 GFRYWRESGALPY---LVGGGT--GKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKT 262
           GFRYWR  G  P+   ++ G    G+FLGW A ++ + F + G+E++GI  GE ANP+KT
Sbjct: 229 GFRYWRNPG--PWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPRKT 286

Query: 263 IPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLP 322
           +PK+   VFFRI F Y+  +F +GL + P N   +  H++   +SPFVI+I S+G ++LP
Sbjct: 287 VPKAINKVFFRILFFYILSLFFVGLLV-PYNHPGLDKHTSVIASSPFVISIQSAGTRILP 345

Query: 323 NFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGF 382
           +  NA +LV IIS+AN+++Y+ SR L+ LA  G APK F  V    VP +G +  +LLG 
Sbjct: 346 DIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLGL 405

Query: 383 LAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQ 442
           LA++    +A   F+++ +  ++ G+  W +I I++I + + +K +GIS DD+PF+    
Sbjct: 406 LAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLM 465

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKP 502
           PY AY             G+ AF  KF    F T YI +    ++    +LY++ +F   
Sbjct: 466 PYGAYYAAFWVAVIIFVQGFQAFCPKFKVAEFFTGYISLILLAVVFCLAQLYYRCRFFNR 525

Query: 503 SE 504
            E
Sbjct: 526 LE 527

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  322 bits (825), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 172/477 (36%), Positives = 271/477 (56%), Gaps = 9/477 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           + G + R LKPR VS++ LG  +GTGL +G  S L+  GP+   IAY+F G+++  V  S
Sbjct: 111 QEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSGPVGALIAYIFMGTVVYFVTQS 170

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           + EMA+F P+    + + +R++ PAFG A G+ Y+  +AI  +  L+  G VI YW    
Sbjct: 171 MGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWAITFAVELSVTGQVIEYWTEAV 230

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  V+++GE+E  +   K+L +V   I  L+I CGG+      
Sbjct: 231 PRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAIVGYLIYALVIVCGGS-KQGPI 289

Query: 208 GFRYWRESGALPYLVG-----GGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKT 262
           GFRYWR  G  P+  G        G+FLGW A ++ + F + G+E++GI  GE ANP++T
Sbjct: 290 GFRYWRNPG--PWGAGIISKDKDEGRFLGWVASLINASFTYQGTELVGITAGEAANPRRT 347

Query: 263 IPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLP 322
           +P++   VFFRI F Y+  +F +GL + P N   +   +T   +SPFVI+I ++G + LP
Sbjct: 348 VPRAINKVFFRILFFYILSLFFVGLLV-PYNHSSLDKTTTVIASSPFVISIQNAGTRALP 406

Query: 323 NFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGF 382
           +  NA +LV IIS+AN+++Y+ SR L+ LA  G APK+F  V    VP +G +  SLLG 
Sbjct: 407 DIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVTPQGVPFMGVIVTSLLGL 466

Query: 383 LAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQ 442
           LA++    +A   F+++ +  ++ G+  W +I I++I + + +K +GIS DD+PF+    
Sbjct: 467 LAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKLM 526

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKF 499
           PY AY             G+ AF   F    F TSYI +   +++  G +L+++ +F
Sbjct: 527 PYGAYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLMLLVVVFCGAQLFYRCRF 583

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  319 bits (818), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 169/476 (35%), Positives = 268/476 (56%), Gaps = 5/476 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           ++  + R LKPR +S++ LG  +GTGL IG  S LA  GP+   IAY+F G++   V  S
Sbjct: 78  QDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQS 137

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   F+ +  R++ PAFG A G+ Y+  + I  +  L+  G +I +W    
Sbjct: 138 LGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQIIQFWTFAV 197

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VKY+GE+E  +   K+L +V   I   I+ CG A      
Sbjct: 198 PLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCG-AGKTGPV 256

Query: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  G   P ++      G+FLGW + ++ + F + G+E++GI  GE+ NP++T+P
Sbjct: 257 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKNPRRTVP 316

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   VFFRI F Y+  +  +GL + P N   + +  +  ++SPFVIAI +SG KVLP+ 
Sbjct: 317 RAINKVFFRILFFYILSLLFIGLLV-PFNDPKLKSEDSYISSSPFVIAIENSGTKVLPHI 375

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L  IIS+ N++IY+ SR LYGLAK+  APK+F    +  VP +  +  +  GFLA
Sbjct: 376 FNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAAFGFLA 435

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           Y+N   SA  VF ++ +  ++ G   W +I +A+I + + +K + +S +D+PF+  F P+
Sbjct: 436 YLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPW 495

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV 500
            AY             G+ AF  KF+   F  +YI VF  + + + +++ F+T+F+
Sbjct: 496 GAYYSAFFISLIIIIQGFTAFAPKFNVSNFFAAYISVFLFLAIWVVFQIRFRTRFI 551

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  319 bits (818), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/489 (36%), Positives = 278/489 (56%), Gaps = 8/489 (1%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            + R LK R + ++ LG  +GTGL +G  + L+  GP+   IAY+F G+++  V  SL E
Sbjct: 91  KVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYFVTQSLGE 150

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           MA+F P+    + +  R++ PAFG A G+ Y+  +AI  +  ++  G VI YW       
Sbjct: 151 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAVPLA 210

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        NF  VK +GE+E  +   K+L +V   I  L+I CGG+ +    GFR
Sbjct: 211 AWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAIVGYLIYALVIVCGGS-HQGPIGFR 269

Query: 211 YWRESGAL-PYLV--GGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           YWR  GA  P ++     TGKFLGW A ++ + F + G+E++GI  GE ANP+KT+P++ 
Sbjct: 270 YWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAI 329

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             V FRI   Y+  +F +G+ + P N K + A      +SPFVI+I ++  KVLP+  NA
Sbjct: 330 NKVVFRIVLFYIMSLFFIGMLL-PYNDKRLSAQDAVIASSPFVISIKNAHTKVLPDIFNA 388

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            ++V ++S+AN+++Y+ SR LY LA  G APK F  V R+ VP +G V  + LG LA++ 
Sbjct: 389 VVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTASLGLLAFLV 448

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAY 447
              +A T F+++ +  ++ G+  W +I +A+I + +A+K +GIS DD+PF+    P+ AY
Sbjct: 449 VNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKLMPWGAY 508

Query: 448 XXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKF-VKPSEIS 506
                        GY AF   +   TF TSYI +    ++V+G +LY++ +F +K  +I 
Sbjct: 509 YAAFFVTVIIFIQGYQAF-CPWDVSTFFTSYISLILLAVLVVGCQLYYRGRFLLKLEDID 567

Query: 507 FRT-RNEHE 514
             T R E E
Sbjct: 568 IDTDRREIE 576

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  315 bits (806), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/496 (35%), Positives = 274/496 (55%), Gaps = 11/496 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +   + R LKPR VS++ LG  +GTGL +G  + L   GP+   I+YLF GSL   V  S
Sbjct: 45  QERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQS 104

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   F+ +  R++ PA G A G+ Y   + I  +  L+  G +I YW    
Sbjct: 105 LGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWTLGV 164

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N ++VK++GE +  + + K++ +V   I CL + CG A      
Sbjct: 165 PNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCG-AGKTGPV 223

Query: 208 GFRYWRESGALPYLVG-----GGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKT 262
           GFRYWR  G  P+  G        G+FLGW + +V + F + G+E++G+  GE+ANP+KT
Sbjct: 224 GFRYWRNPG--PWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKT 281

Query: 263 IPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLP 322
           +PK+   VF RI   YV  +F +GL + P N   + + +  + +SPF+IAI +SG + LP
Sbjct: 282 VPKAIRKVFLRILLFYVGSLFFIGLLV-PFNDPKLDSTANYSASSPFIIAIQNSGTRALP 340

Query: 323 NFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGF 382
           +  NA +L  IIS+AN+++Y+ SR LYGLAK+G APKI   +NR  VP +     SL GF
Sbjct: 341 DIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGF 400

Query: 383 LAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQ 442
           L Y++    +A  F ++ +  ++ G   W +I + +I + +A+K +GIS DD+PF+    
Sbjct: 401 LGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLM 460

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV-K 501
           P+ AY             G+ AF  KF+   F  +Y+ VF  I + + +++ FK++ + K
Sbjct: 461 PWGAYYAAFFILLIIIIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHK 520

Query: 502 PSEISFRT-RNEHEGE 516
             ++   + R E E E
Sbjct: 521 VEDVDIDSDRREIEAE 536

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  315 bits (806), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 166/476 (34%), Positives = 274/476 (57%), Gaps = 5/476 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +   + R LKPR +S++ LG  +GTGL +G  S L++ GP+   IAY+F GS++  V  S
Sbjct: 52  RETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYFVTQS 111

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+    + +  R++ PAFG A G+ Y+  +AI  +  +   G VI YW    
Sbjct: 112 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYWTDAV 171

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  VK++GE+E  +   K++ +V   I  L+I CGG+ +    
Sbjct: 172 PLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGS-HQGPI 230

Query: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  G   P ++      G+FLGW + ++ + F + G+E++GI  GE ANP+KT+P
Sbjct: 231 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 290

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   VFFRI F Y+  +F +GL +   + +L +  +  A +SPFVI+I ++G KVLP+ 
Sbjct: 291 RAINKVFFRILFFYILSLFFIGLLVPYDDLRLSNTTAVIA-SSPFVISIQNAGTKVLPHI 349

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +++ IIS+AN+++Y+ SR LY LA  G APK F  V +  VP +G +  +LLG LA
Sbjct: 350 FNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLA 409

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           ++    +A   F+++ +  ++ G+  W +I ++++ + + +K +GIS +D+PF+    P+
Sbjct: 410 FLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLMPW 469

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV 500
            AY             G+ AF  KF    F TSYI +    ++ +G +L+++ +F+
Sbjct: 470 GAYYAAFFIGVIIIIQGFKAFTPKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFI 525

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  316 bits (809), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 173/493 (35%), Positives = 277/493 (56%), Gaps = 7/493 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           ++  + R LK R + ++ LG  +GTGL +G  + L+  GP+   IAY+F GS++  V  S
Sbjct: 100 QDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYIFMGSVVYFVTQS 159

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+    + +  R++ PAFG A G+ Y+  +AI  +  ++  G VI YW    
Sbjct: 160 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKAV 219

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  VK +GE E  +   K+L ++   I  LII CGG+ +    
Sbjct: 220 PLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALIIVCGGS-HQGPI 278

Query: 208 GFRYWRESGAL-PYLVGGGTG--KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  G   P ++   TG  +FLGW + ++ + F + G+E++GI  GE ANP+K++P
Sbjct: 279 GFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 338

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V FRI   Y+  +F +GL + P N   +   S    +SPFVI+I ++G + LP+ 
Sbjct: 339 RAINKVVFRIALFYIMSLFFIGLLV-PFNDDRLANDSAVIASSPFVISIQNAGTRALPDI 397

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L+ IIS+AN+++Y+ SR LY LA  G APKIF  V ++ VP +G +  + LG LA
Sbjct: 398 FNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGVICTAALGLLA 457

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           ++    +A T F+++ +  ++ G+  W +I +++I + +A+K +GIS DD+PF+    P+
Sbjct: 458 FLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDDLPFKAKLMPW 517

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV-KPS 503
            AY             G+ AF  KF   TF TSYI +    ++  G +LY++ +F+ K  
Sbjct: 518 GAYYASFFVTVIIFIQGFQAFTPKFDVSTFFTSYISLILLAVLFSGCQLYYRCRFIWKVE 577

Query: 504 EISFRT-RNEHEG 515
           +I   + R E E 
Sbjct: 578 DIDIDSDRREIEA 590

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  315 bits (807), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 168/475 (35%), Positives = 269/475 (56%), Gaps = 5/475 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            +  + R LK R + ++ LG  +GTGL IG  + L   GP+   IAYLF GS++  +  S
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+    + +  R++ PAFG A G+ Y+  +AI  +  ++  G VI YW    
Sbjct: 149 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDKV 208

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  VK +GEIE  +   K+L ++   +  LII CGG+ +    
Sbjct: 209 PLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGS-SQGPI 267

Query: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  G   P ++     TG+FLGW + ++ + F + G+E++GI  GE ANP+KT+P
Sbjct: 268 GFRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 327

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V FRI   Y+  +F +G+ + P N + + + S    +SPFVI+I ++G KVLP+ 
Sbjct: 328 RAINKVVFRIALFYIMSLFFIGMLV-PYNDERLASTSAVIASSPFVISIQNAGTKVLPDI 386

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +++ IIS+AN+++Y+ SR LY LA  G APK F  V R+ VP +G +  S LG LA
Sbjct: 387 FNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLLA 446

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           ++    +A T F+++ +  ++ G+  W +I I++I + +A+K +GIS DD+PF+    P+
Sbjct: 447 FLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMPF 506

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKF 499
            AY             G+ AF   +    F TSYI +    ++ IG +++++ +F
Sbjct: 507 GAYYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRF 561

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  313 bits (802), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 171/480 (35%), Positives = 272/480 (56%), Gaps = 5/480 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            +  + R LK R + ++ LG  +GTGL +G  + L+  GP+   IAY+F G+++  V  S
Sbjct: 87  HDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQS 146

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+    + +  R++ PAFG A G+ Y+  +AI  +  ++  G VI YW    
Sbjct: 147 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFKV 206

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  VK +GE E  +   K++ +V   I  LII CGG+ +    
Sbjct: 207 PLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGS-HQGPI 265

Query: 208 GFRYWRESGALPYLV---GGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  GA+   +     G  +FLGW + ++ + F + G+E++GI  GE ANP+K++P
Sbjct: 266 GFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 325

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V FRI   Y+  +F +GL + P N   + A S    +SPFVI+I ++G KVLP+ 
Sbjct: 326 RAINKVVFRIVLFYIMSLFFVGLLV-PYNDPRLSASSAVIASSPFVISIQNAGTKVLPDI 384

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +LV +IS+AN+++Y+ SR LY LA+ G APK F  V R  VP +G +  +LLG LA
Sbjct: 385 FNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLA 444

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           ++    +A T F+++ +  ++ G+  W +I +A+I + +A+K +GIS DD+PF+  F P+
Sbjct: 445 FLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPW 504

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSE 504
            AY             G+ AF  KF    F T+YI +   +++  G +LY++ +F+   E
Sbjct: 505 GAYYASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLE 564

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  311 bits (797), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 167/489 (34%), Positives = 277/489 (56%), Gaps = 6/489 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            +  + R LK R + ++ LG  +GTGL +G  + L+  GP+   IAYLF GS++  +  S
Sbjct: 63  HDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFMGSIVYFITQS 122

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+    + +  R++ PAFG A G+ Y+  +AI  +  ++  G VI +W    
Sbjct: 123 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQFWTSAV 182

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  VK +GEIE  +   K++ +V   I  L+I CGG+ +    
Sbjct: 183 PLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIVCGGS-SQGPI 241

Query: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  G   P ++      G+FLGW + ++ + F + G+E++GI  GE ANP+K++P
Sbjct: 242 GFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 301

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V FRI   Y+  +F +G+ + P N   + ++     +SPFVI+I ++G +VLP+ 
Sbjct: 302 RAINKVVFRIVIFYIMSLFFVGMLV-PFNDPRLASNVAVIASSPFVISIQNAGTRVLPHI 360

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +++ IIS+AN+++Y+ SR LY L++ G APK F  V R  VP +G +  SLLG LA
Sbjct: 361 FNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIATSLLGLLA 420

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           ++    +A T F+++ +  ++ G+  W +I +++I + +A+K +GIS DD+PF+    P+
Sbjct: 421 FLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLPFKAKLMPW 480

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV-KPS 503
            AY             G+ AF  KF    F T+YI +   ++++IG +LY++ +F+ K  
Sbjct: 481 GAYYAAFFVTVIIFIQGFEAFSPKFDVSGFFTAYISLIILVVLLIGCQLYYRCRFLWKLE 540

Query: 504 EISFRTRNE 512
           +I   T   
Sbjct: 541 DIDIDTDRR 549

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  312 bits (799), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 176/497 (35%), Positives = 275/497 (55%), Gaps = 16/497 (3%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            +  + R LKPR + ++ LG  +GTGL +G    L++ GP+   IAY+F GS++  V  S
Sbjct: 98  HDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYFVTQS 157

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+    + +  R++ PA G + G+ Y+  +AI  +  L+  G +I YW    
Sbjct: 158 LGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYWTYKV 217

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  VK +GEIE  ++  K+L +V   I  L+I CGG+      
Sbjct: 218 PLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGS-RQGPI 276

Query: 208 GFRYWRESGALPYLVGGG-------TGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPK 260
           GFRYWR      Y  G G         +FLGW + ++ + F + G+E++GI  GE ANP+
Sbjct: 277 GFRYWRHG----YAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPR 332

Query: 261 KTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKV 320
           KT+P++   V FRI   Y+  +F +GL + P N K +   S    +SPFVI++ ++G   
Sbjct: 333 KTVPRAINKVIFRIALFYILSLFFIGLLV-PYNDKRLSDGSAIIASSPFVISMLNAGTSA 391

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LP+  NA +L+ ++S+AN+D+YI SR LY LA  G APK F  VNR+ VP +G     L+
Sbjct: 392 LPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLV 451

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMW 440
           G+LA++    +A T F+++ +  ++ G+  WF+I  A+I + +A+K KGIS DD+PF+  
Sbjct: 452 GWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKAR 511

Query: 441 FQPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTK-F 499
           F P+ AY             GY+AF   +  K+F TSYI +    ++ +G  +Y++ +  
Sbjct: 512 FMPWGAYYAAFFVGLIIFIQGYDAF-TPWDTKSFFTSYISLILFGVLYLGCLIYYRGRLL 570

Query: 500 VKPSEISFRT-RNEHEG 515
           +K  +I   T R E E 
Sbjct: 571 IKIEDIDIDTDRKEVEA 587

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  310 bits (795), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 169/497 (34%), Positives = 275/497 (55%), Gaps = 14/497 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K+  + R LKPR + ++ LG  +GTGL IG    L K GP+   IAY+F G+++  V  +
Sbjct: 98  KDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQA 157

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+    + + +R++ PAFG + G+ Y+  +AI  +  ++  G VI +W    
Sbjct: 158 LGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTKV 217

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  V  +GEIE  +   K+L +V   I  L+I CGG+      
Sbjct: 218 PLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGS-KQGPI 276

Query: 208 GFRYWRESGALPYLVGGG-------TGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPK 260
           GFRYWR      Y +GGG         +FLGW A ++ + F + G+E++GI  GE ANP+
Sbjct: 277 GFRYWRHG----YAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPR 332

Query: 261 KTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKV 320
           K++P++   V FRI   Y+  +F +GL + P N   +++ ++   +SPFVI+I ++G + 
Sbjct: 333 KSVPRAINKVVFRIVIFYILSLFFIGLLV-PYNDPKLNSATSYIASSPFVISIENAGTRA 391

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LP+  NA +++ IIS+AN+++Y+ SR LY LA  G APKIF  V    VP +G +  +L+
Sbjct: 392 LPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALM 451

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMW 440
           G LA++    +A   F+++ +  ++ G+  W +I ++++ +  A+K +GIS DD+PF+  
Sbjct: 452 GLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKAR 511

Query: 441 FQPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV 500
           F PY +Y             G+ AF  KF   +F T+YI +    ++ IG +LY++ +F 
Sbjct: 512 FMPYGSYYACFFITVIIFIQGFTAFSPKFDVASFFTAYISLILLAVLFIGCQLYYRCRFF 571

Query: 501 -KPSEISFRTRNEHEGE 516
            K  +I   T      E
Sbjct: 572 WKVEDIDIDTDRREIDE 588

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  309 bits (792), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 172/496 (34%), Positives = 275/496 (55%), Gaps = 11/496 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            +  + R LK R + ++ LG  +GTGL +G    L   GP+   IAYLF GS++  +  S
Sbjct: 97  HDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQS 156

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+    + +  R++ PAFG A G+ Y+  +AI  +  ++  G VI YW    
Sbjct: 157 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKV 216

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  VK +GEIE  +   K+L +    +  LII CGG+ +    
Sbjct: 217 PLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGS-SQGPI 275

Query: 208 GFRYWRESGALPYLVG-----GGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKT 262
           GFRYWR  G  P+  G       T +FLGW + ++ + F + G+E++GI  GE ANP+K+
Sbjct: 276 GFRYWRNPG--PWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKS 333

Query: 263 IPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLP 322
           +P++   V FRI   Y+  +F +GL + P +   + + S    +SPFVI+I ++G K+LP
Sbjct: 334 VPRAINKVVFRIALFYIMSLFFIGLLV-PYDDPRLSSDSAVVASSPFVISIQNAGTKILP 392

Query: 323 NFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGF 382
           +  NA +++ +IS+AN+++Y+ SR LY LA+ G APK F  V R  VP +G +  + LG 
Sbjct: 393 DIFNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGL 452

Query: 383 LAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQ 442
           LA++    +A T F+++ +  ++ G+  W +I I++I + +A+K +GIS DD+PF+  F 
Sbjct: 453 LAFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFM 512

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV-K 501
           P+AAY             G+ AF   F    F T+YI +    ++ IG ++Y++ +F  K
Sbjct: 513 PWAAYYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWK 572

Query: 502 PSEISFRTRNEHEGEE 517
             +I   T +  E EE
Sbjct: 573 LEDIDIDT-DRREIEE 587

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  308 bits (788), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 168/484 (34%), Positives = 268/484 (55%), Gaps = 11/484 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +   + R LK R +S++ LG  +GTGL I   S L   GP+   +AY+F G+++  +  S
Sbjct: 51  QETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQS 110

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+    + +  R++ PAFG A G+ Y+  +AI  +  L+  G +I YW    
Sbjct: 111 LGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTDRV 170

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  V+++GEIE  +   K+L +V   I   II CGG+      
Sbjct: 171 PIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGS-KQGPI 229

Query: 208 GFRYWRESGALPYLVGGGTGK-------FLGWWACVVQSIFGFMGSEMIGIVYGETANPK 260
           G      +G +P      + +       FLGW + ++++ F + G+E++GI  GE+ NP+
Sbjct: 230 GLP---ATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPR 286

Query: 261 KTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKV 320
           K +PK+   VFFRI F Y+  +  +GL +   + +L    STD NASPFVI+I ++G K+
Sbjct: 287 KNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASPFVISIKNAGTKI 346

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LP+  NA +L+ +IS+AN+++YI SR  Y LA  G APK    V +  VP  G +  SL+
Sbjct: 347 LPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLM 406

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMW 440
           G ++++    +A+T F ++ +  ++ G+  W +I +A+I + + +K +GIS DD+PF+  
Sbjct: 407 GLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAK 466

Query: 441 FQPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV 500
           F P+AAY             GY AF  KF   TF TSYI +F  +L+ IG ++Y+K +F+
Sbjct: 467 FMPWAAYYATFFVTVIIFIQGYTAFTPKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRFL 526

Query: 501 KPSE 504
              E
Sbjct: 527 WAVE 530

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  306 bits (783), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 167/493 (33%), Positives = 276/493 (55%), Gaps = 8/493 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           ++  + R LK R + ++ LG  +GTGL +G  + L   GP+   IAY+F GS++  +  S
Sbjct: 90  QDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIYFITQS 149

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+    + +  R++ PAFG   G+ Y+  +AI  +  ++  G VI YW    
Sbjct: 150 LGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQYWTDAV 209

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  VK +GE+E  +   K+L ++   I  L+I CGG+ +    
Sbjct: 210 PLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGS-SQGPI 268

Query: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  G   P ++      G+FLGW + ++ + F + G+E++GI  GE ANP+K++P
Sbjct: 269 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 328

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V FRI   Y+  +F +GL + P N   + +  +   +SPFVI+I ++G   LP+ 
Sbjct: 329 RAINKVVFRIALFYIMSLFFIGLLV-PYNDHTLSSGDSYIASSPFVISIQNAGTYALPDI 387

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +++ IIS+AN+++Y+ SR LY LA+ G APK F  V +  VP +G +  + LG LA
Sbjct: 388 FNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASLGLLA 447

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           ++    +A T F+++ +  ++ G+  WF+I +++I + +A+K +GIS DD+PF+    P+
Sbjct: 448 FLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKLMPW 507

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKF-VKPS 503
            AY             G+ AF   +   TF TSYI +   +++ IG +LY++ +F +K  
Sbjct: 508 GAYYSAFFVFVIIFIQGFEAF-TPWDTTTFFTSYISLILLVVVFIGCQLYYRCRFLLKVE 566

Query: 504 EISFRT-RNEHEG 515
           +I   T R E E 
Sbjct: 567 DIDIDTDRREIEA 579

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  306 bits (783), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 171/476 (35%), Positives = 260/476 (54%), Gaps = 5/476 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +N  + RELK R + ++ LG  +GTGL IG  + LA  GP+   IAYLF GSL   V  S
Sbjct: 80  QNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYLFMGSLAFSVTQS 139

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   F+ +  R++ PAFG A G+ Y+  +AI  +  L+  G VI +W    
Sbjct: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTHKV 199

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VKY+GE E  +   K++ ++   I C  + CG        
Sbjct: 200 PLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPV- 258

Query: 208 GFRYWRESGAL-PYLV--GGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  GA  P ++      G+FLGW + ++ + F F G+E++GI  GE ANP+KT+P
Sbjct: 259 GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 318

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V FRI   Y+  +  +GL +   + KL  A S   + SPF++AI +SG KVLP+ 
Sbjct: 319 RAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSY-VSTSPFIVAIQNSGTKVLPHI 377

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L  IIS+AN++IY+ SR L+GL+K+  APK     ++  VP +     ++ G LA
Sbjct: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAVFATAVFGALA 437

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           YM T      VF ++ +   V G   W +I I++I + +A+K +GIS D++PF+    P 
Sbjct: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV 500
            AY             G+ AF  KF+  +F+ +YI +F  I + I ++  F+ +F+
Sbjct: 498 LAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECIFRCRFI 553

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  305 bits (782), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 171/490 (34%), Positives = 273/490 (55%), Gaps = 8/490 (1%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           ++ R LK R + ++ LG  +GTGL +G  + L+  GP+   IAY+F G+++  +  SL E
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           MA+F P+    + +  R++ PAFG + G+ Y+  +AI  +  ++  G VI YW       
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLA 224

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        NF  VK +GE E  +   K+L +V   I  L+I CGG+ +    GFR
Sbjct: 225 AWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGS-HQGPIGFR 283

Query: 211 YWRESGAL-PYLVGGG--TGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           YWR  GA  P ++      G+FLGW + ++ + F + G+E++GI  GE ANP+KT+P++ 
Sbjct: 284 YWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 343

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             V FRI   Y+  +F +GL + P N   +   S    +SPFVI+I ++G   LP+  NA
Sbjct: 344 NKVVFRIVIFYIMSLFFIGLLV-PYNEPRLSPSSAVIASSPFVISIQNAGTYALPDIFNA 402

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ +IS+AN+++Y+ SR LY LA+ G APK F  V +  VP +G ++ + LG LA++ 
Sbjct: 403 VVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLV 462

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAY 447
              +A T F+++ S  ++ G+  W +I +A+I + +A+K +GIS DD+PF+    PY AY
Sbjct: 463 VNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAY 522

Query: 448 XXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV-KPSEIS 506
                        G+ AF   F    F TSYI +    ++ I  +LY+K +F+ K  +I 
Sbjct: 523 YASFFVTIIIFIQGFQAF-CPFSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDID 581

Query: 507 FRT-RNEHEG 515
             + R E E 
Sbjct: 582 IDSDRREIEA 591

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  303 bits (777), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 163/478 (34%), Positives = 266/478 (55%), Gaps = 10/478 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
              ++ RELKPR V++++LG  +GTGL IG  S +   GP+   +AY+F  ++   V  S
Sbjct: 45  NQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQS 104

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   F+ + +R+V PA G A G+ Y+L + I  +  ++  G +I YW    
Sbjct: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N + VK++GE E  +   K++ ++      L++ CGG+      
Sbjct: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGS-KLGRI 223

Query: 208 GFRYWRESGALPYLVGG-----GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKT 262
           GFRYW++ G  P+ VG       T +FLGW + ++++ F F G+E++G+  GET NP++T
Sbjct: 224 GFRYWKDPG--PWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRT 281

Query: 263 IPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVL 321
           +PK+   VFFRI   Y+  + ++GL +   + +L+   ST +ANASPFV+AI+++G KVL
Sbjct: 282 VPKAINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVL 341

Query: 322 PNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLG 381
           P+ +N  ++V IIS+ N++IY+ SR LYGL + G AP          VP V  +  S+ G
Sbjct: 342 PDIMNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFG 401

Query: 382 FLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWF 441
            L Y+N    + +VF ++ S  +V G   W  I +++I + + +K +GIS DD+PF+  F
Sbjct: 402 ALGYLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKF 461

Query: 442 QPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKF 499
            PY AY             G+ AF   F    F+  YI  F  +++ + ++  FK ++
Sbjct: 462 MPYGAYYAAFFVIVIILVQGFTAF-TPFSAVDFVAYYISAFIFVVIWLLFQFLFKGRW 518

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  305 bits (780), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 173/493 (35%), Positives = 276/493 (55%), Gaps = 8/493 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           ++ ++ R LK R + ++ LG  +GTGL +G  + L+  GP+   IAY+F G+++  V  S
Sbjct: 102 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQS 161

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+    + +  R++ PAFG + G+ Y+  +AI  +  ++  G VI YW    
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDKV 221

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  VK +GE E  +   K+L ++   I  LII CGG+ +    
Sbjct: 222 PLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGS-HQGPI 280

Query: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  GA  P ++      G+FLGW + ++ + F + G+E++GI  GE ANP+KT+P
Sbjct: 281 GFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 340

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V FRI   Y+  +F +GL + P N   + A S    +SPFVI+I ++G   LP+ 
Sbjct: 341 RAINKVVFRIVLFYIMSLFFIGLLV-PYNDSRLSASSAVIASSPFVISIQNAGTYALPDI 399

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L+ ++S+AN+++Y+ SR LY LA+ G APK F  V R  VP +G V  + LG LA
Sbjct: 400 FNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLA 459

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           ++    +A T F+++ +  ++ G+  W +I +A+I + +A+K +GIS DD+PF+    PY
Sbjct: 460 FLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLMPY 519

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV-KPS 503
            AY             G+ AF   F    F TSYI +    ++ IG ++Y+K +F+ K  
Sbjct: 520 GAYYAAFFVTVIIFIQGFQAF-CPFKVSEFFTSYISLILLAVVFIGCQIYYKCRFIWKLE 578

Query: 504 EISFRT-RNEHEG 515
           +I   + R E E 
Sbjct: 579 DIDIDSDRREIEA 591

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  303 bits (776), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 171/493 (34%), Positives = 277/493 (56%), Gaps = 8/493 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           ++ ++ R LK R + ++ LG  +GTGL +G  + L+K GP+   I+Y+F G+++  +  S
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+    + +  R++ PAFG A G+ Y+  +AI  +  ++  G VI YW    
Sbjct: 163 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKV 222

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  VK +GE E  +   K+L ++   I  L+I CGG+ +    
Sbjct: 223 PLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-HQGPI 281

Query: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  GA  P ++      G+FLGW + ++ + F + G+E++GI  GE ANP+KT+P
Sbjct: 282 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 341

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V FRI   Y+  +F +GL + P N   + A S    +SPFVI+I ++G   LP+ 
Sbjct: 342 RAINKVVFRIVLFYIMSLFFIGLLV-PYNEPRLSASSAVIASSPFVISIQNAGTYALPDI 400

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L+ +IS+AN+++Y+ SR LY LA+ G APK F  V +  VP +G ++ + LG LA
Sbjct: 401 FNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLA 460

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           ++    +A T F+++ +  ++ G+  W +I +A+I + +A++ +GIS DD+PF+    PY
Sbjct: 461 FLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPY 520

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV-KPS 503
            AY             G+ AF   F    F TSYI +    ++  G +LY+K +F+ K  
Sbjct: 521 GAYYAAFFVTVIIFIQGFQAF-CPFKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLE 579

Query: 504 EISFRT-RNEHEG 515
           +I   T R E E 
Sbjct: 580 DIDIDTDRREIEA 592

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  300 bits (769), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 163/480 (33%), Positives = 265/480 (55%), Gaps = 13/480 (2%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           + R+LKPR VS++ LG  +GTGL IG  S L   GP+   I+YLF GS+   V  SL EM
Sbjct: 53  VQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEM 112

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
           A+F P+   F+ +  R++    G A G+ Y   +++  +  L+  G +I YW        
Sbjct: 113 ATFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAA 172

Query: 152 XXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRY 211
                       N + VK++GE +  + + K++ ++   + CL + CG A      GFRY
Sbjct: 173 WIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCG-AGKTGPVGFRY 231

Query: 212 WRESGALPYLVGGG-------TGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           WR  G  P+  G G        G+FLGW + +V + F + G+E++GI  GE+ANP+KT+P
Sbjct: 232 WRNPG--PW--GDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVP 287

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           K+   VFFRI   YV  +F +GL + P N + + +  + +  SPF+IAI +SG K+LP+ 
Sbjct: 288 KAINKVFFRILLFYVGSLFFIGLLV-PFNDEKLTSSDSYSAGSPFIIAIQNSGTKILPDI 346

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L  IIS+AN+++Y+ SR LYGLAK+  AP+ F   NR  VP V  +  +  GFL 
Sbjct: 347 FNAVILATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLG 406

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           Y++    A+  F ++ +  ++ G  +W +I + ++ + +A+K +GIS DD+PF+    P+
Sbjct: 407 YLSVSNGASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPW 466

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSE 504
            AY             G+ +    F+   F  +YI VF  +++   ++ +++T+ +   E
Sbjct: 467 GAYYSAFFITLIIIIQGFTSLAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIE 526

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  301 bits (770), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 169/476 (35%), Positives = 256/476 (53%), Gaps = 5/476 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +N  + RELK R + ++ LG  +GTGL IG    LA  GP+   I+YLF GSL   V  S
Sbjct: 80  RNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAYSVTQS 139

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   F+ +  R++ PAFG A G+ Y+  +AI  +  L+  G VI +W    
Sbjct: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEFWTNKV 199

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VKY+GE E  +   K+L ++   I C  + CG        
Sbjct: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV- 258

Query: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  GA  P ++      G+FLGW + ++ + F F G+E++GI  GE ANP+KT+P
Sbjct: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 318

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V FRI   Y+  +  +GL + P N   +   ++  + SPF+IAI +SG KVLP+ 
Sbjct: 319 RAIKKVVFRILTFYIGSLLFIGLLV-PYNDPKLTTATSYVSVSPFIIAIENSGTKVLPHI 377

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L  IIS+AN++IY+ SR L+GL+K+  APK      +  VP +     ++ G LA
Sbjct: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFGALA 437

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           YM T      VF ++ +   V G   W  I I++I + +A+K +GIS D++PF+    P 
Sbjct: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKLMPG 497

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV 500
            AY             G+ AF  KF    F+ +YI +F  + + I +++ F+ +F+
Sbjct: 498 LAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAIWILFEIIFRCRFI 553

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  300 bits (767), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 164/480 (34%), Positives = 266/480 (55%), Gaps = 7/480 (1%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           NL + L  R + L+ LG  +GTGL +G+ S L + GP  LF++++   +++  ++ +L+E
Sbjct: 50  NLKKGLSNRHIQLIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAE 109

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           M  + P        + RYVDP+ GFAAGWNY   YA++++  LTA   ++ YW       
Sbjct: 110 MVCYLPQQGSVPELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQVPQG 169

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        NF AV+++GE E      K++ ++ + +  ++I  GGAPNH   GFR
Sbjct: 170 VWITIFLIVVVVLNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFR 229

Query: 211 YWRESGALPY-LVGGGTGKFLGWWACVVQSIFGFMGS-EMIGIVYGETANPKKTIPKSSM 268
           YWR  GA  Y + GG  G+FL  W  +++S F F+ S E++G+   E  + ++ I K+S 
Sbjct: 230 YWRNPGAFGYHITGGNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASR 289

Query: 269 NVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISSSGIKVLPNFV 325
              +RI F Y+    ++G+ ++  +  L+ A   +   A +SPFV  I++SGI VL + +
Sbjct: 290 RFIYRIIFFYLSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVI 349

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           N A+L    S+ N+  Y  SR +  L+K G APKIF  +NRF VP       SL+  LAY
Sbjct: 350 NVAILTSAWSAGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAY 409

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYA 445
           +N   +++ VF ++++  ++ G + WF I +AYI + +AI    + +D IP+R   QP++
Sbjct: 410 LNVSSTSSKVFQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRL-LDRIPYRSPLQPFS 468

Query: 446 AYXXXXXXXXXXXXNGYNAFII-KFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSE 504
           AY            NGY  FI  ++ YK F+TSYI +   +   +G+K  +KT+F  P +
Sbjct: 469 AYFFTIVVAIITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTRFCIPVD 528

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  300 bits (768), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 167/476 (35%), Positives = 258/476 (54%), Gaps = 5/476 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +N  + RELK R + ++ LG  +GTGL IG  + L   GP+   I+YLF GSL   V  S
Sbjct: 80  QNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQS 139

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   F+ +  R++ PAFG A G+ Y+  +A+  +  L+  G VI +W    
Sbjct: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSVVGQVIQFWTYAV 199

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VKY+GE E  +   K++ ++   I C  + CG        
Sbjct: 200 PLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFCMVCGAGVTGPV- 258

Query: 208 GFRYWRESGAL-PYLV--GGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  GA  P ++       +FLGW + ++ + F F G+E++GI  GE ANP+KT+P
Sbjct: 259 GFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 318

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V FRI   Y+  +  +GL + P N   + + ++  + SPF+IAI +SG KVLP+ 
Sbjct: 319 RAIKKVVFRILTFYIGSLLFIGLLV-PYNDPKLTSATSYVSTSPFIIAIENSGTKVLPHI 377

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L  IIS+AN++IY+ SR L+GL+K   APK F    +  VP +     S+ G LA
Sbjct: 378 FNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAVFATSIFGALA 437

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           YM T      VF+++ +   V G   W +I +++I + +A+K +GIS D++PF+    P 
Sbjct: 438 YMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDELPFKAKLMPG 497

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV 500
            AY             G+ +F   F+   F+ +YI VF  + + I ++L F+ +FV
Sbjct: 498 LAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELIFRCRFV 553

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  299 bits (766), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 175/481 (36%), Positives = 274/481 (56%), Gaps = 13/481 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            + R LKPR VS++ LG  +GTGL +G    L+  GP+   IAY+F GS++  V  SL E
Sbjct: 72  EVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQSLGE 131

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           MA+F P+    + +  R++ PAFG A G+ Y+  +AI  +  L+  G +I YW       
Sbjct: 132 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINYWTDAVPLA 191

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        NF  VK++GE E  +   K++ +V   +  LII CGG+ +    GFR
Sbjct: 192 AWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGGS-SQGPIGFR 250

Query: 211 YWRESGALPYLVGGGT-------GKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTI 263
           YWR  G  P+  G GT        +FLGW   +V + F + G+E++GI  GE +NP+KT+
Sbjct: 251 YWRNPG--PW--GTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEASNPRKTV 306

Query: 264 PKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPN 323
           PK+   VFFRI   Y+  +F +GL + P NS  + ++S    +SPFVI+I ++G KVLP+
Sbjct: 307 PKAINKVFFRILVFYIGSLFFVGLLV-PYNSPQLESNSAVIASSPFVISIQNAGTKVLPD 365

Query: 324 FVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFL 383
             NA +LV I+S+ N+++Y+ SR LY LA  G APK F  V +  VP +G +  +LLG L
Sbjct: 366 IFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTALLGLL 425

Query: 384 AYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQP 443
           A++ T ++A T F+++ +  ++ G+  WF+I +A+I + + +K +GIS D +PF+    P
Sbjct: 426 AFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFKAKLMP 485

Query: 444 YAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPS 503
           + AY             G+ AF  +F    F T+YI +   +++ I  +LY++ +F+   
Sbjct: 486 WGAYYAAFFVGLIVFIQGFTAFAPRFDVSEFFTAYISLILLVVLFILCQLYYRCRFLTKI 545

Query: 504 E 504
           E
Sbjct: 546 E 546

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  298 bits (762), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 163/493 (33%), Positives = 264/493 (53%), Gaps = 5/493 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +   + RELK R + ++ LG  +GTGL IG  + L   GP+   IAYLF G+L+  V  S
Sbjct: 55  REAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQS 114

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   F+ +  R++ P+FG A G+ Y+  +AI  +  L+  G +I +W    
Sbjct: 115 LGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSVVGQIIQFWTSAV 174

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   V+++GE E  +   K+L ++   I CL + CG        
Sbjct: 175 PIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGPV- 233

Query: 208 GFRYWRESGAL-PYLVGGG--TGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  G + P ++       KFLGW + ++ + F + G+E++GI  GE ANP+K++P
Sbjct: 234 GFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 293

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V FRI F Y+  +F +GL + P N   + +  +   ASPF+I+I +SG  +LP+ 
Sbjct: 294 RAIKKVVFRILFFYIGSLFFIGLLV-PYNDPKLTSDDSYVAASPFIISIQNSGTPILPHI 352

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L  IIS+AN+++Y+ SR ++GL+K   AP+I    N+  VP V  +   L G LA
Sbjct: 353 FNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALA 412

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           YM T       F+++ +   V G  +W +I I+++ + +A++ +GIS DD+PF+  F P 
Sbjct: 413 YMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPG 472

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSE 504
            AY             G+ +F   F    F+ +YI  F  I + I ++L+F+ + +   E
Sbjct: 473 LAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIE 532

Query: 505 ISFRTRNEHEGEE 517
                 +  + EE
Sbjct: 533 DVDIDTDRRDIEE 545

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  298 bits (763), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 167/476 (35%), Positives = 256/476 (53%), Gaps = 5/476 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +N  + RELK R + ++ LG  +GTGL IG  + L   GP+   I+YLF GSL   V  S
Sbjct: 80  QNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAYSVTQS 139

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   F+ +  R++ PAFG A G+ Y+  +AI  +  L+  G VI +W    
Sbjct: 140 LGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQFWTYKV 199

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VKY+GE E  +   K+L ++   I C  + CG        
Sbjct: 200 PLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGVTGPV- 258

Query: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  GA  P ++      G+FLGW + ++ + F F G+E++GI  GE ANP+K++P
Sbjct: 259 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPRKSVP 318

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V FRI   Y+  +  +GL + P N   +   ++  + SPF+IAI +SG KVLP+ 
Sbjct: 319 RAIKKVVFRILTFYIGSLLFIGLLV-PYNDPKLTQSTSYVSTSPFIIAIENSGTKVLPHI 377

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L  IIS+AN++IY+ SR L+GL+K+  APK      +  VP +     +  G LA
Sbjct: 378 FNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFGALA 437

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           YM T      VF ++ +   V G   W +I I++I + +A+K +GIS D++PF+    P 
Sbjct: 438 YMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKLMPG 497

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV 500
            AY             G+ AF  KF+  +F  +YI +F  + + I ++  F+ +F+
Sbjct: 498 LAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFI 553

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  297 bits (760), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 159/457 (34%), Positives = 255/457 (55%), Gaps = 5/457 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K+ ++ R LKPR ++++ LG  +GTGL +G    L   GP+   IAY+F G+++  V  S
Sbjct: 89  KHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVTQS 148

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EM +F P+   F+ + +R++ PAFG A G+ Y+  +A+  +  L+  G VI +W    
Sbjct: 149 LGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTTAV 208

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VKY+GEIE  +   K+L LV   I CL IT G  P H   
Sbjct: 209 PLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGP-HGPF 267

Query: 208 GFRYWRESGAL-PYLVG--GGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR+ GA  P ++       +FLGW + ++ + F + G+E++GI  GE ANP+K +P
Sbjct: 268 GFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 327

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           K+   V  RI F YV  +F +G+ + P N   + + ++  ++SPF+IAI +SG+ +LP+ 
Sbjct: 328 KAIKKVILRILFFYVGSLFFIGMLV-PFNDPKLTSATSFVSSSPFIIAIQNSGVSLLPSI 386

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            N  +L+ IIS+ N+++Y+ SR L+GLA    AP+ F    +  VP V  +  SL G LA
Sbjct: 387 FNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLFGSLA 446

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           ++        VF+++ S V++ G   W  I +++I + +A++ +GIS + +PF+  F P+
Sbjct: 447 FLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAIFMPW 506

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGV 481
            AY             G+ AF  +F+   F+ SYI +
Sbjct: 507 LAYYATAFIILIILIQGFTAFAPRFNVSDFVASYISL 543

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  295 bits (756), Expect = 5e-93,   Method: Compositional matrix adjust.
 Identities = 170/493 (34%), Positives = 265/493 (53%), Gaps = 11/493 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            + R+L  R ++++ LG  +GTGL +G  + L   GP+   IAYLF G+++  V  SL E
Sbjct: 59  EVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGE 118

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           MA+F P+   F+ + +R++ PA G A G+ Y+  +A+  +  L+  G +I +W       
Sbjct: 119 MATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP 178

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   V+ +GEIE  +   K+  ++   I C  I CG A      GFR
Sbjct: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCG-AGKTGPVGFR 237

Query: 211 YWRESGALPYLVGG-----GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           YWR  G  P+  G         +FLGW + ++ + F F G+E++GI  GE ANP++T+PK
Sbjct: 238 YWRNPG--PWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPK 295

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFV 325
           +   V FRI   Y+  +F +GL + P +   + + ++  ++SPF+IAI +SG K+LP+  
Sbjct: 296 AIRKVVFRILVFYILSLFFIGLLV-PYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIF 354

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           N  +LV IIS+ N+++YI SR L+GLAK+G  PK+F    +  VPV   V  SL G LA+
Sbjct: 355 NGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAF 414

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYA 445
           M T       F ++ + V V G  +W  I  A+I + + ++++GIS +D+PF+  F PY 
Sbjct: 415 METSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYL 474

Query: 446 AYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV-KPSE 504
           AY             G+ AF  KF    F  SYI VF   +    ++L+FK ++V K  +
Sbjct: 475 AYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVD 534

Query: 505 ISF-RTRNEHEGE 516
           I   + R E E  
Sbjct: 535 IDIDKDRREIEDR 547

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  295 bits (756), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 168/493 (34%), Positives = 274/493 (55%), Gaps = 8/493 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           ++ ++ R LK R + ++ LG  +GTGL +G  + L+  GP+   IAY+F G+++  V  S
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+    + +  R++ PAFG + G+ Y+  +AI  +  ++  G VI YW    
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKV 221

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  VK +GE E  +   K+L ++   I  L+I CGG+      
Sbjct: 222 PLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-KQGPI 280

Query: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  GA  P ++      G+FLGW + ++ + F + G+E++GI  GE ANP+KT+P
Sbjct: 281 GFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 340

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V FRI   Y+  +F +GL + P     + A S    +SPFVI+I ++G   LP+ 
Sbjct: 341 RAINKVVFRIVLFYIMSLFFIGLLV-PYTDPRLSASSAVIASSPFVISIQNAGTYALPDI 399

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L+ +IS+AN+++Y+ SR LY LA+ G APK F  V +  VP +G ++ + LG LA
Sbjct: 400 FNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLA 459

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           ++    +A T F+++ +  ++ G+  W +I +++I + +A+  +GIS DD+PF+  F PY
Sbjct: 460 FLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPY 519

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV-KPS 503
            AY             G+ +F   F    F TSYI +    ++  G +LY+K +F+ K  
Sbjct: 520 GAYYASFFVTVIIFIQGFQSF-CPFRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKLE 578

Query: 504 EISFRT-RNEHEG 515
           +I   + R E E 
Sbjct: 579 DIDIDSDRREIEA 591

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  291 bits (745), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 170/493 (34%), Positives = 261/493 (52%), Gaps = 10/493 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            + RELK R + ++ LG  +GTGL IG  + L   GP+   IAYLF  +L   V  SL E
Sbjct: 26  TVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQSLGE 85

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           MA+F P+   F+ +  R+V PAFG A G+ Y+  + I  +  L+  G VI +W       
Sbjct: 86  MATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFAVPLA 145

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   VKY+GE E  + + K++ ++   I C  + CG        GFR
Sbjct: 146 AWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPV-GFR 204

Query: 211 YWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           YWR  GA  P ++       +FLGW + ++ + F F G+E++GI  GE ANP+KT+P++ 
Sbjct: 205 YWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVPRAI 264

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDA--NASPFVIAISSSGIKVLPNFV 325
             V FRI F Y+  +F +GL +   + KL    STD+  +ASPF+IAI +SG  VLP+  
Sbjct: 265 KKVVFRILFFYILSLFFIGLLVPYDDWKLT---STDSYVSASPFIIAIENSGTHVLPHIF 321

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA ++  IIS+ N++IY+ SR +YGL+    AP I     +  VP V  +  SL G LAY
Sbjct: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYA 445
           M T       F+++ +   V G   W +I +++I + +A++ +GIS DD+PF+  + P  
Sbjct: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL 441

Query: 446 AYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSEI 505
           AY             G+ +F   ++   F+T+YI VF  I + I ++ +F+ + +   E 
Sbjct: 442 AYYGVFFMTLIIIIQGFTSF-CPWNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVED 500

Query: 506 SFRTRNEHEGEEA 518
                +    EEA
Sbjct: 501 VDIDTDRRAVEEA 513

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  292 bits (747), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 162/498 (32%), Positives = 264/498 (53%), Gaps = 15/498 (3%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           ++  + R LKPR + ++ LG  +GTGL +G    L   GP+ + IAYLF  ++   V+ S
Sbjct: 70  RSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLFMATIAFSVMQS 129

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA++ P+   FS +  R++ PAFG A G+ Y+  ++I  +  L+  G ++ YW    
Sbjct: 130 LGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVIGQIVQYWTFKV 189

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  VK++GE E  +   K++ +V   I C I+ CG A      
Sbjct: 190 PVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIMVCG-AGKTGPV 248

Query: 208 GFRYWRESGALPYLVGGG-------TGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPK 260
           GFRYWR      Y  G G         +FLGW + ++ + F + G+E++GI  GE ANP+
Sbjct: 249 GFRYWRHG----YAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPR 304

Query: 261 KTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKV 320
           KT+PKS     +RI   Y+F +  +GL + P N   +    + A +SPF++AI +SG K 
Sbjct: 305 KTVPKSIKRTLWRILIFYIFSLLFVGLLV-PFNDHGLQDSRSYAASSPFILAIKNSGTKA 363

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LP+  NA +L  +IS+AN+D+Y+ SR +Y +A++  AP I    ++  VP    +  S +
Sbjct: 364 LPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVLFTSAI 423

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMW 440
           G LAY+ T  S A VF+++ +   V G  +W+ I  +++ + +A+K +GIS +D+PF+  
Sbjct: 424 GALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDLPFKAS 483

Query: 441 FQPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV 500
           F P+ A              G+  F   F    F+ SYI V    ++   ++++F+   +
Sbjct: 484 FMPWIAIYSFFFMTLIILVQGFTCFTPHFQASDFVASYISVGLFFVIWAVFQIWFRCPLL 543

Query: 501 KP-SEISFRT-RNEHEGE 516
            P +EI   T R + + E
Sbjct: 544 VPIAEIDIDTDRRDVDAE 561

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  292 bits (747), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 158/480 (32%), Positives = 258/480 (53%), Gaps = 5/480 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            +  + RELK R + ++ LG+ +GTGL IG  + L + GP+   I+Y+F G+L+  V  S
Sbjct: 69  HDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQS 128

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   F+ +  R++ P+ G A G+ Y+  +A+  +  L+  G VI YW    
Sbjct: 129 LGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWTYAV 188

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VKY+GE+E  +   K++ +V   + CL + CG        
Sbjct: 189 PLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTGPV- 247

Query: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  G   P ++       +FLGW + ++   F + G+E++GI  GE ANP+K +P
Sbjct: 248 GFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVP 307

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V FRI F Y+  +F +GL + P N   ++   +   +SPF+IAI +SG  VLP+ 
Sbjct: 308 RAIKKVVFRILFFYIGSLFFIGLLV-PYNDDALNNTDSYVASSPFIIAIKNSGTPVLPHI 366

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +   I+S+ N+++Y+ SR L+GL+K+  APKI     +  VP +  +  S++G LA
Sbjct: 367 FNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGALA 426

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           YM T       F+++ +  +V G   W +I +++I + +A+K +GIS DD+PF+    P 
Sbjct: 427 YMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMPG 486

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSE 504
            AY             G+ AF  KF    F  +YI +F  I +   +++ F+ +F+   E
Sbjct: 487 LAYYASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKVE 546

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  291 bits (745), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 169/501 (33%), Positives = 267/501 (53%), Gaps = 15/501 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            +  + RELK R + ++ LG  +GTGL IG  + L   GP+   IAY+F G+L   V  S
Sbjct: 58  HDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQS 117

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   F+ + +R++ P+ G A G+ Y+  +A+  +  L+  G ++ YW    
Sbjct: 118 LGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVVGQIVDYWTFAV 177

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VK++GEIE  +   K++ +V   I CL + CG        
Sbjct: 178 PIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGPV- 236

Query: 208 GFRYWRESGALPY---LVGGG--------TGKFLGWWACVVQSIFGFMGSEMIGIVYGET 256
           GFRYWR  G  P+   L   G        TG+FLGW+  ++ + F + G+E++GI  GE 
Sbjct: 237 GFRYWRNPG--PWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEA 294

Query: 257 ANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSS 316
           ANP+KT+P++   V FRI   Y+  +F +GL + P +   + +  +  ++SPF+IAI +S
Sbjct: 295 ANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLV-PFDDPKLSSDDSYVSSSPFIIAIENS 353

Query: 317 GIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVT 376
           G K+LP+  NA +L+ IIS+ N++IY+ SR L+ LAK G APKI     +  VP V  + 
Sbjct: 354 GTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLA 413

Query: 377 GSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIP 436
            ++ G LAYM T +   TVF ++ +  ++ G   W +ILI++I + + +K +GIS DD+P
Sbjct: 414 TAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLP 473

Query: 437 FRMWFQPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFK 496
           F+    P  AY             G+ AF   F    F  +YI V    L+   ++L+FK
Sbjct: 474 FKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFK 533

Query: 497 TKFVKPSEISFRTRNEHEGEE 517
            +++   E      N  + E+
Sbjct: 534 CRWIWKLEDVDIDSNRRDVEK 554

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  291 bits (746), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 169/492 (34%), Positives = 266/492 (54%), Gaps = 12/492 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K   + R+LK R + ++ LG  +GTGL IG  + L   GP+   IAYLF  +++  V  S
Sbjct: 93  KEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFSVTQS 152

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   F+ + +R++ PA G A G+ Y+  +A+  +  L+  G +I +W    
Sbjct: 153 LGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFWTHAV 212

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VK++GE E  +   K+L ++   I CL + CG        
Sbjct: 213 PLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAGVTGPV- 271

Query: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  G   P ++      G+FLGW + ++ + F + G+E++GI  GE ANP+KT+P
Sbjct: 272 GFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 331

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDA--NASPFVIAISSSGIKVLP 322
           ++   V FRI   Y+  +F +GL +   + KL    STD+  +ASPF+IAI +SG K+LP
Sbjct: 332 RAIKKVTFRILIFYILSLFFIGLLVPYDDEKLT---STDSYISASPFIIAIENSGTKILP 388

Query: 323 NFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGF 382
           +  NA +L  IIS+ N+++Y+ SR L+GLAK   APK F   +R  VP       S  G 
Sbjct: 389 HIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFFTSSFGA 448

Query: 383 LAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQ 442
           LA++      A  F+++ + +SV G   W  I IA++ + +A+K +GIS DD+PF+  F 
Sbjct: 449 LAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLPFKARFM 508

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKF--- 499
           P+ AY             G+ AF   F+   F+ +YI +F    + + ++LYF++K    
Sbjct: 509 PHLAYYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFRSKLLWT 568

Query: 500 VKPSEISFRTRN 511
           V+  +I    R+
Sbjct: 569 VEEVDIDTDRRD 580

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  287 bits (735), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 165/496 (33%), Positives = 264/496 (53%), Gaps = 10/496 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K  ++ RELK R +S++ LG  +GTGL +G    L   GPI   IAYLF G+++  V  S
Sbjct: 31  KQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVVFSVTQS 90

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EM +F P+   F+ +  R++ PAFG A G+ Y+  +A+  +  L+  G +I +W    
Sbjct: 91  LGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQFWTMAV 150

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   V+ +GEIE  +   K+L  ++ +I   I    GA      
Sbjct: 151 PLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLA-ILGFIIYGICIICGAGVTGPV 209

Query: 208 GFRYWRESGALPYLVG-----GGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKT 262
           GFRYW+  G  P+ +G         +F GW + ++ + F F G+E++GI  GE   P+KT
Sbjct: 210 GFRYWKNPG--PWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEPRKT 267

Query: 263 IPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLP 322
           +PK+   V FRI   Y+  + ++GL + P N   + ++ +  ++SPF+I I ++G K+LP
Sbjct: 268 VPKAIKKVVFRILVFYIGSLLVIGLLV-PYNDPKLQSNDSYVSSSPFIITIQNAGTKILP 326

Query: 323 NFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGF 382
           +  NA +L+ IIS+ N+++YI SR LYGLAK+ AAPK F   ++  VP V  +  S+ G 
Sbjct: 327 HIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGS 386

Query: 383 LAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQ 442
           LAYM T       F+++ + V V G   W  I  ++I + +A+K +GIS +D+P++    
Sbjct: 387 LAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAMLM 446

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV-K 501
           P+ AY             G+ +F  KF    F  +YI VF  I+  + ++++FK + V K
Sbjct: 447 PWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWK 506

Query: 502 PSEISFRTRNEHEGEE 517
             ++   T      EE
Sbjct: 507 LQDVDLDTDRRDIEEE 522

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  288 bits (738), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 157/474 (33%), Positives = 257/474 (54%), Gaps = 5/474 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           ++  + RELK R + ++ LG  +GTGL IG  + L   GP+   IAYLF  +++  V  S
Sbjct: 85  QDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQS 144

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   F+ + +R++ P+ G A G+ Y+  +AI  +  L+  G +I +W    
Sbjct: 145 LGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VK++GE E  +   K++ ++   I CL + CG        
Sbjct: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT-GPV 263

Query: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  G   P ++      G+FLGW + ++ + F + G+E++GI  GE ANP+KT+P
Sbjct: 264 GFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V FRI   Y+  +F +GL + P +   + +  +  ++SPF+IAI +SG KVLP+ 
Sbjct: 324 RAIKKVSFRILIFYILSLFFIGLLV-PFDDPKLSSDDSYVSSSPFIIAIQNSGTKVLPHI 382

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L  IIS+ N++IY+ SR ++GLAK   AP+ F +  +  VP +  +  S  G LA
Sbjct: 383 FNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALA 442

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           ++      A  F+++ + V V G   W  I IA++ + + ++ +GIS DD+PF+    P+
Sbjct: 443 FLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPW 502

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTK 498
            AY             G+ AF   F+   F+ +YI VF    + + ++LYF+ K
Sbjct: 503 LAYYAIFFMIIIIIIQGFTAFAPTFNGSDFVAAYISVFLFFFLWVSFQLYFRCK 556

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  288 bits (738), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 162/477 (33%), Positives = 253/477 (53%), Gaps = 6/477 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +   + RELKPR + ++ LG  +GTGL IG  + +   GP+   IAY+F G+L+  V  S
Sbjct: 98  EEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFMGTLVFSVTQS 157

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   F+ + +R+V   FG A G+ Y+  +AI  +  L+  G VI +W    
Sbjct: 158 LGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVGQVIEFWTFKV 217

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  VK +GE E  +   K++ ++   I CL + CG        
Sbjct: 218 PLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMVCGAGIT-GPV 276

Query: 208 GFRYWRESGAL-PYLVG--GGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  G   P ++       +FLGW + ++ + F + G+E++GI  GE ANP+K++P
Sbjct: 277 GFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 336

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V  RI   Y+  +F +GL + P N   + +  +  +ASPF+IAI +SG KVLP+ 
Sbjct: 337 RAIKKVSVRILLFYILSLFFIGLLV-PYNDPKLSSTDSYVSASPFIIAIQNSGTKVLPHI 395

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L  IIS+AN+++Y+ SR LYGL+    APK F    R  VP +  +  +  G LA
Sbjct: 396 FNAVILTTIISAANSNVYVGSRILYGLSSAKLAPK-FFQKTRNGVPFIAVLFTAAFGALA 454

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           YM T       F+++ +   V G   W  I I++I + + +K +G+S DD+P++    P 
Sbjct: 455 YMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLPYKAALMPG 514

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVK 501
            AY             G+ AF  KF    F+T+YI  F  + + I  + YF+T+  +
Sbjct: 515 LAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFRTRLWR 571

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  287 bits (735), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 165/492 (33%), Positives = 258/492 (52%), Gaps = 20/492 (4%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
              + R LKPR VS++ LG  +GTGL I     L   GP+   IA++  G+L   V  SL
Sbjct: 70  QAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSL 129

Query: 89  SEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXX 148
            EMA+F P+   F+ +  R++ PA G A G+ Y+  +AI  +  L+  G +I YW     
Sbjct: 130 GEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSIVGQIIQYWTDAVP 189

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          N   VK++GE E  +   K++ ++   I  L + CG  P     G
Sbjct: 190 LEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EGPIG 248

Query: 209 FRYWRESGALPYLVGGG-------TGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKK 261
           FRYWR+ G  P+  G G         +FLGW + ++ + F + G+E++GI  GET NP+K
Sbjct: 249 FRYWRKPG--PW--GNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITAGETKNPRK 304

Query: 262 TIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANA-SPFVIAISSSGIKV 320
            +P++   VFFRI   Y+  +F +GL +   + KL  + +    A SPF+IAI +    V
Sbjct: 305 AVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIAILNCRTPV 364

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LP+  NA +L  IIS+ N+++Y+ SR L+GL+K+  APK F    +  VP +  +  ++ 
Sbjct: 365 LPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVF 424

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMW 440
           GFLAY+N    A  VF ++ +  ++ G + W  I I++I + + +K +GIS DD+P++  
Sbjct: 425 GFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAK 484

Query: 441 FQPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV 500
           F PYAAY             G+ AF   F+   F  +YI VF   ++   ++  ++TK  
Sbjct: 485 FMPYAAYYAAFFITVIIIIQGFTAFAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKL- 543

Query: 501 KPSEISFRTRNE 512
                 FRT +E
Sbjct: 544 ------FRTLDE 549

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  286 bits (731), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 171/491 (34%), Positives = 260/491 (52%), Gaps = 8/491 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
               + R LK R + ++ LG  +GTGL IG  + L+  GP+   IAYLF  +L+  V+ S
Sbjct: 73  HEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLVYSVVQS 132

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   F+ + +R++ PAFG A+G+ Y+  +AI  +  L+  G +I +W    
Sbjct: 133 LGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIEFWTTAV 192

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VKY+GE E  +   K++ LV   I CL + CG        
Sbjct: 193 PMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGAGITGPV- 251

Query: 208 GFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  GA  P ++      G+FLGW + ++ + F + G+E++GI  GE ANP+K++P
Sbjct: 252 GFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 311

Query: 265 KSSMNVFFRI-GFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPN 323
           ++   V FRI  F Y   VFI GL + P N   +++  +  ++SPF+IAI +SG KVLP+
Sbjct: 312 RAIKKVVFRILVFYYPIAVFI-GLLV-PYNDPKLNSSDSYVSSSPFIIAIENSGTKVLPH 369

Query: 324 FVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFL 383
             NA +L  IIS+ N+++Y+ SR +YGLAK   AP  F   N   VP       S  G L
Sbjct: 370 IFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSAFGAL 429

Query: 384 AYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQP 443
           AYM      A+ F+++ +   V G   W  I   +I + +A+K +GIS DD+PF+  F P
Sbjct: 430 AYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKAKFMP 489

Query: 444 YAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTK-FVKP 502
           + AY             G+ AF   F    F  +Y+ VF  I + +G +++F+ + F + 
Sbjct: 490 WLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRIFHRL 549

Query: 503 SEISFRTRNEH 513
            E+   T    
Sbjct: 550 DEVDIDTDRRD 560

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  283 bits (723), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 170/493 (34%), Positives = 263/493 (53%), Gaps = 6/493 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
            G + R+LK R + ++ LG  +GTGLIIG G  LA  GP+   I+YLF G+++  V  SL
Sbjct: 63  RGEVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSL 122

Query: 89  SEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXX 148
            EMA+F P+   FS +  R++ PA G   G+ Y+L +    +  L+  G +I YW     
Sbjct: 123 GEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVP 182

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          N   VKY+GE E  +   K++ L+   I    I CG        G
Sbjct: 183 LAAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIG 242

Query: 209 FRYWRESGAL-PYLVGGG--TGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           FRYWR  GA  P ++      G+FLGW + ++ + F + G+E++GI  GE ANP+K +P+
Sbjct: 243 FRYWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPR 302

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFV 325
           +   V  RI   Y+  +F +GL + P N   + +  T  +ASPF+I+I +SG KVLP+  
Sbjct: 303 AIKKVVIRILVFYILSLFFIGLLV-PYNDPKLDSDGTFVSASPFMISIENSGTKVLPDIF 361

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ I S+ N+++YI SR LY L+K+  APK    V R  VP +  +  SL GFLA+
Sbjct: 362 NAVVLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAF 421

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYA 445
           + T   +   F+++ +   V G   W  I  ++I + +AIK +GIS DD+P++    P+ 
Sbjct: 422 LETSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFL 481

Query: 446 AYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV-KPSE 504
           AY             G+ AF   F    F+ +YI VF   ++ + ++L+FK + + K  +
Sbjct: 482 AYYASFFIALIVLIQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQD 541

Query: 505 ISFRTRNEHEGEE 517
           I   + +  E EE
Sbjct: 542 IDIDS-DRREIEE 553

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  282 bits (721), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 157/480 (32%), Positives = 262/480 (54%), Gaps = 7/480 (1%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + L+ R + L+ LG  +GTGL +G+   L   G   L ++++   +++  ++ SL+E
Sbjct: 45  TLHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAE 104

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           M  + P        ++RYVDP+ GFA GWNY   YAI+++A L+A   V+ YW       
Sbjct: 105 MICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYWDNPVPMA 164

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        NF AVKY+GE E      KL+ ++ + +  ++I  GGAPNH  TGFR
Sbjct: 165 AWITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFR 224

Query: 211 YWRESGALPY-LVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKKTIPKSSM 268
           YW+  G     L  G TG+FL  W  V++S F F +  E+IGI   E  + ++   K+S 
Sbjct: 225 YWKNPGPFAMSLAPGSTGRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTEKASR 284

Query: 269 NVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDA---NASPFVIAISSSGIKVLPNFV 325
              +RI F YV    ++G+ +S  + KL+ A  T A    +SPFV  I+++GI VL + +
Sbjct: 285 RFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPVLDHVI 344

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           N A+L    S+ N+ +Y  +R +  LA++G APK    +NR+ VP    +  +L+  LAY
Sbjct: 345 NVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLVACLAY 404

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYA 445
           +N K ++A VF ++++  ++ G + WF + IA+I + R I    +    IP++   QPY 
Sbjct: 405 LNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRFRRGIVFNNLQ-SRIPYQGPLQPYI 463

Query: 446 AYXXXXXXXXXXXXNGYNAFII-KFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSE 504
           AY            NG++ F+  +++   F+ +Y+ +   +++ +G+KL+F+T++  P E
Sbjct: 464 AYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRWYIPVE 523

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  282 bits (721), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 167/498 (33%), Positives = 264/498 (53%), Gaps = 8/498 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
              NL + L  R + L+ LG  +GTGL +G+ S L   GP+ LF++++    ++  V+ +
Sbjct: 42  DENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFVIISFIVYPVMNT 101

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L+EM  + P         +RYVDP+ GFAAGWNY   Y+I+++  L+A   V+ YW    
Sbjct: 102 LAEMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSAAAGVVQYWTDKV 161

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  VK++GE E      K++ ++ + I  ++I  GGAP+H   
Sbjct: 162 HVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIVIFFGGAPSHDRL 221

Query: 208 GFRYWRESGALPY-LVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKKTIPK 265
           GFRYW   G   Y + GG TG+FL  W  +++S F F +  E+IG+   E  + ++ I K
Sbjct: 222 GFRYWNNPGPFAYHITGGNTGRFLDIWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEK 281

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISSSGIKVLP 322
           +S    +RI F Y+     +G  +S  + KL+ A ++D   A +SPFV  IS++GI VL 
Sbjct: 282 ASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLN 341

Query: 323 NFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGF 382
           + +NA +L    SSAN+ +Y  SR +  LAK G APK+F  +NR  VP       + +  
Sbjct: 342 HIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSC 401

Query: 383 LAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQ 442
           L Y+N   S+A VF+++++  ++ G + W  I I Y+ + +AI    +  + +PF+   Q
Sbjct: 402 LTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIFYNNL-YERVPFKSALQ 460

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIKF-HYKTFITSYIGVFANILMVIGYKLYFKTKFVK 501
           PY  Y            NGY  FI K+ +   F+ +YI +    L+ +G+K++FKT++  
Sbjct: 461 PYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIFFLLYLGHKIWFKTRWYI 520

Query: 502 P-SEISFRTRNEHEGEEA 518
           P  EI   T      EEA
Sbjct: 521 PFREIDVITGLADAEEEA 538

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  282 bits (722), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 159/492 (32%), Positives = 262/492 (53%), Gaps = 7/492 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           ++ ++ R LK R + ++ LG  +GTGL IG  + LA  GP+   +AYLF G+++  V  S
Sbjct: 62  EHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQS 121

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   FS +  R++ PA G A G+ YFL +    +  L+  G +I +W    
Sbjct: 122 LGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFKV 181

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VK++GE E  +   K+L L+   I  L I CG A      
Sbjct: 182 PLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCIVCG-AGKTGPI 240

Query: 208 GFRYWRESGAL-PYLVGGGTG--KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  GA+ P ++   TG  +FLGW + ++ + F + G+E++GI  GE ANP+K +P
Sbjct: 241 GFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 300

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V  RI   Y+  +F +GL + P N   + +  +  ++SPF+I I ++G +VLP+ 
Sbjct: 301 RAIRKVLIRILLFYIGSLFFIGLTV-PYNDPKLTSTDSYVSSSPFIITIQNAGTRVLPHI 359

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L  IIS+ N+++Y+ SR L+ +AK+G APK         VP +  +  S  G L+
Sbjct: 360 FNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLS 419

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           YM      A  F+++ +   V G   W  I  +++ + +A+K +GIS DD+P++  + P+
Sbjct: 420 YMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPW 479

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV-KPS 503
            AY             G+ +F   F  + F+ +YI V   ++    +++YF+ + + K  
Sbjct: 480 LAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLE 539

Query: 504 EISFRT-RNEHE 514
           ++   T R E E
Sbjct: 540 DVDIDTDRREIE 551

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  281 bits (718), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 168/493 (34%), Positives = 265/493 (53%), Gaps = 7/493 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K G + R+LK R + ++ LG  +GTGLIIG G  LA  GP+   I+YLF G+++  V  S
Sbjct: 62  KGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQS 121

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+F P+   FS +  R++ PA G   G+ Y+L +    +  L+  G +I YW    
Sbjct: 122 LGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDAV 181

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VKY+GE E  +   K++ L+        I CG   +    
Sbjct: 182 PLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPI 241

Query: 208 GFRYWRESGAL-PYLV--GGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           GFRYWR  GA  P ++      G+FLGW + ++ + F + G+E++GI  GE ANP++ +P
Sbjct: 242 GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVP 301

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           ++   V  RI   Y+  +F +GL + P N   + +  T  ++SPF+I+I +SG KVLP+ 
Sbjct: 302 RAIKKVVVRILVFYILSLFFIGLLV-PYNDPKLDSEGTFVSSSPFMISIENSGTKVLPDI 360

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
            NA +L+ I+S+ N+++YI SR LY L+K+  AP+    V +  VP    ++ S  GFLA
Sbjct: 361 FNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLA 420

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           ++ T   +  VF+++ +   V G   W  I +++I + +AIK +GIS DD+P+R    P+
Sbjct: 421 FLETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPF 480

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFV---K 501
            AY             G+ AF   F    FI +YI VF  I + + ++++FK +FV   +
Sbjct: 481 LAYYASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQ 540

Query: 502 PSEISFRTRNEHE 514
             +I    R+  E
Sbjct: 541 DVDIDSDRRDIEE 553

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  280 bits (716), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 173/481 (35%), Positives = 257/481 (53%), Gaps = 6/481 (1%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + LK R + +LTL    GTGL + SG  L K GP+ L IAYLF G ++     +++E
Sbjct: 48  KLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAE 107

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           +ASF P       +  +++D + GF  GW     Y+ ++   L+A  +++ YW  D    
Sbjct: 108 VASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYW-TDVSPA 164

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   ++++GE+E +    KL+++ I+ I+ L+I  GG       GF 
Sbjct: 165 VFITVFGILFVVTNIYTIRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKGQERLGFH 224

Query: 211 YWRESGALP-YLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YWRE G    YLVGG  GKF+G+WA +   ++ + G + I I+ GET N +  I   + N
Sbjct: 225 YWREPGPFANYLVGGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRHAIFHGAKN 284

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           VF RI  LY+  VFIL L I P N KL+   +  A +SPFVIA++ +GIKVLP+ VNA +
Sbjct: 285 VFLRIIVLYLVTVFILTL-IVPYNDKLIATGTGTARSSPFVIAMNRAGIKVLPHIVNALI 343

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L    S+ N  I   SR L+ LA    APKIFL  ++  +P VG +  S    LAYM+  
Sbjct: 344 LTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISSFLPLAYMSCS 403

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAYXX 449
           KS+ATVF +    VS   +L W  I   +I+ DRA+KA+G S  D+P+     P+AA+  
Sbjct: 404 KSSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYSTPMGPFAAWFS 463

Query: 450 XXXXXXXXXXNGYNAFII-KFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSEISFR 508
                      G+  FI   F  ++F T Y  +   I +   +KL+ KTK+++P E+   
Sbjct: 464 GIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTKYLRPHEVDLE 523

Query: 509 T 509
           +
Sbjct: 524 S 524

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  275 bits (704), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 172/481 (35%), Positives = 256/481 (53%), Gaps = 7/481 (1%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + LK R + +LTL    GTGL + SG  L K GP+ + IAY+  G ++     +++E
Sbjct: 45  KLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIAIAE 104

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           +ASF P       +  +++D A GF  GW     Y+ ++   L+A  +V+ YW  D    
Sbjct: 105 VASFMPATGATIRHSEQFIDEAVGFTFGW--ISTYSSLMPGELSATAVVMTYW-TDLSPA 161

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   ++++GEIE      KL ++ I+ IT L+I  GG       GF 
Sbjct: 162 IFITIFGVLFILTNIYTIRFYGEIEYFFGWLKLALIAILIITGLVIDLGGT-KQERLGFH 220

Query: 211 YWRESGAL-PYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YWR  G    YLVGG TGKF+G+WA +   ++ + G + I I+ GET N +  I   + N
Sbjct: 221 YWRNPGPFAEYLVGGDTGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGAKN 280

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           VF RI  LY+  VF+L L I P N KL+   S +A +SPFVIA+  +GIKVLP+ VNA +
Sbjct: 281 VFVRIILLYLITVFVLTL-IVPYNDKLIATGSGNARSSPFVIAMERAGIKVLPHIVNALI 339

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L    S+ N  I   SR L+ LA    APKIFL  ++  +P VG +  S    LAYM+  
Sbjct: 340 LTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGVLFISSFLPLAYMSCS 399

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAYXX 449
           +S+ATVFS+    VS   +L W  I   +I+ DRA++A+G S  D+P+     PYAA+  
Sbjct: 400 ESSATVFSWFQELVSSNTLLRWILISANHIHMDRALRAQGYSRKDLPYSTTIAPYAAWFS 459

Query: 450 XXXXXXXXXXNGYNAFII-KFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSEISFR 508
                      G+  FI   F  ++F + Y  +   I +   +KL+ KT++++P E+  +
Sbjct: 460 GIMSFIFLLTGGFYNFIHGNFDIESFFSRYFIIPLAIALFTFWKLFKKTRYLRPHEVDLQ 519

Query: 509 T 509
           +
Sbjct: 520 S 520

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  276 bits (706), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 162/481 (33%), Positives = 258/481 (53%), Gaps = 14/481 (2%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L + LK R V L+ LG  +GTGL +G+ S L   GP  LFIAY    S++  ++ ++ EM
Sbjct: 75  LKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEM 134

Query: 92  ASFAPMDKGFSG-----YLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             + P D   S       + RYVD +  FA GWNYF  Y I+++A  TA   V+ YW   
Sbjct: 135 VCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVVEYWTLA 194

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N  +VKYFGE E      K+L ++ + I   I+  GG P+H  
Sbjct: 195 VPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFWGGGPSHDR 254

Query: 207 TGFRYWRESGALPYLVGGGT-GKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKKTIP 264
            GFRYW+  GA  + V  G+ G FL  ++ +++  F F +G E++ +   E ++ ++ I 
Sbjct: 255 LGFRYWKNPGAFAHHVTDGSLGNFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRNIA 314

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAIS---PVNSKLVHAHSTDANASPFVIAISSSGIKVL 321
           K+S    +R+ F Y+ G   +G+ ++   PV +  +  ++  A +SPFVI I ++GI+VL
Sbjct: 315 KASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIEVL 374

Query: 322 PNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLG 381
           P+ +NA +L    SS N  ++  SR L+ +A++G APKIF  +N++ VP +  +  +L+ 
Sbjct: 375 PHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTLIS 434

Query: 382 FLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWF 441
            LAY+N   SAA VF+++++  ++ G L W    IAY+ + +AI    +  D +PF+ W 
Sbjct: 435 CLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAIFYNNL-YDRMPFKTWG 493

Query: 442 QPYAAYXXXXXXXXXXXXNGYNAFIIKF-HYKTFITSYIGVFANILMVIGYKLY--FKTK 498
           QPY               NGY  FI KF +   FI +YI +   + + +G+K+Y  FK  
Sbjct: 494 QPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKVYNHFKND 553

Query: 499 F 499
           +
Sbjct: 554 Y 554

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  274 bits (700), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 167/505 (33%), Positives = 262/505 (51%), Gaps = 24/505 (4%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
            G L + L  R + L+ LG A+GTGL +G+ S L   GP  LFI+Y+   ++L  ++ + 
Sbjct: 53  EGKLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAF 112

Query: 89  SEMASFAPMDK-----GFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW 143
            EM  + P +        S  ++RYVDP+  FA GWNYF  Y I+++A  TA   V+ YW
Sbjct: 113 GEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYW 172

Query: 144 RPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPN 203
                               N  AVKY+GE E      K+L +V + I   I+  GG PN
Sbjct: 173 TDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPN 232

Query: 204 HTTTGFRYWRESGALPY-LVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKK 261
           H   GFRYW+  G   + + GG  G FL  ++ +++  F F +G E+I +   E  + ++
Sbjct: 233 HDRLGFRYWKNPGGFAHHITGGNLGNFLDVYSGIIKGAFAFILGPELIALASSECKDQRR 292

Query: 262 TIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISSSGI 318
            I K+S    +R+ F Y+ G   + + ++  +  L  A ++    A +SPFVI I ++GI
Sbjct: 293 NIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNAGI 352

Query: 319 KVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGS 378
           K+LP+ +NA +L    S+ N  ++  SR L  +A +G APKIF  +NRF VP V     +
Sbjct: 353 KILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTFSA 412

Query: 379 LLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
           L+  LAY+N   S A VF++ T+  ++ G + W   L+AY+ + +AIK  G+  + +P+ 
Sbjct: 413 LISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYNGLE-NRLPYA 471

Query: 439 MWFQPYAAYXXXXXXXXXXXXNGYNAFIIKF-HYKTFITSYIGVFANILMVIGYKLYFKT 497
             FQ Y  +            NGY  FI +F +   FI +YI +   +++ IG+K+Y + 
Sbjct: 472 PRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYTRD 531

Query: 498 --KFVKP----------SEISFRTR 510
             K+  P          +EI  RTR
Sbjct: 532 FKKWWYPVEEIDVVTGLTEIEERTR 556

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  271 bits (694), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 165/478 (34%), Positives = 250/478 (52%), Gaps = 12/478 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + L+ R V L+ LG A+GTGL++G+ S L   GP  LFI+Y+   +++  ++ +L E
Sbjct: 105 KLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGE 164

Query: 91  MASFAPMDKGFSG-----YLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRP 145
           M  F P D   S       + RYVDP+ GFA GWNYF  Y I+++A  TA   V+ YW  
Sbjct: 165 MVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYWTT 224

Query: 146 DXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHT 205
                             NF AVK +GE E      K+L +V + I   I+  GG PNH 
Sbjct: 225 AVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHD 284

Query: 206 TTGFRYWRESGALPY-LVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKKTI 263
             GFRYW+  GA  + L GG  G F   +  +++  F F +G E++ +   E A+ ++ I
Sbjct: 285 RLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNI 344

Query: 264 PKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISSSGIKV 320
            K+S    +R+ F YV G   + + +   +  LV+A +     A +SPFVI I ++GIKV
Sbjct: 345 AKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAGIKV 404

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LP+ +N  +L    S+AN  ++  +R L  +A+ G APK    +N++ VP V      L 
Sbjct: 405 LPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVSFLC 464

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMW 440
             LAY+N   S A VF++ ++  ++ G L W    IAY+ + +AI   G+  D +PF+ W
Sbjct: 465 SCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-YDRLPFKTW 523

Query: 441 FQPYAAYXXXXXXXXXXXXNGYNAFIIKF-HYKTFITSYIGVFANILMVIGYKLYFKT 497
            QPY  +            NGY  FI K+     FI +YI +   +++  G+KLY +T
Sbjct: 524 GQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLYTRT 581

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  270 bits (690), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 160/513 (31%), Positives = 262/513 (51%), Gaps = 5/513 (0%)

Query: 8   VVLERPASGXXXXXXXXXXXKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGP 67
           +  ER               +   + R+LK R + ++ LG  +GTGLIIG G  LA  GP
Sbjct: 42  ITTERKVEDDAAKETESSPQERREVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGP 101

Query: 68  ISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAI 127
           +   I+YLF G+++  V  SL EM +F P+   FS +  R++ PA G   G+ Y+L +  
Sbjct: 102 VGALISYLFMGTVIYSVTQSLGEMVTFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCF 161

Query: 128 VLSANLTAFGLVIGYWRPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLV 187
             +  L+  G VI YW                    N   VKY+GE E  +   K++ L+
Sbjct: 162 TFALELSVLGKVIQYWTEAVPLAAWIVIFWCLLTSMNMFPVKYYGEFEFCIASIKVIALL 221

Query: 188 IVYITCLIITCGGAPNHTTTGFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFM 244
              I    + CG   +    GFRYWR  GA  P ++      G+FLGW + ++ + F + 
Sbjct: 222 GFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQ 281

Query: 245 GSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDA 304
           G+E++GI  GE ANP+K +P++   V  RI   Y+  +F +GL + P N   + +     
Sbjct: 282 GTELVGITAGEAANPRKALPRAIKKVVVRILVFYILSLFFIGLLV-PYNDPKLDSDGIFV 340

Query: 305 NASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLV 364
           ++SPF+I+I +SG KVLP+  NA +L+ I+S+ N+++YI SR LY L+K+  AP+    V
Sbjct: 341 SSSPFMISIENSGTKVLPDIFNAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNV 400

Query: 365 NRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRA 424
            R  VP    ++ S+ GFLA++     +   F+++ +   V G   W  I  ++I + +A
Sbjct: 401 TRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQA 460

Query: 425 IKAKGISIDDIPFRMWFQPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFAN 484
           I+ +GIS DD+P++    P+ AY             G+ AF   F    F+ +YI +F  
Sbjct: 461 IRKRGISRDDLPYKAQMMPFLAYYASFFIALIVLIQGFTAFAPTFQPIDFVAAYISIFLF 520

Query: 485 ILMVIGYKLYFKTKFV-KPSEISFRTRNEHEGE 516
           + + + ++++FK + + K  +I   +      E
Sbjct: 521 LAIWLSFQVWFKCRLLWKLQDIDIDSDRRQIEE 553

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  267 bits (683), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 148/461 (32%), Positives = 241/461 (52%), Gaps = 8/461 (1%)

Query: 62  LAKGGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNY 121
           LA  GP+   I+Y+F G+++  V  SL EMA+F P+   FS +  R++ PA G   G+ Y
Sbjct: 20  LAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMY 79

Query: 122 FLKYAIVLSANLTAFGLVIGYWRPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVF 181
           +L +    +  L+  G +I YW                    N   VKY+GE E  +   
Sbjct: 80  WLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIASI 139

Query: 182 KLLVLV--IVYITCLIITCGGAPNHTTTGFRYWRESGAL-PYLVGG--GTGKFLGWWACV 236
           K++ L+  I+Y  C++  CG        GFRYWR  GA  P ++      G+FLGW + +
Sbjct: 140 KVIALLGFIIYSFCMV--CGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSL 197

Query: 237 VQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKL 296
           + + F + G+E++GI  GE ANP+K +P++   V  RI   Y+  +F +GL + P N   
Sbjct: 198 INAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLV-PYNDPK 256

Query: 297 VHAHSTDANASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGA 356
           + +  +  +ASPF+I+I +SG KVLP+  NA +L+ I+S+ N+++YI SR LY L+K+  
Sbjct: 257 LDSDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDL 316

Query: 357 APKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILI 416
           AP+   +V +  VP    +  S+ GFLA++ T   +   F+++ +   V G   W  I  
Sbjct: 317 APRFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISF 376

Query: 417 AYINYDRAIKAKGISIDDIPFRMWFQPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFIT 476
           ++I + +AI  +GIS +D+P++    PY AY             G+ AF   F    F+ 
Sbjct: 377 SHIRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVA 436

Query: 477 SYIGVFANILMVIGYKLYFKTKFVKPSEISFRTRNEHEGEE 517
           +YI VF  + +   ++L+FK   +   +      +  E EE
Sbjct: 437 AYISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEE 477

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  266 bits (681), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 156/478 (32%), Positives = 252/478 (52%), Gaps = 12/478 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + L+ R + L+ LG  +GTGL +G+ S L+  GP  L  +Y+    ++  V+ +L E
Sbjct: 48  TLKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNALGE 107

Query: 91  MASFAP---MDKG--FSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRP 145
           M  + P    D G   S  ++RY DP+ GFA GWNY+  Y I+++A  TA   V+ YW  
Sbjct: 108 MVCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTT 167

Query: 146 DXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHT 205
                             NF  VK++GE E    + K+L +V +     I+  GG P+H 
Sbjct: 168 VVPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHD 227

Query: 206 TTGFRYWRESGALPY-LVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKKTI 263
             GFRYW++ GA  Y +  G TG+FL  W  V++  F F +G E++ +   E  + ++ I
Sbjct: 228 RLGFRYWQKPGAFAYHITTGNTGRFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRRNI 287

Query: 264 PKSSMNVFFRIGFLYVFGVFILGLAIS---PVNSKLVHAHSTDANASPFVIAISSSGIKV 320
            K+S    +R+ F YV     +G+ ++   PV    + +    A +SPFVIAI ++ IK+
Sbjct: 288 EKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHIKI 347

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LP+ +NA +L    SS N+ ++  SR L  +A+DG APK+F  +NR  VP       +  
Sbjct: 348 LPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSAAF 407

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMW 440
             LAY+N    +A  F++ ++  ++ G + W  I +AY+ + +AI  +G+  D +PF+  
Sbjct: 408 SCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YDRVPFKSP 466

Query: 441 FQPYAAYXXXXXXXXXXXXNGYNAFIIKFHY-KTFITSYIGVFANILMVIGYKLYFKT 497
           FQPY  Y            NGY  FI +F     F+ +YI +   +++ +G+K+Y +T
Sbjct: 467 FQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLWVGHKIYTRT 524

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  268 bits (686), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 164/478 (34%), Positives = 248/478 (51%), Gaps = 12/478 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + L+ R V L+ LG A+GTGL++G+ S L   GP  LFI+Y+   +++  ++ +L E
Sbjct: 109 KLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGE 168

Query: 91  MASFAPMDKGFSG-----YLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRP 145
           M  F P D   S       + RYVD + GFA GWNYF  Y I+++A  TA   V+ YW  
Sbjct: 169 MVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTT 228

Query: 146 DXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHT 205
                             N  AVK +GE E      K+L +V + I   I+  GG PNH 
Sbjct: 229 AVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHD 288

Query: 206 TTGFRYWRESGALPY-LVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKKTI 263
             GFRYW+  GA  + L GG  G F   +  +++  F F +G E++ +   E A+ ++ I
Sbjct: 289 RLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNI 348

Query: 264 PKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISSSGIKV 320
            K+S    +R+ F YV G   + + +   +  LV+A +     A +SPFVI I ++GIKV
Sbjct: 349 SKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQNAGIKV 408

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LP+ +N  +L    S+AN  ++  +R L  +A+ G APK    +NR+ VP V      L 
Sbjct: 409 LPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVGVSFLC 468

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMW 440
             LAY+N   S A VF++ ++  ++ G L W    IAY+ + +AI   G+  D +PF+ W
Sbjct: 469 SCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGL-FDRLPFKTW 527

Query: 441 FQPYAAYXXXXXXXXXXXXNGYNAFIIKF-HYKTFITSYIGVFANILMVIGYKLYFKT 497
            QPY  +            NGY  FI K+     FI +YI +   +++  G+KLY +T
Sbjct: 528 GQPYTVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLYTRT 585

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  267 bits (682), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 160/481 (33%), Positives = 259/481 (53%), Gaps = 12/481 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
             G+L + LK R + ++ LG A+GTGL +G+ S LA  GP  LFI+Y+   S++  ++  
Sbjct: 73  NEGSLQQGLKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYIIISSVVYPIMCG 132

Query: 88  LSEMASFAPMD----KGFSGYL-NRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGY 142
             EM  + P +     G + +L  RYVD + GFA  WNY+  Y I+++A  TA   V+ Y
Sbjct: 133 FGEMVCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAAECTAASGVVEY 192

Query: 143 WRPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAP 202
           W                    NF  VKY+GE E      K+L +V + I   I+  GG P
Sbjct: 193 WTVAVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLIILSFILFWGGGP 252

Query: 203 NHTTTGFRYWRESGAL-PYLVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPK 260
           NH   GFRYW+  GA   +++ GG G+FL  ++ V++  F F +G E++ +   E  + +
Sbjct: 253 NHDRLGFRYWQRPGAFTEHIMKGGFGRFLDIYSGVIKGGFAFILGPELVCLTSAECEDQR 312

Query: 261 KTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISSSG 317
           + I K++    +R+ F YV G   + + ++  +  LV A ++    A +SPFVI I ++G
Sbjct: 313 RNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNAG 372

Query: 318 IKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTG 377
           I+VLP+ +NA +L    S+ N  ++  +R L  +A++G AP++F  +NRF VP V     
Sbjct: 373 IRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKINRFGVPYVAISLS 432

Query: 378 SLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
             L  LA++N   S A VF++ ++  ++ G + W    +AYI + +AI   G+  D +PF
Sbjct: 433 GGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKAIFFNGM-YDRLPF 491

Query: 438 RMWFQPYAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYFK 496
           + W QPYA Y            NGY  FI K +    F+ +YI +   +++ +G+KL+ +
Sbjct: 492 KTWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLWTR 551

Query: 497 T 497
           T
Sbjct: 552 T 552

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  267 bits (683), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 171/501 (34%), Positives = 259/501 (51%), Gaps = 16/501 (3%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + L+ R V L+ LG A+GTGL++G+ S L   GP  LFI+Y+   +++  ++ +L E
Sbjct: 104 KLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYPIMCALGE 163

Query: 91  MASFAPMDKGFSG-----YLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRP 145
           M  F P D   S       + RYVD + GFA GWNYF  Y I+++A  TA   V+ YW  
Sbjct: 164 MVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWTT 223

Query: 146 DXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHT 205
                             NF AVK +GE E      K+L +V + I   I+  GG P H 
Sbjct: 224 AVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHD 283

Query: 206 TTGFRYWRESGALPY-LVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKKTI 263
             GFRYW+  GA  + L GG  G F   +  +++  F F +G E++ +   E A+ ++ I
Sbjct: 284 RLGFRYWQHPGAFAHHLTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNI 343

Query: 264 PKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISSSGIKV 320
            K+S    +R+ F YV G   + + +   +  LV+A +     A +SPFVI I ++GIKV
Sbjct: 344 AKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNAGIKV 403

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LP+ +N  +L    S+AN  ++  +R L  +A+ G APK    +NR+ VP V      L 
Sbjct: 404 LPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAASFLC 463

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMW 440
             LAY+N   S A VF++ ++  ++ G L W    IAY+ + +AI   G+  D +PF+ W
Sbjct: 464 SCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFYNGL-YDRLPFKTW 522

Query: 441 FQPYAAYXXXXXXXXXXXXNGYNAFIIKF-HYKTFITSYIGVFANILMVIGYKLYFKT-- 497
            QPY  +            NGY  FI K+     FI +Y+ +   +++ +G+KLY +T  
Sbjct: 523 GQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIFLVLWLGHKLYTRTWH 582

Query: 498 -KFVKPSEISFRTRNEHEGEE 517
             ++  SEI   TR   E EE
Sbjct: 583 QWWLPVSEIDV-TRGLVEIEE 602

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  264 bits (675), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 167/504 (33%), Positives = 260/504 (51%), Gaps = 15/504 (2%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           +  L + LK R + L+ LG  +GTGL +G+ S L   GP  LF +Y     ++  V+ +L
Sbjct: 48  DHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNAL 107

Query: 89  SEMASFAPMDKGFSGY-----LNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW 143
            EM  + P D   SG      + RYVDP+ GFA GWNY+  Y I+++A  TA   V+ YW
Sbjct: 108 GEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYW 167

Query: 144 RPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPN 203
                               NF AVK++GE E      K+L ++ +     I+  GG P+
Sbjct: 168 TTAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPH 227

Query: 204 HTTTGFRYWRESGALPY-LVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKK 261
           H   GFRYW++ GA  Y +  G TG+FL  W  V++  F F +G E++ +   E  + ++
Sbjct: 228 HDRLGFRYWQKPGAFAYHITSGNTGRFLDIWTGVIKGGFAFILGPELVALTSAEAQDARR 287

Query: 262 TIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISSSGI 318
            I K+S    +R+ F YV     +G  ++  +  L  A       A +SPFVI I ++GI
Sbjct: 288 NIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNAGI 347

Query: 319 KVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGS 378
           KVLP+ +N  +L    SS N+ ++  SR L  ++++G APKI   VNRF VP       S
Sbjct: 348 KVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVALTS 407

Query: 379 LLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
           LL  +AY+N   S A VF++ ++  ++ G + W  I IAY+ + +AI  + +  + +PF+
Sbjct: 408 LLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERVPFK 466

Query: 439 MWFQPYAAYXXXXXXXXXXXXNGYNAFI-IKFHYKTFITSYIGVFANILMVIGYKLY--- 494
             FQPY  +            NGY  FI   ++   FI +Y+ +   +++ IG+KL+   
Sbjct: 467 TPFQPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLVLWIGHKLWTRT 526

Query: 495 FKTKFVKPSEISFRTRNEHEGEEA 518
           +KT  +   EI   T  +   EE+
Sbjct: 527 WKTWAIPVPEIDVTTGLKEIEEES 550

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  267 bits (682), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 162/478 (33%), Positives = 250/478 (52%), Gaps = 12/478 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + L+ R V L+ LG A+GTGL++G+ S L   GP  LFI+Y+   +++  ++ +L E
Sbjct: 161 RLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGE 220

Query: 91  MASFAPMDKGFSG-----YLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRP 145
           M  F P D   S       + RYVD + GFA GWNY+  Y I+++A  TA   V+ YW  
Sbjct: 221 MVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWTT 280

Query: 146 DXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHT 205
                             NF AVK +GE E      K+L +V + I   I+  GG P H 
Sbjct: 281 AVPKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHD 340

Query: 206 TTGFRYWRESGALPY-LVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKKTI 263
             GFRYW+  G+  + L GG  G F   +  +++  F F +G E++ +   E A+ ++ I
Sbjct: 341 RLGFRYWQHPGSFAHHLAGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNI 400

Query: 264 PKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISSSGIKV 320
            K+S    +R+ F YV G   + + +   +  LV+A +     A +SP+VI I ++GIKV
Sbjct: 401 AKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAGIKV 460

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LP+ +N  +L    S+AN  ++  +R L  +A+ G APK    +NRF VP V      L 
Sbjct: 461 LPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVSFLC 520

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMW 440
             LAY+N   S A VF++ ++  ++ G L W    IAY+ + +AI   G+  D +PF+ W
Sbjct: 521 SCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKAIFFNGL-YDRLPFKTW 579

Query: 441 FQPYAAYXXXXXXXXXXXXNGYNAFIIKF-HYKTFITSYIGVFANILMVIGYKLYFKT 497
            QPY  +            NGY  FI K+ +   FI +YI +   +++ +G+KLY +T
Sbjct: 580 GQPYTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYTRT 637

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  263 bits (672), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 154/476 (32%), Positives = 246/476 (51%), Gaps = 12/476 (2%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L + L+ R + L+ LG  +GTGL +G+ S L+  GP  L  +Y+    ++  V+ SL EM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 92  ASFAPMDKGFSG-----YLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             F P   G SG      + RY DP+ GFA GWNY+  Y I+++A  TA   V+ YW   
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            NF  VK +GE E    + K+L +V +     I+  GG P H  
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 207 TGFRYWRESGALPY-LVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKKTIP 264
            GFRYW+  GA  Y +  G TG+FL  W  V++  F F +G E++ I   E  + ++ I 
Sbjct: 285 LGFRYWQHPGAFAYHITTGNTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDARRNIE 344

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAIS---PVNSKLVHAHSTDANASPFVIAISSSGIKVL 321
           K+S    +R+ F YV     +G+ +S   PV    +      A +SPFVIAI ++ IKVL
Sbjct: 345 KASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIKVL 404

Query: 322 PNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLG 381
           P+ +NA +L    SS N+ ++  SR L  +A+DG AP+I   +NR  VP       +   
Sbjct: 405 PHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAAFS 464

Query: 382 FLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWF 441
            LA++N    +A  F++ ++  ++ G + W  I +AY+ + +A+  +G+  + +PF+   
Sbjct: 465 CLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPFKSPL 523

Query: 442 QPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKT 497
           QPY  Y            NGY +F + ++   F+ +YI +   +++ +G+K+Y +T
Sbjct: 524 QPYGTYFFIVVVSLICLTNGYASF-VNWNASDFVAAYITLPIFVVLWVGHKIYTRT 578

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  261 bits (668), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 159/480 (33%), Positives = 250/480 (52%), Gaps = 12/480 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + LK R V L+ LG A+GTGL +G+ S L   GP  LFI+Y    S++  ++  + E
Sbjct: 74  ELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGE 133

Query: 91  MASFAP----MDKGFSGYL-NRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRP 145
           M  + P      +GF+ YL  +YVD + GFA  WNY+  Y I+++A  TA   V+ YW  
Sbjct: 134 MVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWTT 193

Query: 146 DXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHT 205
                             NF AVK++GE E      K+L +V + I   I+  GG PNH 
Sbjct: 194 SVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPNHD 253

Query: 206 TTGFRYWRESGALPYLVGGGT-GKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKKTI 263
             GFRYW+  G   + + GG+ G FL  +  +++  F F +G EMI +   E  + ++ I
Sbjct: 254 RLGFRYWQNPGGFAHHIRGGSFGSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQRRNI 313

Query: 264 PKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISSSGIKV 320
            K++    +R+ F Y+ G   + + ++  +  L +A + +   A +SPFVI I ++GIKV
Sbjct: 314 AKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNAGIKV 373

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LP+ +NA +L    S+ N  ++  SR L  +A++G AP+IF  VNR+ VP       S +
Sbjct: 374 LPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLSSAI 433

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMW 440
             LAY+N   S A VF++ ++   + G + W  + IAYI + +AI   G+    +P+   
Sbjct: 434 SCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGMQ-SRLPYTAR 492

Query: 441 FQPYAAYXXXXXXXXXXXXNGYNAFIIKF-HYKTFITSYIGVFANILMVIGYKLYFKTKF 499
             PY  Y            NGY  FI +F   K F+ +YI +    ++ IG+++Y +  F
Sbjct: 493 GMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHRVYRRKIF 552

>Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON}
           YBR132C (REAL)
          Length = 598

 Score =  260 bits (664), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 157/502 (31%), Positives = 251/502 (50%), Gaps = 18/502 (3%)

Query: 34  RELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFSLSEMA 92
           R+L+ R V L+ +   +GT L +  G AL +GGP SL +A+ L+   +LC+ + S +EM 
Sbjct: 88  RKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITV-STAEMV 146

Query: 93  SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXXX 152
            F P+   F     + VD +F   A WN++    + +   + +   +I YWR D      
Sbjct: 147 CFFPVSSPFLRLATKCVDDSFAVMASWNFWFLECVQIPFEIVSVNTIIHYWRDDYSAGIP 206

Query: 153 XXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRYW 212
                      +  AVKY+GE+E  L  FK+++ + ++I   I   GG P H   GFR +
Sbjct: 207 LAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFITMLGGNPKHDRYGFRNY 266

Query: 213 RESGALPYL-----VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
            ES    Y      VG  +G F G+ AC++Q+ F   G E I ++ GE   P+K +PK+ 
Sbjct: 267 GESPFKKYFPDGKDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPKAF 326

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKL---VHAHSTDANASPFVIAISSSGIKVLPNF 324
             VF R+ FL++     +G+  SP +  L   ++     A +SP+VIA+++  I++LP+ 
Sbjct: 327 KQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILPDI 386

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           VN AL+    S+ N   Y  SR  YG+A DG APK+F   NR  VP+       +   ++
Sbjct: 387 VNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVAISLVWALVS 446

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
            +    ++A V +++ + ++   ++N+  + I Y+ + RA   +  S+  +PFR W QPY
Sbjct: 447 LLQLNSNSAVVLNWLINLITASQLINFVVLCITYLFFRRAYHVQQDSLPKLPFRSWGQPY 506

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYF---KTKFV 500
            A              GY  F  K +  + F+ SY+ VF NI + +GYK  +   K KF 
Sbjct: 507 TAIIGLVSCSAMILIQGYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIWKRGKDKFK 566

Query: 501 KPSEISFRTR----NEHEGEEA 518
            P EI F         HE E +
Sbjct: 567 NPHEIDFSKELVEIENHEIESS 588

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  258 bits (659), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 169/492 (34%), Positives = 258/492 (52%), Gaps = 13/492 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + LK R + +LTL    GTGL + SG  L K GP+ L IAYLF G ++     +++E
Sbjct: 43  KLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAE 102

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           +ASF P       +  +++D + GF  GW     Y+ ++   L+A  +++ YW  D    
Sbjct: 103 VASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYW-TDISPA 159

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   ++++GE+E +    KL+++ I+ I+ L+I  GG       GF 
Sbjct: 160 VFITIFGVLFVVTNIYTIRFYGEVEYVFGWLKLILIFILIISGLVIDLGGVKGQERLGFH 219

Query: 211 YWRESGAL-PYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YWR+ G    Y+VGG  GKF+G+W+ +   ++ + G + I I+ GET N +  I   + N
Sbjct: 220 YWRDPGPFAEYIVGGSIGKFVGFWSALSSVVYSYSGIQNIAILAGETKNSRHAIYHGAKN 279

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           VF RI  LY+  VF+L L I P N  L+ + +  A +SPFVIA++ +GIKVLP+ VNA +
Sbjct: 280 VFLRIIVLYLVTVFVLTL-IVPYNDALIASGTGTAKSSPFVIAMNRAGIKVLPHIVNALV 338

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L    S+ N  I   SR L+ LA    APKIFL  ++  +P VG +  S    LAYM+  
Sbjct: 339 LTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPYVGVIFISCFLPLAYMSCS 398

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAYXX 449
           +S++TVF +    VS   +L W  I   +I  DRA+KA+G S  D+P+     PYAA+  
Sbjct: 399 ESSSTVFGWFQELVSSNTLLRWILISANHIYMDRALKAQGYSRSDLPYSTPIAPYAAWFS 458

Query: 450 XXXXXXXXXXNGYNAFII-KFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSEISF- 507
                      G+  FI   F  ++F T Y  +   I +   +KL+ KT++++P E+   
Sbjct: 459 GIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTRYLRPEEVDLA 518

Query: 508 ------RTRNEH 513
                 R   EH
Sbjct: 519 SIFDDIRENPEH 530

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  258 bits (660), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 168/530 (31%), Positives = 270/530 (50%), Gaps = 30/530 (5%)

Query: 3   EKKGTVVLERPASGXXXXXXXXXXXKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSAL 62
           EK G++   +P SG            + NL + LK   + L+ +G  +GTGL +G+ S L
Sbjct: 36  EKNGSLP-NKPQSG------------DHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTL 82

Query: 63  AKGGPISLFIAYLFTGSLLCVVIFSLSEMASFAP--MDKGFSG-----YLNRYVDPAFGF 115
            K GP  LFI+Y    +++  V+ +L+EM  F P   D+  +G        RYVD + GF
Sbjct: 83  YKCGPAGLFISYCIMSTIIYPVMNALAEMVCFLPGLPDENETGGSISTLCTRYVDSSLGF 142

Query: 116 AAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIE 175
           A GWNY   Y I+++A  TA   V+ YW                    N  AV+++G  E
Sbjct: 143 AVGWNYVYCYVILVAAECTAASGVVTYWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSE 202

Query: 176 ALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGALPY-LVGGGTGKFLGWWA 234
           A+    K+  ++ + I  +++  GG PNH   GFR+W++ GA  Y L  GG G+      
Sbjct: 203 AIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLGFRFWKDPGAWAYHLADGGAGRLSDIIT 262

Query: 235 CVVQSIFGF-MGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVN 293
            V+++ F F +G E++ +   E  + ++ I K++    +R+ F Y       G+ +S  +
Sbjct: 263 GVIRAGFAFILGPELVVLTSTEAQDSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRND 322

Query: 294 SKLVHAHSTD---ANASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYG 350
             L++A S     A +SPFVI I ++GIKVLP+ +N  +L    SS N+ +Y  +R L  
Sbjct: 323 PVLLNALSQGKPGAGSSPFVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLS 382

Query: 351 LAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILN 410
           L+++G APKIF  VNR+ VP  G    +    LAY+N   S A VF++ ++  ++ G L 
Sbjct: 383 LSQEGYAPKIFNRVNRWGVPYTGVAFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLG 442

Query: 411 WFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAYXXXXXXXXXXXXNGYNAFIIKFH 470
           W    +AY+ + +A+    +  D +PF+  FQPY  +            NGY +F + ++
Sbjct: 443 WICSGVAYLRFRKAVFFNNL-YDRLPFKTPFQPYFTWFYIILIAIICLINGYESF-VHWN 500

Query: 471 YKTFITSYIGVFANILMVIGYKLYFKT---KFVKPSEISFRTRNEHEGEE 517
           YK FI +YI +   +++ +G+K Y +T     +  SEI   T      EE
Sbjct: 501 YKDFIAAYITLPLFLILWLGHKAYTRTWSQWMISVSEIDVTTGLREIEEE 550

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  258 bits (659), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 164/492 (33%), Positives = 249/492 (50%), Gaps = 18/492 (3%)

Query: 34  RELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEMAS 93
           R LK R + L+ LGSA+GTGL IGSG AL+  GP  L IAY+     +  ++  ++EM  
Sbjct: 57  RGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYIIISFFVWSIMNQMTEMVC 116

Query: 94  FAPMDKGFSGY--LNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
             P+    S Y     Y++    F  GWN F   A+++ A +TA  L++ YW  D     
Sbjct: 117 LIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEITACALLVQYWT-DANSAI 175

Query: 152 XXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT-GFR 210
                         L VK FGE E  ++  K+L +V + I  ++I  GG P      GF 
Sbjct: 176 FISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVGIVIFFGGGPAQDHVLGFH 235

Query: 211 YWRESGAL-PYLVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKKTIPKSSM 268
           YW+  GA  P+L  G TG+FL  W  +++S F F +  E +     E   P++ +PK+  
Sbjct: 236 YWKNPGAFNPHLAEGNTGRFLAVWTAIIKSGFSFVLVPETVTSCSAECIAPRRNMPKACQ 295

Query: 269 NVFFRIGFLYVFGVFILGLAISPVNSKLVHA---HSTDANASPFVIAISSSGIKVLPNFV 325
              +R+   Y+ G  ++G+ +   N +L++A     +DA ASPFVI I  +GIK+LP+ +
Sbjct: 296 RFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAAASPFVIGIQEAGIKILPHII 355

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L    S     +Y  SR LY +A  G APKIF  VNRF  P       SL  FLAY
Sbjct: 356 NACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVNRFGTPYYSTGLASLFSFLAY 415

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYA 445
           +N  KSA+ VF+++++  ++ G ++W ++ + YI + + I A  ++ D +PFR  FQ   
Sbjct: 416 LNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVINALDLN-DRVPFRRPFQVPL 474

Query: 446 AYXXXXXXXXXXXXNGYNAFII-KFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSE 504
           AY            NGY  F+   ++   F  SY+ +   I + +    Y+K       +
Sbjct: 475 AYLTCGFFFILSLTNGYAVFVKGNWNVSDFFASYVTIGFVIFLYLVGSFYYK-------Q 527

Query: 505 ISFRTRNEHEGE 516
            +FR   E E E
Sbjct: 528 WTFRDFKEIEVE 539

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  254 bits (650), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 154/418 (36%), Positives = 228/418 (54%), Gaps = 5/418 (1%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + LK R + +LTL    GTGL + SG  L K GP+ L IAYLF G ++     +++E
Sbjct: 47  RLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAE 106

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           +ASF P       +  +++D + GF  GW     Y+ ++   L+A  +++ YW  D    
Sbjct: 107 VASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMKYW-TDVSPA 163

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   ++++GEIE +    KL+++ I+ I+ L+I  GG       GF 
Sbjct: 164 VFITVFGVLFVATNIYTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLGGVKGQERLGFH 223

Query: 211 YWRESGALP-YLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YWR+ G    YLV G  GKF+G+WA +   ++ + G + I I+ GET N +  I   + N
Sbjct: 224 YWRDPGPFANYLVAGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRYAIFHGAKN 283

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           VF RI  LY+  VF+L L I P N KL+   +  A +SPFVIA++ +GIKVLP+ VNA +
Sbjct: 284 VFLRIIVLYLVTVFVLTL-IVPYNDKLIATGTGTAKSSPFVIAMNRAGIKVLPHIVNALI 342

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L    S+ N  I   SR L+ LA    AP+IFL  ++  +P VG +  S    LAYM+  
Sbjct: 343 LTSAWSAGNLAIIEGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISSFLPLAYMSCS 402

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAY 447
           +S+ATVF +    VS   +L W  I   +I+ DRA+KA+G S  D+P      P+AA+
Sbjct: 403 ESSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCSTRIAPFAAW 460

>YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}
           AGP2High affinity polyamine permease, preferentially
           uses spermidine over putrescine; expression is
           down-regulated by osmotic stress; plasma membrane
           carnitine transporter, also functions as a low-affinity
           amino acid permease
          Length = 596

 Score =  256 bits (654), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 155/498 (31%), Positives = 249/498 (50%), Gaps = 15/498 (3%)

Query: 34  RELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFSLSEMA 92
           R+L+ R V L+ +   +GT L +  G AL +GGP SL +A+ L+   +LC+ + S +EM 
Sbjct: 86  RKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITV-STAEMV 144

Query: 93  SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXXX 152
            F P+   F     + VD +    A WN++    + +   + +   +I YWR D      
Sbjct: 145 CFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYWRDDYSAGIP 204

Query: 153 XXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRYW 212
                      +  AVKY+GE+E  L  FK+++ + ++    I   GG P H   GFR +
Sbjct: 205 LAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFTFTFITMLGGNPEHDRYGFRNY 264

Query: 213 RESGALPYL-----VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
            ES    Y      VG  +G F G+ AC++Q+ F   G E I ++ GE   P+K +PK+ 
Sbjct: 265 GESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPKAF 324

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKL---VHAHSTDANASPFVIAISSSGIKVLPNF 324
             VF R+ FL++     +G+  SP +  L   ++     A +SP+VIA+++  I++LP+ 
Sbjct: 325 KQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILPDI 384

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           VN AL+    S+ N   Y  SR  YG+A DG APKIF   NR  VP+       +   ++
Sbjct: 385 VNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTRCNRHGVPIYSVAISLVWALVS 444

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
            +    ++A V +++ + ++   ++N+  + I Y+ + RA   +  S+  +PFR W QPY
Sbjct: 445 LLQLNSNSAVVLNWLINLITASQLINFVVLCIVYLFFRRAYHVQQDSLPKLPFRSWGQPY 504

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYF---KTKFV 500
            A              GY  F  K ++ + F+ SY+ VF NI + +GYK  +   K  F 
Sbjct: 505 TAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLFSYLMVFINIGIYVGYKFIWKRGKDHFK 564

Query: 501 KPSEISF-RTRNEHEGEE 517
            P EI F +   E E  E
Sbjct: 565 NPHEIDFSKELTEIENHE 582

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  255 bits (651), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 166/503 (33%), Positives = 253/503 (50%), Gaps = 18/503 (3%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            + R LK R + L+ LG A+GTGL IG+G AL+  GP  L I+Y+     +  ++  L+E
Sbjct: 58  QMQRGLKSRHMQLIALGCAIGTGLFIGTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTE 117

Query: 91  MASFAPMDKGFSGY-LNR-YVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXX 148
           M    P+    S Y L R Y++    F  GWN F   A++  + +TA  L+I YW  D  
Sbjct: 118 MVVLTPIPGEASMYALARAYLNRPLSFMCGWNLFYAQAMIAPSEITASTLLIQYWT-DAN 176

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPN-HTTT 207
                            L VK FGE E  +++ KL+ +  + I  ++I  GG PN H   
Sbjct: 177 SAIFVSIFIVITIAVTALPVKVFGESEFWVSMIKLITITGLIILGVVIFFGGGPNQHHVL 236

Query: 208 GFRYWRESGAL-PYLVGGGTGKFLGWWACVVQSIFGFMGS-EMIGIVYGETANPKKTIPK 265
           GF YW+  GA  P++  G TGKFL  W  +++S F F+ S E +     E   P++ +P+
Sbjct: 237 GFHYWKHPGAFKPHISTGNTGKFLAVWTAIIKSGFAFILSPETLTSCSAEADRPRRNMPR 296

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHA---HSTDANASPFVIAISSSGIKVLP 322
           ++    +R+   Y+ G  ++G+ +   N  L+ A     ++A ASPFVI I   GIKVLP
Sbjct: 297 AANRFVWRLMLFYIGGALVVGVTVGYDNQNLLSAIASGQSNAAASPFVIGIKEVGIKVLP 356

Query: 323 NFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGF 382
           + +NAA+L    S+   ++Y  SR L+ +A  G APKIF  VNR+ VP    +  S   F
Sbjct: 357 HIINAAILTGAYSAGTAEMYGASRMLHSMALKGNAPKIFARVNRYGVPYYSIIVPSCFCF 416

Query: 383 LAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQ 442
           LAY+N   SA+ VF+++T+  ++ G ++W ++ I Y+ + R I    ++ D I FR  FQ
Sbjct: 417 LAYLNCSNSASQVFTWLTNISTISGFISWVFVSITYVRFRRVIDYLDLN-DRIKFRKPFQ 475

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFII-KFHYKTFITSYIGV-FANILMVIGYKLYFKTKFV 500
              AY            NGY  F    +    F  +YI + F  +L ++G   Y + +F 
Sbjct: 476 RIFAYFSGCFFVILSLTNGYAVFTKGNWSVSDFFANYITIGFVVVLFIMGTAYYKEWRFR 535

Query: 501 KPSEI------SFRTRNEHEGEE 517
              EI           +E E  E
Sbjct: 536 DMEEIRSELIPKIDMADEEESNE 558

>Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}
           complement(18362..20104) [1743 nt, 581 aa]
          Length = 580

 Score =  254 bits (649), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 153/499 (30%), Positives = 249/499 (49%), Gaps = 16/499 (3%)

Query: 34  RELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFSLSEMA 92
           R+L  R V L+ +   +GT L +  G AL  GGP  L IA+ L+   +LC+ + S +EM 
Sbjct: 69  RKLLNRHVQLIAISGVIGTALFVAIGKALYHGGPAFLLIAFALWCIPILCITV-STAEMV 127

Query: 93  SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXXX 152
           SF P+   F    ++  D +    A WN++    + +   + +   +I YWR D      
Sbjct: 128 SFLPVASPFLRLASKCADESLAVTASWNFWFLECVQIPFEIVSVNTIIHYWRDDYNAAIP 187

Query: 153 XXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRYW 212
                      +   VKY+GE+E  L  FK+++ + ++   L+   GG P H   GFRYW
Sbjct: 188 LVVQVVLYLFISIATVKYYGEMEFWLASFKIILAIGLFFFTLVTMLGGNPKHDRYGFRYW 247

Query: 213 RESGALPYLVGGGT------GKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            E     Y     T      G F G+  C++Q+ F   G E I ++ GE   P+K +PK+
Sbjct: 248 GEEPFKKYYPDNNTNGTDSLGYFQGFLTCLIQAAFTIAGGEYISMLAGEIKLPRKVLPKA 307

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKL---VHAHSTDANASPFVIAISSSGIKVLPN 323
              VF+R+  +++     LG+  SP +  L   ++     A +SPFVIA+++  I+VLP+
Sbjct: 308 FKQVFWRLTIIFLGTCLCLGIVCSPNDPSLTAAINEARPGAGSSPFVIAMNNLRIRVLPD 367

Query: 324 FVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFL 383
            VNAAL+    S+ N   Y  SR LYG+A DG APKIF   N++ VP+       L   +
Sbjct: 368 IVNAALITSAFSAGNAYTYCSSRTLYGMALDGYAPKIFTRCNKYGVPIYAVGVSLLWALI 427

Query: 384 AYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQP 443
           + +    ++A V +++ + ++   ++N+ ++ + Y+ + RA  A+   +  +PFR W QP
Sbjct: 428 SLLQLNSNSAIVLNWLVNLITASQLINFVFLCVIYLFFRRAYNAQKDKLPPLPFRSWGQP 487

Query: 444 YAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYF---KTKF 499
           Y A              GY  FI   ++ + F+  Y+ VF N+ + +GYK  +   K KF
Sbjct: 488 YTAIFGLVCAFSMIFIQGYTVFIHSLWNTRDFLFCYLMVFINVAIYLGYKFIWKRGKDKF 547

Query: 500 VKPSEISFRTR-NEHEGEE 517
           + P ++ F T   E E  E
Sbjct: 548 IDPHKVDFITDLKEIEAHE 566

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  254 bits (648), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 151/485 (31%), Positives = 248/485 (51%), Gaps = 12/485 (2%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           NG L + L  R V  + LG  +GTGL +G+   L   GP  L I+Y+   +++  ++ +L
Sbjct: 55  NGKLKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNAL 114

Query: 89  SEMASFAPMDKGFSG-----YLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW 143
            EM  + P +   S       + RYVD +  FA GWNY+  + I+++A  TA   V+ YW
Sbjct: 115 GEMVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTYW 174

Query: 144 RPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPN 203
                               NF AVKYFGE E      K+L ++ + +   I+  GG P+
Sbjct: 175 TTSVPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGGPS 234

Query: 204 HTTTGFRYWRESGALPYLVGGGT-GKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKK 261
           H   GF YW++ G   + + GG+ G FL  +  +++  F F +G E++ +   E  + ++
Sbjct: 235 HVRLGFHYWKDPGTFAHHITGGSWGSFLDIYTGIIKGAFAFILGPELVALTSSECNDQRR 294

Query: 262 TIPKSSMNVFFRIGFLYVFGVFILGLAIS---PVNSKLVHAHSTDANASPFVIAISSSGI 318
            I K+S    +R+ F Y+ G   + + ++   PV    +      A +SPFVI I ++GI
Sbjct: 295 NIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIGIQNAGI 354

Query: 319 KVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGS 378
           KVLP+ +NA +L    S+ N+ ++  SR L  +A +G+APKIF  VNRF VP       +
Sbjct: 355 KVLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGLSA 414

Query: 379 LLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
           +L  LA++N   S A VF + ++  ++ G L W   +IAY+ + +AI    +  D +PF+
Sbjct: 415 MLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNM-YDRLPFK 473

Query: 439 MWFQPYAAYXXXXXXXXXXXXNGYNAFIIKFHY-KTFITSYIGVFANILMVIGYKLYFKT 497
            + QPY  +            NGY  FI +F     F+ +YI +   +++ +G+K + + 
Sbjct: 474 TFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVGHKFWARY 533

Query: 498 KFVKP 502
           K   P
Sbjct: 534 KHAVP 538

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  253 bits (646), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 161/487 (33%), Positives = 254/487 (52%), Gaps = 12/487 (2%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
              + R LK R + L+ LG A+GTGL IGSG AL+  GP  + I+Y+     +  ++  L
Sbjct: 48  QNEMVRGLKSRHIQLIALGDAIGTGLFIGSGGALSTCGPAPILISYIVMSFFVWTIVNQL 107

Query: 89  SEMASFAPMDKGFSGY-LNR-YVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
           +EM +  P+    S Y L R YV     F  GWN F   A++  + +TA  ++I YW  D
Sbjct: 108 TEMVALIPLPGEASMYSLARMYVGRPLAFMCGWNLFYAMAMIAPSEITACAMLIQYWT-D 166

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                              L V+ FGE E  ++  KLL +V + I  ++I  GG P+   
Sbjct: 167 ANSAIFISIFIVFSVAITMLPVRVFGESEFCVSSIKLLTIVGLIIVGIVIFFGGGPSQDH 226

Query: 207 T-GFRYWRESGAL-PYLVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKKTI 263
             GF YW++ GA   +LV G TGKFL  W  +++S F F +  E +     E+A+P++ +
Sbjct: 227 ILGFHYWKKPGAFKEHLVPGSTGKFLAVWTAIIKSGFSFVLVPETVASCSAESASPRRNM 286

Query: 264 PKSSMNVFFRIGFLYVFGVFILGLAISPVNSKL---VHAHSTDANASPFVIAISSSGIKV 320
           P++     +R+   YV GV ++ + +   ++ L   +H+ +++A ASP+VI I  +GIKV
Sbjct: 287 PRACQRFVYRLALFYVAGVLVVTVVVGSDDANLLNAIHSGASNAAASPYVIGIKEAGIKV 346

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LP+ +NA +L    S    ++Y CSR L+ +A  G AP+IF  VNRF VP        L 
Sbjct: 347 LPHIINACILTSAYSCGTAELYGCSRILHSMAMKGDAPQIFAKVNRFGVPYYSTAVACLF 406

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMW 440
             LAY+N  KS++ VF+++++  ++ G ++W ++ + Y  +   I    ++ D IPFR  
Sbjct: 407 TLLAYLNCSKSSSLVFNWLSNIATISGFISWVFVSVTYTRFRTVIDKLDLN-DRIPFRRR 465

Query: 441 FQPYAAYXXXXXXXXXXXXNGYNAFII-KFHYKTFITSYIGVFANILMVIGYKLYFKT-K 498
           FQ   AY            NGY  FI   ++   F  SY+ +    ++ IG  +Y+K  +
Sbjct: 466 FQKGFAYACIAFFVLLSLTNGYAVFIKGNWNTSDFFASYVTIGFVAVLFIGSTIYYKELR 525

Query: 499 FVKPSEI 505
           F   SEI
Sbjct: 526 FRDVSEI 532

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  252 bits (643), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 163/494 (32%), Positives = 258/494 (52%), Gaps = 22/494 (4%)

Query: 34  RELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEMAS 93
           R LK R V L+ LGSA+GTGL IGSG AL+  GP  L IAY      +  V+  ++EM +
Sbjct: 53  RGLKSRHVQLIALGSAIGTGLFIGSGGALSICGPAPLLIAYAVMSLFVWSVMNQMTEMVT 112

Query: 94  FAPM--DKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
             P+  +      L  YV+    F  GWN F   A++  A +TA  L++ YW  D     
Sbjct: 113 LIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQAMIAPAEVTACALLVQYWT-DANPAI 171

Query: 152 XXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAP-NHTTTGFR 210
                         L VK FGE E  ++  K+L +V + I  ++I  GG P      GF 
Sbjct: 172 FISIFLVLSVAITMLPVKVFGESEFWVSSIKILTIVGLIIVGVVIFFGGGPAQEHVLGFH 231

Query: 211 YWRESGAL-PYLVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKKTIPKSSM 268
           YW++ GA  PYLV GGTGKFL +W  +++S F F +  E++     E   P++ +P++  
Sbjct: 232 YWKKPGAFKPYLVEGGTGKFLAFWTAIIKSGFSFVLVPEIVSSCAAEAVAPRRNMPRACK 291

Query: 269 NVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANAS---PFVIAISSSGIKVLPNFV 325
              +R+   YVFG+ ++G+ +   N +L++A ++  +++   PFVI I  +GI+VLP+ +
Sbjct: 292 RFIYRLALFYVFGILVVGVIVGYDNDRLLNAIASGQSSAAASPFVIGIKEAGIRVLPHII 351

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NAA+L    S     +Y  SR L+ +A  G AP+I   VN++ VP       SL   LAY
Sbjct: 352 NAAILTSAYSCGTGLLYGASRTLHSMACKGDAPRILTTVNKYGVPYYCTGITSLFCLLAY 411

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYA 445
           +N   S++ VF+++++  ++ G ++W  + IAYI +   I    ++ D IPFR+ +Q   
Sbjct: 412 LNCSNSSSVVFNWLSNIATISGFVSWVLVSIAYIRFRNVIDVLKLN-DRIPFRVPYQKPL 470

Query: 446 AYXXXXXXXXXXXXNGYNAFIIKFHYKT--FITSYIGVFANILMVIGYKLYFKTKFVKPS 503
           AY            NG+  F IK ++ T  F  +YI +   +++ +G  +Y+K       
Sbjct: 471 AYLAMGFFSILTLTNGFAVF-IKGNWDTSNFFAAYITLGFVLVLFVGSTIYYK------- 522

Query: 504 EISFRTRNEHEGEE 517
              +R R+  E E+
Sbjct: 523 --EWRCRDIAEIEQ 534

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  251 bits (640), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 163/481 (33%), Positives = 252/481 (52%), Gaps = 7/481 (1%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + LK R + +LTL    GTGL + SG  L K GP  +F+AY+  G ++     +++E
Sbjct: 49  RLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQIAIAE 108

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           +ASF P       +  +++D + GF  GW     Y+ ++   L+A  +V+ YW  D    
Sbjct: 109 VASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVVMRYWT-DINPA 165

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   ++++GE+E      K+++++I+ +T L+I  GGA      GF 
Sbjct: 166 VWITIFGILFVLTNIYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGA-KQERLGFH 224

Query: 211 YWRESGAL-PYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YWRE G    Y+V G  GKF+G+WA +   ++ + G + I I+ GET N +  I   + N
Sbjct: 225 YWREPGPFAEYIVKGEIGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGARN 284

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           VF RI  LY+  V +L L I P N KL+   +  A +SP+VIAI  + IK+LP+ +NA +
Sbjct: 285 VFLRIIVLYLIAVLVLTL-IVPYNDKLIATGTGTAKSSPYVIAIQRANIKILPHIINAII 343

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L    S+ N  I   SR L+ LA    APKIFL  N+  +P VG    S    L+YM+  
Sbjct: 344 LTSAWSAGNLAIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISAFLPLSYMSVS 403

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAYXX 449
            S+A VFS+    VS   +L W  I   +I+ DRA+KA+G S  D+P      P+AA+  
Sbjct: 404 SSSANVFSWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHSTCLGPFAAWFS 463

Query: 450 XXXXXXXXXXNGYNAFII-KFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSEISFR 508
                      G+  FI   F  ++F T Y  +   I++   +KL+ KTK+++P+E+   
Sbjct: 464 GIMSLIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIILFTFWKLFKKTKYLRPAEVDLE 523

Query: 509 T 509
           +
Sbjct: 524 S 524

>Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON}
           YBR132C (REAL)
          Length = 597

 Score =  252 bits (643), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 153/498 (30%), Positives = 249/498 (50%), Gaps = 15/498 (3%)

Query: 34  RELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFSLSEMA 92
           R+L+ R V L+ +   +GT L +  G AL +GGP SL +A+ L+   +LC+ + S +EM 
Sbjct: 87  RKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITV-STAEMV 145

Query: 93  SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXXX 152
            F P+   F     + VD +    A WN++    + +   + +   +I YWR D      
Sbjct: 146 CFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYWRDDYSAGIP 205

Query: 153 XXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRYW 212
                      +  AVKY+GE+E  L  FK+++ + ++I   I   GG P H   GFR +
Sbjct: 206 LAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFITMLGGNPRHDRYGFRNY 265

Query: 213 RESGALPYL-----VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
            ES    Y      VG  +G F G+ AC++Q+ F   G E I ++ GE   P+K +PK+ 
Sbjct: 266 GESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPKAF 325

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKL---VHAHSTDANASPFVIAISSSGIKVLPNF 324
             VF R+ FL++     +G+  SP +  L   ++     A +SP+VIA+++  I++LP+ 
Sbjct: 326 KQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILPDI 385

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           VN AL+    S+ N   Y  SR  YG+A DG APK+F   NR  VP+       +   ++
Sbjct: 386 VNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKLFTRCNRHGVPIYSVGISLIWALVS 445

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
            +    ++A V +++ + ++   ++N+  + I Y+ + RA + +  S+  +PFR W QPY
Sbjct: 446 LLQLNSNSAVVLNWLINLITASQLINFVVLCIIYLFFRRAYRVQQDSLPRLPFRSWGQPY 505

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYF---KTKFV 500
            A              GY  F  K +  + F+ SY+ VF NI + +GYK  +   K    
Sbjct: 506 TAIIGLVSCSAMILIQGYTVFFPKLWSTQDFLFSYLMVFINIGIYVGYKFIWKRGKDSLK 565

Query: 501 KPSEISF-RTRNEHEGEE 517
            P +I F +   E E  E
Sbjct: 566 NPHDIDFSKELTEIENHE 583

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  251 bits (641), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 136/408 (33%), Positives = 232/408 (56%), Gaps = 3/408 (0%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L  +LK R + ++ +G A+GTGL++GSG AL  GGP SL I +   G+++  ++ +L E+
Sbjct: 85  LKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMALGEL 144

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
           A   P+  GF+ Y  R++D +FGFAA +NY L++ + L   + +  + + YW  D     
Sbjct: 145 AVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPKYRD 204

Query: 152 XXXXXX-XXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   VK +GE E + ++ K++ ++   I  +I+ CGG P     G +
Sbjct: 205 GFVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYIGGK 264

Query: 211 YWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNV 270
           Y+ + GA      G   KF G  +  V + F F GSE++G+   E+ +P+K++PK++  V
Sbjct: 265 YFHDPGAFAGDTPGA--KFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVPKAAKQV 322

Query: 271 FFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAALL 330
           F+RI   Y+  + ++GL +   +S+L+ A S DA ASPFVIAI + GIK LP+ VN  +L
Sbjct: 323 FWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAASPFVIAIVTHGIKGLPSVVNVVIL 382

Query: 331 VFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKK 390
           + ++S  N+ I+ CSR    LA+ G  P+IF  V+R   P+VG +  S +G +A++    
Sbjct: 383 IAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIAFVAASN 442

Query: 391 SAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
               VF+++ +   +  +  W  I I +I + +A+ ++G S+D++ F+
Sbjct: 443 KEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFK 490

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  251 bits (640), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 139/408 (34%), Positives = 225/408 (55%), Gaps = 5/408 (1%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L   LK R + ++ +G A+GTGL +GSG+AL   GP SL I +  TGS++  ++ +++EM
Sbjct: 89  LKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEM 148

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW-RPDXXXX 150
           A   P+  GF+ Y  R++D +FGFA  +NY L++ +VL   + +  + + YW  P     
Sbjct: 149 AVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRD 208

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   VK +GE E + +  K++ +V   I  L++ CGG P     G +
Sbjct: 209 GFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGAK 268

Query: 211 YWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YW + GA    VG   G +F G+ +  V + F F GSE+IGI   E  NP+K +P ++  
Sbjct: 269 YWHDPGAF---VGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPAAKQ 325

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           VF+RI   Y+  +  +GL +   +S+L+ + + DA ASPFVIAI+  GI+ LP+ +N  +
Sbjct: 326 VFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGIRGLPSVINVVI 385

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L+ ++S  N+ IY CSR L  LA+ G  PK+   ++R   P+VG    S  G +A++   
Sbjct: 386 LIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVAFVAQS 445

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
                VF+++ +   +     W  I + +I +  A+KA+  S D++PF
Sbjct: 446 DKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPF 493

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  250 bits (638), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 153/495 (30%), Positives = 253/495 (51%), Gaps = 13/495 (2%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N  L   LK R + ++ +G A+GTGL +GSG+AL   GP  + I +  TG+++  ++ +L
Sbjct: 78  NSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAL 137

Query: 89  SEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXX 148
            E+A   P+  GF+ Y  R++D ++GFA   NY L++ +VL   + A  + + YW  +  
Sbjct: 138 GELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGTNPR 197

Query: 149 XXXXXXXXXXXXX-XXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VK +GE E + ++ K++ +V   I  +I+ CGG P     
Sbjct: 198 YRDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPVKGYI 257

Query: 208 GFRYWRESGALPY--LVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           G RYW      PY   VG   G +F G  +  V + F F GSE++G+   ETANP+K++P
Sbjct: 258 GGRYWHH----PYGAFVGDSAGARFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSVP 313

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
           K++  VF+RI   Y+  + ++GL +     +L+ A S DA ASPFVIAI++ GI+ LP+ 
Sbjct: 314 KAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAASPFVIAITTHGIRGLPSV 373

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           VN  +L+ ++S  N+ IY CSR L  LA+    PK F  ++R   P+   +  S  G +A
Sbjct: 374 VNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVTSGFGLVA 433

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           ++   K    VF+++ +   +  +  W  I + +I + +A+ A+G   D++ F      Y
Sbjct: 434 FVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSFVSPAGVY 493

Query: 445 AAYXXXXXXXXXXXXNGYNAFI---IKFHYKTFITSYIGVFANILMVIGYKLYFKTK--F 499
            +Y              Y A      K + K F  +Y+     I   +G+K+Y K    F
Sbjct: 494 GSYWGLFMIILMFIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIACYLGHKIYKKNWKIF 553

Query: 500 VKPSEISFRTRNEHE 514
           +K  ++   T  + +
Sbjct: 554 IKAEDMDIDTGRKDD 568

>Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON}
           YBR132C (REAL)
          Length = 590

 Score =  249 bits (637), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 149/487 (30%), Positives = 246/487 (50%), Gaps = 14/487 (2%)

Query: 34  RELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFSLSEMA 92
           R+L+ R V L+ +   +GT L +  G AL +GGP SL +A+ L+   +LC+ + S +EM 
Sbjct: 80  RKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITV-STAEMV 138

Query: 93  SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXXX 152
            F P+   F     + VD +    A WN++    + +   + +   +I YWR D      
Sbjct: 139 CFFPVSSPFLRLATKCVDESLAVMASWNFWFLECVQIPFEIVSVNTIIHYWRDDYSAGIP 198

Query: 153 XXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRYW 212
                      +  AVKY+GE+E  L  FK+++ + ++I   +   GG P H   GFRY+
Sbjct: 199 LAVQVVLYLLISICAVKYYGEMEFWLASFKIILALGLFIFTFVTMLGGNPKHDRYGFRYY 258

Query: 213 RESGALPYL-----VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
            ES    Y      VG  +G F G+ AC++Q+ F   G E I ++ GE   P+K +PK+ 
Sbjct: 259 GESPFKQYFPDGKDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVLPKAF 318

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKL---VHAHSTDANASPFVIAISSSGIKVLPNF 324
             VF R+ FL++     +G+  SP +  L   ++     A +SP+VIA+++  I++LP+ 
Sbjct: 319 KQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNMKIRILPDV 378

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           VN AL+    S+ N   Y  SR  YG+A DG APKIF   N+  VP+       +   ++
Sbjct: 379 VNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPKIFTKCNKHGVPIYAVGISLIWALVS 438

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
            +    ++A V +++ + ++   ++N+  + I Y+ + R    +  S+  +PFR W QPY
Sbjct: 439 LLQLNSNSAVVLNWLINLITASQLINFVVLCIIYLFFRRTYSIQQDSLPKLPFRSWGQPY 498

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYF---KTKFV 500
            A              GY  F  K ++ + F+ SY+ VF +I + +GYK  +   K K  
Sbjct: 499 TAIIGLVSCLAMIMIQGYTVFFPKLWNSQDFLFSYLMVFIDIGIYVGYKFIWKRGKDKVK 558

Query: 501 KPSEISF 507
            P +I F
Sbjct: 559 DPYKIDF 565

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  249 bits (635), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 134/408 (32%), Positives = 227/408 (55%), Gaps = 5/408 (1%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L R LK R + ++ +G A+GTGL +GSG AL  GGP  + I +   G ++  V+ S+ E+
Sbjct: 77  LQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGEL 136

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW-RPDXXXX 150
           A   P+  GF+ Y  R+VD +FGFA  +NY L++ +VL   + A  + + +W  P     
Sbjct: 137 AVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRD 196

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        NF  V+ +GE E + +  K++ ++   I  +++ CGG P     G +
Sbjct: 197 GFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGGK 256

Query: 211 YWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YW   GA     G   G +F G  +  V + F F G+E++G+   ETANP+K +P+++  
Sbjct: 257 YWHNPGAFS---GDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRKALPRAAKQ 313

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           VF+RI   Y+  + ++GL +   + +L+   S DA ASPFV+AI + GIK LP+ +N  +
Sbjct: 314 VFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQTHGIKGLPSVINVVI 373

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L+ ++S  N+ +Y CSR +  LA+ G+ P IF  ++R   P+V  +T  + G L+++   
Sbjct: 374 LISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLSFIAQS 433

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
           +    VF+++ +   +  + +W  I I +I + RA+ A+G S D++ F
Sbjct: 434 EKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAF 481

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  249 bits (635), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 135/409 (33%), Positives = 223/409 (54%), Gaps = 5/409 (1%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L   LK R + ++ +G A+GTGL +GSG+AL   GP  + I +  TG+++  ++ ++ E+
Sbjct: 79  LKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAVGEL 138

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
           A   P+  GF+ Y  R+VD +FGFAA + Y L++ +VL   + A  + + YW  D     
Sbjct: 139 AVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDPKYRD 198

Query: 152 XXXXX-XXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   VK +GE E + +  K++ ++   I  +++ CGG  +H   G +
Sbjct: 199 GFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYIGAQ 258

Query: 211 YWRESGALPYLVGGGTGK-FLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YW   GA    VG   G+ F G+    V + F F GSE++G+   E   P+K++P ++  
Sbjct: 259 YWYNPGAF---VGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSVPGAAKQ 315

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           VF+RI   Y+  + ++G+ +   + +L+ A S DA ASPFVIAI + GIK LP+ VN  +
Sbjct: 316 VFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAASPFVIAIVNHGIKGLPSVVNVVI 375

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L+ ++S  N+ IY CSR L  LA  G  P I   ++R   P+VG    +  G +A++   
Sbjct: 376 LIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFGLIAFVAQS 435

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
           K    VF+++ +   +  +  W  I + +I Y  A+ A+G S D++PF+
Sbjct: 436 KKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQ 484

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  248 bits (633), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 158/503 (31%), Positives = 251/503 (49%), Gaps = 18/503 (3%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            +SR LK R V  + LG A+GTGL IGSG+AL+  GP  L I+Y      +  ++  ++E
Sbjct: 63  EVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLLISYSVMSFFVWAIMNQMTE 122

Query: 91  MASFAPM--DKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXX 148
           M    P+  +   +     Y++    F  GWN F   ++V+   +TA  L+I YW  D  
Sbjct: 123 MVVLIPLSGESSMASLAGTYLNRPSSFMCGWNCFYAMSMVVPTEITACALLIEYWT-DAN 181

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAP-NHTTT 207
                          + L VK FGE E  +++ K+L ++ + +  ++I  GG P  H   
Sbjct: 182 AAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILGLILVGVVIFFGGGPAQHKVL 241

Query: 208 GFRYWRESGAL-PYLVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKKTIPK 265
           GF YW   GA   YLV G TG FL  W  +++S F F M  E+      E A P+K +P+
Sbjct: 242 GFHYWNTPGAFNSYLVKGSTGAFLAVWKAIIKSGFAFVMIPEITSSCSAEAAFPRKNMPR 301

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHST---DANASPFVIAISSSGIKVLP 322
           +     +R+   YV G  ++G+ +   N  L  A S+   +A ASPFVI I  +GI++LP
Sbjct: 302 ACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSGKANAAASPFVIGIQEAGIRILP 361

Query: 323 NFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGF 382
           + +NA +L    S + +++Y  SR L+ LA  G APK F  VN++ VP       SL G 
Sbjct: 362 HIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYGVPYYSVAATSLFGV 421

Query: 383 LAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQ 442
           LAY+N  KS+  VF+++++  ++ G +NW ++ I Y+ + +      I+ D +P+R   Q
Sbjct: 422 LAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYLKIN-DRVPYRRRGQ 480

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFII-KFHYKTFITSYIGVFANILMVIGYKLYFKTKFVK 501
              AY            NG+  FI   ++   F T Y+ +    ++ IG  +Y+K    +
Sbjct: 481 RALAYASAIFFALLAITNGFYVFIAGNWNVSDFFTCYVTIGFVGVLFIGSSIYYKEWTFR 540

Query: 502 PSEISFR-------TRNEHEGEE 517
             ++  R         ++ E EE
Sbjct: 541 DMDVVGREIMPKIDQADQEEKEE 563

>TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {ON}
           Anc_3.397 YBR132C
          Length = 575

 Score =  247 bits (631), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 153/499 (30%), Positives = 244/499 (48%), Gaps = 16/499 (3%)

Query: 34  RELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFSLSEMA 92
           R LK R V L+ +   +GT L +  G AL KGGP  L IA+ L+   +LC+ + S +EM 
Sbjct: 64  RRLKNRHVQLIAISGVIGTALFVAIGKALYKGGPAFLLIAFALWCVPILCITV-STAEMV 122

Query: 93  SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXXX 152
            F P+   F     R  D +    A WN++    + +   + +   +I YWR D      
Sbjct: 123 CFLPVSSPFLRLAARCADDSLAVMASWNFWFLQCVQIPFEIVSVNTIIHYWRDDYSAAIP 182

Query: 153 XXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRYW 212
                      +  AVKY+GE E  L  FK+++ + +++   I   GG P H   GFRY+
Sbjct: 183 LVVQIVLYFLISICAVKYYGETEFWLASFKIILALGLFLFTFITMLGGNPKHDRYGFRYY 242

Query: 213 RESGALPYL------VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            E+    Y        G   G F G+ AC++Q+ F   G E I ++ GE   P+K +P++
Sbjct: 243 GETPFKKYYPNGDKDAGASVGYFQGFLACLIQASFTIAGGEYISMLAGEVKLPRKVLPRA 302

Query: 267 SMNVFFRIGFLYVFGVFILGLAIS---PVNSKLVHAHSTDANASPFVIAISSSGIKVLPN 323
              VF+R+ FL++     +G+  S   P  +  +      A +SP+VIA+++ GIKVLP+
Sbjct: 303 FKQVFYRLTFLFLGSCLCVGIICSANDPALTAAIDESRPGAGSSPYVIAMNNLGIKVLPD 362

Query: 324 FVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFL 383
            VNAAL+    S+ N   Y  SR LYG+A DG AP+IF   N+  VP+   +   L G +
Sbjct: 363 IVNAALITAAFSAGNAYTYCSSRTLYGMALDGYAPRIFTRCNKHGVPIYSVLISLLWGLI 422

Query: 384 AYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQP 443
           + +    ++A V +++ + ++   ++N+  + I Y+ + RA       +  +PF+ W QP
Sbjct: 423 SLLQLNDNSAVVLNWLINLITASQLINFTVLCIIYLFFRRAYLLHKDILPKLPFKSWGQP 482

Query: 444 YAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYF---KTKF 499
           Y A              GY  F    +  + F+  Y+ VF +I + IGYK  +   + KF
Sbjct: 483 YTAIVGLVSATAMILIQGYTVFFPSLWTVRDFLFCYLMVFIDIGIYIGYKFIWRRGRDKF 542

Query: 500 VKPSEISF-RTRNEHEGEE 517
             P  + F +   E E  E
Sbjct: 543 KDPKTVDFSKDLKEIESHE 561

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  247 bits (630), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 151/498 (30%), Positives = 249/498 (50%), Gaps = 18/498 (3%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +   ++R+LK R + L+ LG A+GTGL IGSG AL+  GP  L I+Y+     +  ++  
Sbjct: 63  QEHQVARKLKSRHIQLIALGGAIGTGLFIGSGGALSVCGPAPLLISYMIMSFFVWCIMNF 122

Query: 88  LSEMASFAPMDKGFSGY--LNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRP 145
           L+EM    P+    S +     Y++    F  G N F   +++  + +TA  ++I YW  
Sbjct: 123 LTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFYAMSMIAPSEITATAILIQYWT- 181

Query: 146 DXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHT 205
           D                   L V +FGE E  +++ KL  +  + I  ++I  GGAPN  
Sbjct: 182 DANSAIFISIFIVVTVSLTMLPVHFFGESEFWVSIIKLFCITGLVILGIVIFFGGAPNQD 241

Query: 206 TT-GFRYWRESGAL-PYLVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPKKT 262
              GF YW+  GA  P+LV G TGKFL  W  +++S F + +  E++     E  +P++ 
Sbjct: 242 KVLGFHYWKHPGAFNPHLVPGNTGKFLACWTAIIKSGFSYVLVPEVVVSCAAEAKDPRRN 301

Query: 263 IPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHA---HSTDANASPFVIAISSSGIK 319
           +P+ +    +R+   YV G   +G+ +   NS+L++A     ++A ASPFVI I   GI+
Sbjct: 302 MPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRLLNAIAAGESNAAASPFVIGIQEVGIR 361

Query: 320 VLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSL 379
           VLP+ +NA +L    S   + +Y  SR L+ +A +GA PKIF   NRF  P       S+
Sbjct: 362 VLPHIINACILTSAYSCGTSVLYGASRVLHSMAVNGAVPKIFATTNRFGTPYYSTAAASV 421

Query: 380 LGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRM 439
              LAY+N   S++ VF+++++  ++ G ++W  + + Y+ + + I+   ++ D +PFR 
Sbjct: 422 FCLLAYLNCSDSSSVVFTWLSNIATISGFVDWMLVCVVYLRFRKVIEHANLT-DKMPFRK 480

Query: 440 WFQPYAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYFKTK 498
            F    AY            NGY  F+   ++   F   Y  +    ++ IG  +Y+KT 
Sbjct: 481 RFMKPLAYLSCGFFAILSLTNGYAVFVADNWNVSDFFACYTTLGLAAVLYIGAAIYYKT- 539

Query: 499 FVKPSEISFRTRNEHEGE 516
                 I  R  +E   E
Sbjct: 540 ------IKLRDLDEVAAE 551

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  247 bits (631), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 129/407 (31%), Positives = 219/407 (53%), Gaps = 3/407 (0%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           LSR LK R + ++ +G A+G GL +GSG ALA  GP  + I +  T +++ ++  SL E+
Sbjct: 83  LSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLGEL 142

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
           A   P+  G+  Y  R++D ++GFA  +NY ++  +V+   + A  + +GYW  D     
Sbjct: 143 AVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKYKL 202

Query: 152 XXXXXX-XXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   V+ FGE E++ ++ K++ ++   I  +++  GG P+H   G +
Sbjct: 203 AFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIGGK 262

Query: 211 YWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNV 270
           YW + G  P++    + KF G  +  V + F F GSE+IG+   ET  P+K+IPK++  V
Sbjct: 263 YWNDPG--PFVGNAPSDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPKAAKQV 320

Query: 271 FFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAALL 330
           F+RI   Y+  + I+GL +   N  L+     DA  SPFVIA+    I+VLP+ +N  +L
Sbjct: 321 FWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVIAMDMHRIRVLPSIINVVIL 380

Query: 331 VFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKK 390
             +IS  N+ +Y  SR +  LA+ G  PKIF  ++R   P+      SL G L ++   K
Sbjct: 381 TAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLCFVAGAK 440

Query: 391 SAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
               +F ++ +   +     W  I +A++ +  A+KA+G + +++ F
Sbjct: 441 EEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSF 487

>AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR132C (AGP2)
          Length = 566

 Score =  246 bits (628), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 150/504 (29%), Positives = 251/504 (49%), Gaps = 21/504 (4%)

Query: 34  RELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFSLSEMA 92
           R+L+ R V L+ +   +GT L +  G AL +GG +SL + + L+   +LC+ + S +EM 
Sbjct: 55  RKLENRHVQLIGISGVIGTALFVSIGKALYRGGSVSLLLGFALWCVPILCITV-STAEMV 113

Query: 93  SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXXX 152
            + P++  F    +R V+ +    AGWN++    + +   + A   +I YWR D      
Sbjct: 114 CYLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQIPFEIVAVNSIIHYWRDDYSAAIT 173

Query: 153 XXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRYW 212
                      +  AV+Y+GEIE  L  FK+L+ V ++    +   GG P     GFRY 
Sbjct: 174 LVVQVMLYLLISLFAVRYYGEIEFWLASFKVLLAVGLFCFTFVTMVGGNPKRDRYGFRYI 233

Query: 213 RESGALPYL-----VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
            E+    Y      +    G F G+ AC++Q+ F   G + + ++ GET  P+K +P + 
Sbjct: 234 GEAPFKQYSPTMEPISSSAGYFQGFLACLIQASFTIAGPDYVSMIAGETKLPRKVLPVAF 293

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKL---VHAHSTDANASPFVIAISSSGIKVLPNF 324
             VF R+  L++ G   +G+  S  +  L   ++A    A +SP+VIA++  GIK+LP+ 
Sbjct: 294 KQVFIRLTVLFLGGCLCVGIVCSANDPDLTAAINASRPGAGSSPYVIAMNHLGIKILPDI 353

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           VNAAL+    S+ N   Y  SR LYGLA DG AP IF   NRF VP+       +   L+
Sbjct: 354 VNAALVTAAFSAGNAYTYCSSRSLYGLALDGYAPAIFKRCNRFGVPIYAVSVSVMWSVLS 413

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
            +    ++A V +++ S ++   ++N+  + + Y+ + RA  A+  ++ ++ F+ W+QPY
Sbjct: 414 LLQLNSNSAVVLNWLISLITASQLINFGVLCVVYLYFRRAYLAQQDNLPELSFKSWWQPY 473

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYF---KTKFV 500
            AY             GY  F    ++ K F+  Y+ VF +I + +GY+  +   K   +
Sbjct: 474 TAYVGLTCVLLIVVVQGYTVFYSALWNVKDFLFCYLMVFIDIAIYLGYRYIWRRGKDAVI 533

Query: 501 KPSEISFRT-------RNEHEGEE 517
            P+E+   T          H G E
Sbjct: 534 PPTEVDLTTGLLEIELHERHHGFE 557

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  245 bits (626), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 138/408 (33%), Positives = 227/408 (55%), Gaps = 3/408 (0%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L   LK R + ++ +G A+GTGL++GSG+AL  GGP SL I +  TG+++  ++ +L E+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGEL 145

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
           A   P+  GF+ Y  R++D +FG+A  +NY L++ +VL   + +  + + +W  D     
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 152 XXXXXX-XXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   VK +GE E + +  K++ +V   I  +I+ CGG P     G +
Sbjct: 206 GFVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGK 265

Query: 211 YWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNV 270
           YW + GA      G   KF G  +  V S F F GSE++G+   E+  P+K++PK++  V
Sbjct: 266 YWHDPGAFAGDTPGA--KFKGVCSVFVTSAFSFAGSELVGLAASESVEPRKSVPKAAKQV 323

Query: 271 FFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAALL 330
           F+RI   Y+  + ++GL +   +  L+ A S DA ASPFVIAI + GIK LP+ VN  +L
Sbjct: 324 FWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVIL 383

Query: 331 VFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKK 390
           + ++S  N+ IY CSR +  LA+    P+IF  V+R   P+VG    S  G +A++   K
Sbjct: 384 IAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFGLIAFVAASK 443

Query: 391 SAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
               VF+++ +   +  +  W  I I +I + +A+ A+G  +D++ F+
Sbjct: 444 KEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFK 491

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  245 bits (626), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 157/494 (31%), Positives = 252/494 (51%), Gaps = 16/494 (3%)

Query: 34  RELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE--- 90
           R+L PR VS++ +G A+GT L +  G+ +  GGP SL IA+     L  VV   LS+   
Sbjct: 47  RKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAF----CLWSVVFIGLSQCMC 102

Query: 91  -MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXX 149
            M ++ P+   F  +  R+VD + GF+ GW YF+  A  +   +TA  LV+ +W      
Sbjct: 103 VMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTDKIPK 162

Query: 150 XXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGF 209
                         N  +V  FGE E  L++ K+++ + +    +++  GG P H   GF
Sbjct: 163 AALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHKVLGF 222

Query: 210 RYWRESGAL-PYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSM 268
           + W   GA   Y+  G  GKF G+ +C++ +++ F G + +G    E  NP+K IP S  
Sbjct: 223 KNWSNPGAFAEYISKGSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKVIPSSFR 282

Query: 269 NVFFRIGFLYVFGVFILGLAISPVNS----KLVHAHSTDANASPFVIAISSSGIKVLPNF 324
            VF R+   Y+ G   +G+ + P N     K +   +  A ASP+V A+ + GI VLP+ 
Sbjct: 283 KVFGRLIIFYIGGAICVGILV-PFNDHNMIKAISEGAVGAGASPYVSAMKTLGIGVLPHI 341

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           VN  +L  IIS+ N+ +Y  SR L+ LA +G APK+F +  R  VP+  CV   L+  LA
Sbjct: 342 VNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLFKITKR-GVPIYCCVAVLLVCGLA 400

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           Y++   S   V ++  +  +    + + +I I+Y+ + +  KA+ I +  +P+   F PY
Sbjct: 401 YLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSSSFLPY 460

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPS 503
             +            NGY  F+   +  ++FI SY  +   I++  G+KLY KT+FVKP 
Sbjct: 461 LGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTRFVKPV 520

Query: 504 EISFRTRNEHEGEE 517
           E+   +      EE
Sbjct: 521 EMDLFSGIAELAEE 534

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  246 bits (629), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 138/408 (33%), Positives = 227/408 (55%), Gaps = 3/408 (0%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L   LK R + ++ +G A+GTGL++GSG+AL  GGP SL I +  TG+++  ++ +L E+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMVMALGEL 145

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
           A   P+  GF+ Y  R++D +FG+A  +NY L++ +VL   + +  + + +W  D     
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 152 XXXXXX-XXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   VK +GE E + +  K++ +V   I  +I+ CGG P     G +
Sbjct: 206 GFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEGGYIGGK 265

Query: 211 YWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNV 270
           YW + GA      G   KF G  +  V S F F GSE++G+   E+ +P+K++PK++  V
Sbjct: 266 YWHDPGAFAGDTPGA--KFKGLCSVFVTSAFSFAGSELVGLAASESVDPRKSVPKAAKQV 323

Query: 271 FFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAALL 330
           F+RI   Y+  + ++GL +   +  L+ A S DA ASPFVIAI + GIK LP  VN  +L
Sbjct: 324 FWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAASPFVIAIKTHGIKGLPTVVNVVIL 383

Query: 331 VFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKK 390
           + ++S  N+ IY CSR +  LA+    P+IF  V+R   P+VG    S  G +A++   K
Sbjct: 384 IAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFGLIAFVAASK 443

Query: 391 SAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
               VF+++ +   +  +  W  I I +I + +A+ A+G  +D++ F+
Sbjct: 444 KEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFK 491

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  246 bits (628), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 134/408 (32%), Positives = 223/408 (54%), Gaps = 5/408 (1%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L  +LK R + ++++G A+GTGL +GSG+AL   GP  + I ++  GS++  ++ S++E+
Sbjct: 84  LQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAEL 143

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
           A   P+  GF+ Y  R++D ++GFA  +NY L++ + L   + A  + + YW  D     
Sbjct: 144 AIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRD 203

Query: 152 -XXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   V+ +GE E + ++ K+L++V   I  +I+ CGG P     G R
Sbjct: 204 GFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGAR 263

Query: 211 YWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YW   GA     G  +G KF G+ +  V + F F GSE++G+   E +NP+K +P ++  
Sbjct: 264 YWYHPGAF---AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGAAKQ 320

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           VF+RI   YV  + ++G+ +   + +L+   S DA ASPFVIAI + GI  LP  VN  +
Sbjct: 321 VFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAIKNQGISGLPTLVNVVI 380

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L+ ++S  N+ +Y CSR L  LA  G  PK F  ++R   P+VG    S  G +A++   
Sbjct: 381 LIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIAFVAQS 440

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
                VF ++ +   +  +  W  I + +I + RA+ A+G S +++ F
Sbjct: 441 DKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAF 488

>SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {ON}
           similar to uniprot|P38090 Saccharomyces cerevisiae
           YBR132C AGP2 Plasma membrane carnitine transporter
           expression is down-regulated by osmotic stress also
           functions as a low-affinity amino acid permease
          Length = 558

 Score =  244 bits (624), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 148/490 (30%), Positives = 249/490 (50%), Gaps = 15/490 (3%)

Query: 34  RELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFSLSEMA 92
           R+L+ R V L+ +   +GT L +  G AL  GGP+ L + + L+   +LC+ + S +EM 
Sbjct: 46  RKLQNRHVQLIGISGVIGTALFVSIGRALYHGGPVFLLLGFSLWCIPILCITV-STAEMV 104

Query: 93  SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXXX 152
            + P    F    +R VD +    A WN++    + +   + A   +I YWR D      
Sbjct: 105 CYMPFSSPFLRIASRCVDNSLAIMASWNFWFLECVQIPFEIVAVNTMIHYWRDDYSAAIP 164

Query: 153 XXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRYW 212
                      +  AV+Y+GE+E  L  FK+ + + ++    I   GG P H   GFR +
Sbjct: 165 LVVQVVLYLAISVFAVRYYGEMEFWLASFKIFLAIGLFFFTFITMLGGNPKHDRYGFRNF 224

Query: 213 RESGALPYL------VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
           ++     Y       VG   G F G+ AC++Q+ F   G + + ++ GET  P+K +P +
Sbjct: 225 KDLPFKEYFPNNDKTVGSSAGYFQGFLACLIQASFTIAGPDYVSMIAGETLLPRKVLPIA 284

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISSSGIKVLPN 323
              VF R+  L++ G   +G+  S  +  L  A + D   A ASP+VIA+++ GIKVLP+
Sbjct: 285 FKQVFVRLTVLFLGGCLCIGIVCSANDPNLTAAITEDRPGAGASPYVIAMNNLGIKVLPD 344

Query: 324 FVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFL 383
            VNAAL+    S+ N   Y  SR LYG+A DG APK+F   NR  VP+       L   L
Sbjct: 345 IVNAALITAAFSAGNAYTYCSSRTLYGMALDGYAPKVFSRCNRHGVPIFAVAVSLLWALL 404

Query: 384 AYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQP 443
           + +   K++A V +++ + ++   ++N+  + + Y+ + RA  A+  ++ ++PF+ W+QP
Sbjct: 405 SLLQLGKNSAVVLNWLVNLITASQLINFGVLCVVYLFFRRAYMAQRDNLPELPFKSWWQP 464

Query: 444 YAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKL---YFKTKF 499
           Y A              GY  F    ++Y++F+ SY+ +F +I + +G+K    Y K   
Sbjct: 465 YPAIIGLVSVSVMTIVQGYTVFFKTLWNYESFLFSYLMIFVDIFIYLGHKFVINYGKDPV 524

Query: 500 VKPSEISFRT 509
            +P ++   T
Sbjct: 525 KRPQDVDLIT 534

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  245 bits (625), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 138/409 (33%), Positives = 229/409 (55%), Gaps = 5/409 (1%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           NL+R+L  R +  L +G A+GTGL + SGSAL  GGP SL IA+    + L  ++ +L E
Sbjct: 70  NLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWTIISTCLFTIVNALGE 129

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           +A+  P+  GF+ Y+ R VDP+ GFA   NY  ++A++L   L A  + I YW       
Sbjct: 130 LAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVAASITIRYWNNSVNSD 189

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        + L VK FGE E +L++ K+L +    I  +++ CGG P +   G +
Sbjct: 190 AWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIVLICGGGPKNGYIGAK 249

Query: 211 YWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YW + G+    VG   G +F G  +  V + F + G+E++G+   E+ANP+ T+PK+S  
Sbjct: 250 YWNDPGS---FVGASPGSQFKGLCSVFVTAAFSYSGTELVGVSAAESANPRYTLPKASKR 306

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFVNAA 328
            F+ I   Y+  + I+G  +   + KL+ A S+ D  ASP VIAI + GI+ LP+ +NA 
Sbjct: 307 TFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAASPLVIAIENGGIQGLPSLMNAI 366

Query: 329 LLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNT 388
           +L+ IIS AN+ +Y CSR +  +A+ G  P+IF  ++    P+V  +   + G L+++  
Sbjct: 367 ILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPIVAIIFTLVFGLLSFIAA 426

Query: 389 KKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
                 +F ++++   +  +  W  I I++I + RA+  +G S+D++P+
Sbjct: 427 SNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYSLDELPY 475

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  245 bits (625), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 156/483 (32%), Positives = 251/483 (51%), Gaps = 15/483 (3%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           NG L + LK R + L+ LG  +GT L++G+ SALA  GP  LFI+YL   + +  ++ +L
Sbjct: 93  NGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALANCGPAGLFISYLIISTFVYPIMNAL 152

Query: 89  SEMASFAPMD----KGFSGYL-NRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW 143
            EM  F P +     G + +L ++YVDP+ GFAA WNY+  + I+++A ++A   VI YW
Sbjct: 153 GEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVILVAAEVSAASGVIEYW 212

Query: 144 R--PDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGA 201
                                 NFL V  +GE E      K+L +  + I   I+  GG 
Sbjct: 213 AWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCITGLIILSFILFWGGG 272

Query: 202 PNHT-TTGFRYWRESGALPY-LVGGGTGKFLGWWACVVQSIFG-FMGSEMIGIVYGETAN 258
           P      GFRYW+  G+  + + GGG G FL  +  +++  F   +G E++ +   E A+
Sbjct: 273 PKSDGILGFRYWKNPGSFAHHITGGGGGNFLDIYTGIIKGGFSVILGPELVCLTSSECAD 332

Query: 259 PKKTIPKSSMNVFFRIGFLYVFGVFILGLAIS---PVNSKLVHAHSTDANASPFVIAISS 315
            ++ I K+S    +R+ F Y+ G   +G+ ++   PV    +      A +SPFVI I +
Sbjct: 333 QRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALAQSKAGAGSSPFVIGIQN 392

Query: 316 SGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCV 375
           +GI+ +P+ VN  +L    S+ N  ++  SR L  +A++G APKIF  +N+  VP     
Sbjct: 393 AGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAPKIFCRINQLGVPYTAVG 452

Query: 376 TGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDI 435
              LL  LAY+N   S A VF++ ++  ++ G + W    +AYI + +AI    ++   I
Sbjct: 453 ASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACVAYIRFRKAITYNKLT-HRI 511

Query: 436 PFRMWFQPYAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLY 494
           PFR   Q Y  +            NGY  FI + ++ K FI +YI +   I++ IG+K++
Sbjct: 512 PFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAAYITLPIFIVLWIGHKVF 571

Query: 495 FKT 497
            +T
Sbjct: 572 TRT 574

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  244 bits (623), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 137/408 (33%), Positives = 227/408 (55%), Gaps = 3/408 (0%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L   LK R + ++ +G A+GTGL++GSG+AL  GGP SL I +  TG+++  ++ +L E+
Sbjct: 86  LKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMVMALGEL 145

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
           A   P+  GF+ Y  R++D +FG+A  +NY L++ +VL   + +  + + +W  D     
Sbjct: 146 AVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGTDPKYRD 205

Query: 152 XXXXXX-XXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   VK +GE E + +  K++ +V   I  +I+ CGG P     G +
Sbjct: 206 GFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTGGYIGGK 265

Query: 211 YWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNV 270
           YW + GA      G   KF G  +  V + F F GSE++G+   E+  P+K++PK++  V
Sbjct: 266 YWHDPGAFAGDTPGA--KFKGVCSVFVTAAFSFAGSELVGLAASESVEPRKSVPKAAKQV 323

Query: 271 FFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAALL 330
           F+RI   Y+  + ++GL +   +  L+ A S DA ASPFVIAI + GIK LP+ VN  +L
Sbjct: 324 FWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVIAIKTHGIKGLPSVVNVVIL 383

Query: 331 VFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKK 390
           + ++S  N+ IY CSR +  LA+    P+IF  V+R   P+VG    S  G +A++   K
Sbjct: 384 IAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFGLIAFVAASK 443

Query: 391 SAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
               VF+++ +   +  +  W  I I +I + +A+ A+G  +D++ F+
Sbjct: 444 KEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFK 491

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  243 bits (621), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 152/493 (30%), Positives = 253/493 (51%), Gaps = 13/493 (2%)

Query: 34  RELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE--- 90
           R+L PR VS++ +G A+GT L +  G+ + +GGP SL IA+     L  VV   LS+   
Sbjct: 119 RKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAF----CLWSVVFIGLSKCMC 174

Query: 91  -MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXX 149
            M ++ P+   F  +  R+VD + GFA GW YF+  A  +   +TA  LV+ YW      
Sbjct: 175 VMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWTDKIPK 234

Query: 150 XXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGF 209
                         N  +V +FGE E  L++ K+++ + + I  +++  GG P HT  GF
Sbjct: 235 AALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHTVLGF 294

Query: 210 RYWRESGAL-PYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSM 268
           + W   GA   Y+  G  G+F G+ +C+V +++ F G + +G    E  NP+K IP S  
Sbjct: 295 KNWSNPGAFAEYISDGSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKVIPSSFR 354

Query: 269 NVFFRIGFLYVFGVFILGLAI---SPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFV 325
            VF R+   Y+ G   +G+ I    P   + +   +  A ASP+V A+ + GI+VLP+ V
Sbjct: 355 KVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIRVLPHIV 414

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           N  +L  IIS+ N+ +Y  SR L+ LA D  AP+IF +  +  VPV  C+   ++  LAY
Sbjct: 415 NILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLVICGLAY 474

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYA 445
           ++   S   V ++  +  +    + + +I ++Y+ + +   A+ + +  +P+     PY 
Sbjct: 475 LSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYSSSLPYL 534

Query: 446 AYXXXXXXXXXXXXNGYNAFII-KFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSE 504
           A+            NGY  F+   +  ++F+ SY  +   ++ + G+KLY  TK V+P E
Sbjct: 535 AWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYKGTKSVRPLE 594

Query: 505 ISFRTRNEHEGEE 517
           +   T  E   +E
Sbjct: 595 MDLFTGIEELADE 607

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  242 bits (618), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 149/517 (28%), Positives = 259/517 (50%), Gaps = 31/517 (5%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           NL   L+ R + L+ LG  +GTGL +G+ S LA  GP +L I+Y+   +++  ++    E
Sbjct: 55  NLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGE 114

Query: 91  MASFAPMDK------GFSGYL-NRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW 143
           M  + P +       G+  YL ++YVD + GFA  WNY+  + ++++   TA   ++ YW
Sbjct: 115 MVCYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYW 174

Query: 144 RPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPN 203
                               NFL VK++GE E    + K+  +  + I   +I CGGAPN
Sbjct: 175 TSKIPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPN 234

Query: 204 HTTT---GFRYWRESGAL-PYLVGGGTGKFLGWWACVVQSIFGF-MGSEMIGIVYGETAN 258
           +      GF YW+   +   Y+  G  G FL  +  +++  F F +G E++ +   E  +
Sbjct: 235 NEDNSFVGFHYWKNPSSFRDYVTNGSLGNFLDVYNALIKGAFAFILGPELVSLTSSECVD 294

Query: 259 PKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISS 315
            ++ I K+S    +R+ F Y+FG   + + +   +  L++A + +   A +SPFVI I +
Sbjct: 295 QRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGIQN 354

Query: 316 SGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCV 375
           +GI +LP+ +N  +L   +S+ N  ++  +R L  + K+G+AP+IF  +NR  VP V   
Sbjct: 355 AGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVALS 414

Query: 376 TGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDI 435
              ++  LA++N   S+A VF + ++  ++ G + WF   IAY+ + R I   G+  D +
Sbjct: 415 LSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YDRL 473

Query: 436 PFRMWFQPYAAYXXXXXXXXXXXXNGYNAFIIKF-HYKTFITSYIGVFANILMVIGYKLY 494
           PF+   Q Y  +            NGY   I KF +Y+ FI +YI +   +++  G+ +Y
Sbjct: 474 PFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFGHIIY 533

Query: 495 ----FKTKFVKP----------SEISFRTRNEHEGEE 517
                + K+ KP           EI  +T+   E  +
Sbjct: 534 SGRWRQRKWWKPVDEIDVVTGLEEIELKTKIADEERQ 570

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  242 bits (618), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 137/412 (33%), Positives = 228/412 (55%), Gaps = 5/412 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           +  L   LK R + ++ +G A+GTGL +GSG+AL   GP  + I +  TG+++  ++ ++
Sbjct: 78  HAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYCMVMAM 137

Query: 89  SEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXX 148
            E++   P+  GF+ Y  R++D +FGFA  +NY L++  VL   + A  + + YW  D  
Sbjct: 138 GELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAASITVNYWGTDPK 197

Query: 149 XXX-XXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VK +GE E + ++ K+L ++   I  +++ CGG P     
Sbjct: 198 YRDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYI 257

Query: 208 GFRYWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
           G +Y+ + GA    VG   G +F G  +  V + F F GSE+IGI   E+A P+K++PK+
Sbjct: 258 GGKYFHDPGAF---VGDTAGARFQGVCSVFVTAAFSFAGSELIGIAAAESAEPRKSVPKA 314

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           +  VF+RI   Y+  + ++GL +   + +L+ A S DA ASPFVIAI+S GI+ LP+ VN
Sbjct: 315 AKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAASPFVIAITSHGIRGLPSVVN 374

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
             +L+ ++S  N+ +Y CSR L  LA+    PKIF  ++R   P+ G    S  G +A++
Sbjct: 375 VVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGIAFTSAFGLVAFV 434

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
              K    VF+++ +   +  +  W  I   +I +  A+ A+G S D++PF+
Sbjct: 435 AQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDELPFK 486

>TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.397
           YBR132C
          Length = 580

 Score =  241 bits (615), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 151/504 (29%), Positives = 252/504 (50%), Gaps = 27/504 (5%)

Query: 34  RELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLS---- 89
           R LK R V  + +   +GT L +  G  L KGGP+SL +A++    L C+ IF+++    
Sbjct: 64  RNLKNRHVQFIAISGVIGTALFVTIGKPLYKGGPVSLILAFI----LWCIPIFAITVSTA 119

Query: 90  EMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXX 149
           EM  F P+   F    N+ VD +  F A WN++    + +   + +   +I YW  +   
Sbjct: 120 EMVCFYPVSSPFLRLANKCVDESLAFMASWNFWFLECVQIPFEIVSVNTMIHYWTTNYSP 179

Query: 150 XXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGF 209
                         +  AVKY+GE+E  L+ FK+++ + +++  LI  CGG P     GF
Sbjct: 180 AIPLVVQVVLYFIISITAVKYYGELEFWLSSFKIILAIGLFLFTLITMCGGNPERDHFGF 239

Query: 210 RYWRESGALPYLVGGGT-----GKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
           R ++      Y   G       G F G+  C++Q+ F   G E I ++ GE   P+K +P
Sbjct: 240 RNYKVEPFKQYFPSGNHSPASLGYFQGFLNCLIQAAFTIAGGEYISMLAGEVHLPRKVLP 299

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISSSGIKVL 321
           K+   VF+R+ F+++     +G+  SP +  L  A S     A +SP+VIA+++  I++L
Sbjct: 300 KAFKQVFYRLTFIFIGSCLCVGIICSPNDPDLTAAISESRPGAGSSPYVIAMNNLKIRIL 359

Query: 322 PNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLG 381
           P+ VN AL+    S+ N   Y  SR LYG+A DG APKIF   N++ VP+   V   L  
Sbjct: 360 PHIVNVALITAAFSAGNAYTYCSSRTLYGMALDGYAPKIFSRCNKYGVPIYSVVISLLWA 419

Query: 382 FLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWF 441
            L+ +    ++A V +++ + ++   ++N+  I I Y+ + ++ +A+   +  +PF+ WF
Sbjct: 420 LLSLLQLNSNSAVVLNWLVNLITASQLINFSVICITYLFFRKSYRAQSNDLPSLPFKSWF 479

Query: 442 QPYAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKL---YFKT 497
           QPY A              GY   I   +  + F+  Y+ VF N++    +K    Y+KT
Sbjct: 480 QPYTAIFGLACAVIMIGVQGYTTLIPSIWSVQNFLFCYLMVFLNLIFYFVHKFGWTYYKT 539

Query: 498 K---FVKPSEISFRTR----NEHE 514
           K   F  P++I+F+        HE
Sbjct: 540 KSLSFRNPTQINFKNDLMVIENHE 563

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  241 bits (615), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 133/412 (32%), Positives = 233/412 (56%), Gaps = 5/412 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            +  L+++L  R +  L +G A+GTGL + SG++L  GGP SL +A++   + L  ++ +
Sbjct: 84  NDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLIVAWVIVSTCLFTIVNA 143

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+A+  P+  GF+ Y+ R+V+P+FGFA   NY  ++A++L   L A  + I YW    
Sbjct: 144 LGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLPLELVAASITIRYWNNTI 203

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N L VK FGE E +L++ K+L ++   I  +++ CGG P+    
Sbjct: 204 NSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPSGEYI 263

Query: 208 GFRYWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
           G RYW + GA    VG   G +F G  A  V + F + G+E++ +   E+ NP+ T+PK+
Sbjct: 264 GGRYWNDPGA---FVGDTPGRRFKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLPKA 320

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFV 325
           S   F+ I   Y+  + I+G  +   + +L++ +S+ DA ASP VIAI + GIK LP+ +
Sbjct: 321 SKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVDAAASPLVIAIENGGIKGLPSLM 380

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ I+S AN+ +Y CSR +  +A+ G  PK    +++   P+       + G L++
Sbjct: 381 NAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGLLSF 440

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
           +        VF+++++   +  +  WF I +++I + +A+KA+  S++++PF
Sbjct: 441 IAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQAMKAQDRSLNELPF 492

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  241 bits (614), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 155/500 (31%), Positives = 253/500 (50%), Gaps = 16/500 (3%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N  L R LK R + ++ +G A+GTGL +GSG AL   GP  + I +  TG+++  ++ ++
Sbjct: 74  NSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAM 133

Query: 89  SEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXX 148
            E+A   P+  GF+ Y  R++D +FG+A  +NY L++ +VL   + A  + + YW  D  
Sbjct: 134 GELAVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPK 193

Query: 149 XXX-XXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VK +GE E + +  K++ ++   I  +I+ CGG P     
Sbjct: 194 YRDGFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYI 253

Query: 208 GFRYWRESGALPYLVGGGTGK-FLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
           G   W   GA    VG   GK F G  +  V + F F GSE++G+   ETANP+K++P++
Sbjct: 254 GGANWHNPGAF---VGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPRA 310

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           +  VF+RI   Y+  + ++GL +   +++L+ A S DA ASPFV+AI + GIK LP+ VN
Sbjct: 311 AKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVLAIKNHGIKGLPSVVN 370

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
             +L+ ++S  N+ ++ CSR L  LA+ G  PKIF  ++R   P+VG    S  G L+++
Sbjct: 371 VVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLSFI 430

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAA 446
                   VF ++ +   +  +  W  I I ++ + RA+ A+G S D++ F     P   
Sbjct: 431 AASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSF---VSPAGV 487

Query: 447 YXXXXXXXXXXXXNGYNAFIIKF------HYKTFITSYIGVFANILMVIGYKLYFKT--K 498
           +                 +I  F        K F  SY+ +   ++M IG+K Y +    
Sbjct: 488 WGSIYGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYLSLPVVLVMYIGHKCYKRNWKL 547

Query: 499 FVKPSEISFRTRNEHEGEEA 518
           F++   I   T       EA
Sbjct: 548 FIRAENIDIDTGRREVDIEA 567

>TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.397
           YBR132C
          Length = 583

 Score =  241 bits (614), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 151/500 (30%), Positives = 249/500 (49%), Gaps = 19/500 (3%)

Query: 33  SRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFSLSEM 91
            R LK R V  + +   +GT + +  G AL KGGP +L IA+ ++   +LC+ + S +EM
Sbjct: 68  KRNLKNRHVQFIAISGVIGTAIFVAIGKALYKGGPGNLIIAFAVWCIPILCITM-STAEM 126

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
            SF P+   F        D +F   A WN++    + +   + +   +I YWR D     
Sbjct: 127 VSFYPVHSPFLRLATMCGDDSFSIMASWNFWFLECVQIPFEIVSVNTIIHYWRDDYSAAI 186

Query: 152 XXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRY 211
                       + LAVKY+GE+E  L  FK+++ + +++   I   GG P H   GFRY
Sbjct: 187 PLVVQVVLYILISVLAVKYYGELEFWLASFKIILALGLFLFTFITMVGGNPKHDRYGFRY 246

Query: 212 WRESGALPYLVGGGT------GKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
             ES    Y   G T      G F G+  C++Q+ F   G E I ++ GE   P+K +PK
Sbjct: 247 LSESPFKKYYPDGDTTAGPSAGHFQGFLICLIQAAFTIAGGEYISMLAGEVCLPRKVMPK 306

Query: 266 SSMNVFFRIGFLYVFGVFILGLAIS---PVNSKLVHAHSTDANASPFVIAISSSGIKVLP 322
           +   VF+R+ F+++   F +G+  S   P+ +  ++     A +SP+VIA+ +  I++LP
Sbjct: 307 AFKQVFWRLTFIFIGSCFCVGIVCSSNDPLLTSAINESRPGAGSSPYVIAMQNLQIRILP 366

Query: 323 NFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGF 382
           + VN AL+    S+ N   Y  SR LYG+A DG APKIF   N+  VP+   +  +L   
Sbjct: 367 DIVNIALITAAFSAGNAYTYCSSRTLYGIALDGNAPKIFKKCNKEGVPIYCVLVSTLWAL 426

Query: 383 LAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQ 442
           L+ +    ++A V +++ + ++   ++N+  I I Y+ + RA +A+  S+  +PF  W+Q
Sbjct: 427 LSLLQLNSNSAVVLNWLINLITASQLINFSCICITYLLFRRAYRAQEDSLPRLPFTSWYQ 486

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYF---KTK 498
           PY  Y             GY  F  K +    F+ +Y+ +F ++ + +G K  +   K  
Sbjct: 487 PYTTYFGLFCSISMMLVQGYTVFFKKLWAVDDFLFNYLMIFIDLAIYLGVKFIWKRGKDP 546

Query: 499 FVKPSEISFRTR----NEHE 514
              P +I F T      +HE
Sbjct: 547 VKDPKKIDFETELKNIEQHE 566

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  241 bits (615), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 144/478 (30%), Positives = 240/478 (50%), Gaps = 12/478 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +   L + L  R + L+ LG  +GTGL +G+G  L K GP  L  +YL   +++  ++  
Sbjct: 98  RKNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVYPIMNV 157

Query: 88  LSEMASFAPMDKGFSG-----YLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGY 142
           L EM  + P D   S       + RY+D +  FAAGWNY+  + ++++A  TA   V+ Y
Sbjct: 158 LGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAASGVVEY 217

Query: 143 WRPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAP 202
           W                    N   V+ +GE E    + K+L +V + I   I+  GG P
Sbjct: 218 WTKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFILFWGGGP 277

Query: 203 NHTTTGFRYWRESGALPYLVGGGT-GKFLGWWACVVQSIFGF-MGSEMIGIVYGETANPK 260
           NH   GFRYW   G+    +  G+ G FL  +  ++   F F +G E++ +   E ++P+
Sbjct: 278 NHDRLGFRYWITPGSFANTITNGSFGNFLDVYKGIILGAFSFILGPELVVLPSSECSDPR 337

Query: 261 KTIPKSSMNVFFRIGFLYVFGVFILGLAIS---PVNSKLVHAHSTDANASPFVIAISSSG 317
           + I K+S    +R+ F Y+ G   + + +S   P+ S  +      A +SPFVI I ++G
Sbjct: 338 RNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAGSSPFVIGIQNAG 397

Query: 318 IKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTG 377
           I VLP+ +N  +L+   SS N  ++  SR L  +A +  APK    +NRF VP V  +  
Sbjct: 398 IDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRFGVPYVAVIVS 457

Query: 378 SLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
            +L  +AY+N  KS + VF + T+  ++ G L W  + + Y+ + +AI+  G+  D +P+
Sbjct: 458 IILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKAIEYHGMK-DRLPY 516

Query: 438 RMWFQPYAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLY 494
             W QPY               NG++  I + ++   FI +Y+ +   +++ IG+K Y
Sbjct: 517 TTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLMIWIGHKFY 574

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  239 bits (611), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 134/418 (32%), Positives = 226/418 (54%), Gaps = 5/418 (1%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L R LK R + ++ +G A+GTGL +GSGSAL  GGP ++ I +   G ++  V+ ++ E+
Sbjct: 80  LQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGEL 139

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW-RPDXXXX 150
           A   P+  GF+ Y+ R+VD +FGFA  + Y L++ +VL   + A  + + YW  P     
Sbjct: 140 AVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYRD 199

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   VK +GE E + ++ K+  +V   I  +++ CGG P     G +
Sbjct: 200 GFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVGGK 259

Query: 211 YWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YW   GA     G   G +F    +  V + F F G+E++G+   ET NP+K +P+++  
Sbjct: 260 YWHNPGAFN---GDNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALPRAAKQ 316

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           VF+RI   Y+  + ++GL +   +  L+ + S DA ASPFV+AI + GI  LP+ +N  +
Sbjct: 317 VFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVLAIKTHGISGLPSVINVVI 376

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L+ ++S  N+ +Y CSR L  LA  G  P+IF  ++R   P+VG +     G L ++   
Sbjct: 377 LISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLCFIAQS 436

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAY 447
           K    VF+++ +   +  +  W +I I ++ + RA+ A+G S D++ F  +   + +Y
Sbjct: 437 KKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVWGSY 494

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  238 bits (608), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 132/410 (32%), Positives = 222/410 (54%), Gaps = 8/410 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N  L R LK R + ++ +G A+GTGL +GSG ALA  GP  + I +  TG+++  ++ ++
Sbjct: 73  NAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAM 132

Query: 89  SEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW-RPDX 147
            E+A   P+  GF+ Y +R+VD +FGFA    Y L++ +VL   + A  + + YW  PD 
Sbjct: 133 GELAVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDK 192

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF  VK +GE E + +  K++ ++   I  +I+ CGG P     
Sbjct: 193 YRDGFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYI 252

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G R W   GA           F G  +  V + F F GSE++G+   ETANP+K++P ++
Sbjct: 253 GGRLWHNPGAF-------ANGFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAA 305

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             VF+RI   Y+  + ++GL +   + +L+   S DA ASPFVI+I ++GIK LP+ +N 
Sbjct: 306 KQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINV 365

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ ++S  N+ ++ CSR +  LA  G+ PKIF  ++R   P+VG +   + G L+++ 
Sbjct: 366 VILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIA 425

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
                  VF ++ +   +  +  W  I++ +I   RA+ A+  +  ++ F
Sbjct: 426 ASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSF 475

>ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]
           {ON} similar to uniprot|P38090 Saccharomyces cerevisiae
           YBR132C AGP2 Plasma membrane carnitine transporter
           expression is down-regulated by osmotic stress also
           functions as a low-affinity amino acid permease
          Length = 578

 Score =  238 bits (607), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 141/489 (28%), Positives = 241/489 (49%), Gaps = 13/489 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFSLS 89
           ++ R+LK R V L+++   +GT L +  G AL  GG  +L + + ++   ++C+ + + +
Sbjct: 47  HVQRKLKNRHVQLISISGVIGTALFVSIGKALYHGGAANLLLGFAIWCIPIMCITVCT-A 105

Query: 90  EMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXX 149
           EM  F P+   F    +  VD + G  A WN++    + +   + +   +I YWR D   
Sbjct: 106 EMVCFLPVSSPFLRLAHMCVDDSLGVMASWNFWFLECVQIPYEIVSVNTIIHYWRDDYNA 165

Query: 150 XXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGF 209
                         +   V+Y+GE E  L  FK+++ + +Y    +   GG P H   GF
Sbjct: 166 AIPLVVQLVLYGFISLCTVRYYGEAEFWLASFKIVLAIGLYFFTFVTMLGGNPRHDRYGF 225

Query: 210 RYWRESGALPYLVGG----GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           RY+ E+    Y   G     +G F G+ ACV+Q+ F   G E + ++ GE   P+K +P+
Sbjct: 226 RYYGEAPFKKYWPNGHGSNASGHFQGFLACVIQAAFTVAGGEYVSMLAGEVVLPRKVMPR 285

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKL---VHAHSTDANASPFVIAISSSGIKVLP 322
           +   VF R+  L++     +G+  SP +  L   ++     A +SP+VIA+    I VLP
Sbjct: 286 AFKQVFIRLTVLFLGSCLCVGILCSPNDPDLTAAINESRPGAGSSPYVIAMKHLHIHVLP 345

Query: 323 NFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGF 382
           + VNAAL+    SS N   Y  SR LYG+A DG APKIF        P+         GF
Sbjct: 346 DIVNAALITAAFSSGNAYTYCSSRTLYGMALDGYAPKIFARCTPQGTPIFAMAVSMCWGF 405

Query: 383 LAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQ 442
           L+ +    ++A V +++ + ++   ++N+  + + Y+ + R  K    ++  +PF+ W+Q
Sbjct: 406 LSLLQLGDNSAVVLNWLINLITTSQLINFVILCVTYLFFRRVYKVNEHNLPRLPFKSWWQ 465

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYF---KTK 498
           P+ AY             GY  F    +  K F+ SY+ +F +I + +GYK  +   K K
Sbjct: 466 PWPAYIGIICAGSMTFIQGYAVFFSSLWSTKQFLFSYLMLFIDIGLYLGYKFIWRRGKDK 525

Query: 499 FVKPSEISF 507
              P+E++F
Sbjct: 526 LRNPTEVNF 534

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  237 bits (604), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 135/412 (32%), Positives = 232/412 (56%), Gaps = 5/412 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           ++   +++L  R +  L +G A+GTGL + SG+AL  GGP SL I ++   + L  ++ +
Sbjct: 68  QDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNA 127

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E++S  P+  GF+ Y++R+V+P+FGFA   NY  ++A++L   L A  L I YW    
Sbjct: 128 LGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNHTI 187

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N L VK FGE E +L++ K+L ++   I  +++TCGG P     
Sbjct: 188 NSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYI 247

Query: 208 GFRYWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
           G +YW   GA    VG   G +F G  +  V + F + G+E+I +   E+ NP+ T+PK+
Sbjct: 248 GGKYWSNPGAF---VGHTAGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKA 304

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFV 325
               F+ I   Y+  + ++G  +S  + +L++  S+ D  ASP VIAI + GIK LP+ +
Sbjct: 305 CKRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPSLM 364

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ ++S AN+ +Y CSR +  +A+ G  PK+F  V+R   P+   V   + G L++
Sbjct: 365 NAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSF 424

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
           +        VF+++++   +  +  WF I +++I + R +K +G ++D++PF
Sbjct: 425 IAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPF 476

>Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar to
           Ashbya gossypii AAR038W
          Length = 559

 Score =  236 bits (601), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 145/491 (29%), Positives = 247/491 (50%), Gaps = 15/491 (3%)

Query: 33  SRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFSLSEM 91
            R+L+ R V  + +   +GT L +  G AL  GGPISL + + L+   +LC+ + S +EM
Sbjct: 48  QRKLENRHVQFVGISGVIGTALFVSIGKALHHGGPISLLLGFTLWCIPILCITV-STAEM 106

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
            S+ P++  F    +R V+ +  F AGWN++    + +   + A  +VI YW  D     
Sbjct: 107 VSYLPLNSPFLRLASRCVNDSLTFTAGWNFWFLECVQIPFEIVAVNVVIHYWTDDYSATI 166

Query: 152 XXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRY 211
                       +  AV+Y+GEIE  L  FK+++ V ++    +   GG P     GF++
Sbjct: 167 PLCVQVALYFLISVFAVRYYGEIEFWLASFKIILAVGLFAFTFVTMVGGNPKRERYGFKH 226

Query: 212 WRESGALPYLVGGGT------GKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
            RE     Y  GG +      G F G+ AC++Q+ F   G + + ++ GET  P+K +P 
Sbjct: 227 IRELPFKTYFPGGDSDQGSALGYFQGFLACLIQASFTIAGPDYVSMIAGETKLPRKVLPI 286

Query: 266 SSMNVFFRIGFLYVFGVFILGL---AISPVNSKLVHAHSTDANASPFVIAISSSGIKVLP 322
           +   VF R+ FL++ G   +G+   A  P  +  ++     A +SP+VIA++  GI++LP
Sbjct: 287 AFKQVFVRLTFLFLGGCLCVGIVCGANDPQLTAAINDSRPGAASSPYVIAMNHLGIRILP 346

Query: 323 NFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGF 382
           + VNAAL+    S+ N   Y  SR LYGLA DG AP IF   NR+ VP+           
Sbjct: 347 DIVNAALITAAFSAGNAYTYCSSRSLYGLALDGYAPPIFKRCNRYGVPIYAVGVSLFWAV 406

Query: 383 LAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQ 442
           L+ +   ++++ V +++ + ++   ++N+  + I Y+ + RA  A+  ++  +PF+ W+Q
Sbjct: 407 LSLLQLNENSSIVLNWLINLITASQLINFGILCIIYLYFRRAYIAQQDNLPALPFKSWWQ 466

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYFK---TK 498
           PY A              GY  F    ++ + F+  Y  VFANI + +     +K     
Sbjct: 467 PYTAICGLVSVTIMVIVQGYTVFYSSLWNVQDFLFCYFMVFANIAIYLACYFVWKRGNDN 526

Query: 499 FVKPSEISFRT 509
            + P+++   T
Sbjct: 527 VLPPNQVDLIT 537

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  236 bits (602), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 141/494 (28%), Positives = 247/494 (50%), Gaps = 13/494 (2%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L R+LK R + ++ +G A+GTGL IGS  AL   GP  + I +    +++  +  SL EM
Sbjct: 84  LQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSLGEM 143

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
           A   P+  G++ Y  R++D ++GFA   NY ++  +VL   + A  + + YW P      
Sbjct: 144 AVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQYRA 203

Query: 152 XXXXXX-XXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   VK +GE E + ++ K++ ++   I  +I+ CGG P H   G +
Sbjct: 204 AFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYIGSK 263

Query: 211 YWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           +W   GA    VG   G KF G  +  V + F F  +E++G+   ET +P+K++PK++  
Sbjct: 264 FWSNPGAF---VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVPKAAKQ 320

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           VF+RI   Y+  + ++GL +   + +L+ +   DA ASPFV+A+ + GIK LP+ +N  +
Sbjct: 321 VFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLALKNHGIKGLPSVINVVI 380

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L  ++S  N+ ++ CSR L  L++ G  P +F  ++R   P+V  +  S  G L ++   
Sbjct: 381 LTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLCFLAVS 440

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAYXX 449
                +F ++ S   +  +  W  I + +I + +A+ A+  SID++ F      + +Y  
Sbjct: 441 HQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGIWGSYYS 500

Query: 450 XXXXXXXXXXNGYNAFIIKFHYK----TFITSYIGVFANILMVIGYKLYFKT--KFVKPS 503
                       + A +   H K     F  +Y+ +   + M +G+K+Y K     + P 
Sbjct: 501 VFLIIVVLILQFWIA-LFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKNWKLLIDPK 559

Query: 504 EISFRT-RNEHEGE 516
            +   T R E + E
Sbjct: 560 YMDIDTGRRELDIE 573

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  235 bits (599), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 133/411 (32%), Positives = 230/411 (55%), Gaps = 3/411 (0%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           ++   +++L  R +  L +G A+GTGL + SGSAL  GGP SL I ++   + L  ++ +
Sbjct: 66  EDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNA 125

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E++S  P+  GF+ Y++R+V+P+FGFA   NY  ++A++L   L A  L I YW    
Sbjct: 126 LGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNSTI 185

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N L VK FGE E +L++ K+L ++   I  +++TCGG P     
Sbjct: 186 NSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGGYI 245

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW   GA  ++    + +F G  +  V + F + G+E+I +   E+ NP+ T+PK+ 
Sbjct: 246 GGKYWSNPGA--FVGNTSSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKAC 303

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFVN 326
              F+ I   Y+  + ++G  +   + +L+H  S+ D  ASP VIAI + GIK LP+ +N
Sbjct: 304 KRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPSLMN 363

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ ++S AN+ +Y CSR +  +A+ G  PK F  V+R   P+   +   + G L+++
Sbjct: 364 AIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLSFI 423

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
                  TVF+++++   +  +  WF I +++I +   +K +G S+D++PF
Sbjct: 424 AASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPF 474

>KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} similar
           to uniprot|P38090 Saccharomyces cerevisiae YBR132C AGP2
           Plasma membrane carnitine transporter expression is
           down-regulated by osmotic stress also functions as a
           low-affinity amino acid permease
          Length = 568

 Score =  233 bits (595), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 144/504 (28%), Positives = 255/504 (50%), Gaps = 19/504 (3%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFS 87
           N + SR+L+ R V L+ +   +GT L +  G AL +GGP+SL + + L+   +LC+ + S
Sbjct: 50  NNSTSRKLQNRHVQLIGISGVIGTALFVSIGKALYRGGPVSLILGFSLWCIPILCITV-S 108

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            +EM  + P+   F     R  + +    AGWN++    + +   + A   ++ YWR D 
Sbjct: 109 TAEMVCYLPISSPFLRMAKRCCNDSLAVTAGWNFWFLECVQIPFEIVAVNTILHYWRDDF 168

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           +  AV+ +GE EA L  FK+L+ + +++   I   GG P H   
Sbjct: 169 SPAIPLCVQVLLYIGISLFAVRCYGETEAFLASFKILLAIGLFLFTFITMLGGNPKHDRY 228

Query: 208 GFRYWRESGALPYLVGG----GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTI 263
           GFRY  ++    Y          G F G+ ACV+Q+ F   G + + ++ GE   P+K +
Sbjct: 229 GFRYITDTKFKQYFPNNEGSSSMGYFQGFLACVIQASFTIAGPDYVAMIAGECKLPRKVL 288

Query: 264 PKSSMNVFFRIGFLYVFGVFILGLAIS---PVNSKLVHAHSTDANASPFVIAISSSGIKV 320
           P +   VF R+  L++ G   +G+  S   P  + +++     A +SP+VIA+++ GIKV
Sbjct: 289 PVAFKQVFIRLTVLFLGGCLCVGIVCSSNDPNLTAVINNPRPGAGSSPYVIAMNNLGIKV 348

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           LP+ VNAAL+    S+ N   Y  SR LYGL+ DG APK+F    +  VP+   +     
Sbjct: 349 LPDVVNAALVTAAFSAGNAYTYCSSRTLYGLSLDGYAPKLFQYCTKSGVPINAVLVSLAW 408

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGIS--IDDIPFR 438
            F++ +    ++A V +++ + ++   ++N+  + + Y+++ RA   +  S  + ++PF+
Sbjct: 409 AFISLLQLGSNSAVVLNWLINLITASQLINFSILCVIYLSFRRAYIKQHPSGELPELPFK 468

Query: 439 MWFQPYAAYXXXXXXXXXXXXNGYNAFII-KFHYKTFITSYIGVFANI-LMVIGYKLYFK 496
            W QPY AY             GY  F+   +  ++F+  Y+ VF ++ + ++ + +Y +
Sbjct: 469 SWGQPYTAYCGLFAVTLMIGVQGYTVFLHGSWEVQSFLFCYLMVFIDLGIFLLCFFVYKR 528

Query: 497 TK--FVKPSEISFRT----RNEHE 514
           T+  +VKP +    T      EHE
Sbjct: 529 TRDPWVKPEDADLLTGMDEVEEHE 552

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  233 bits (594), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 139/411 (33%), Positives = 226/411 (54%), Gaps = 3/411 (0%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            N NLS+ L  R +  L +G ++GTGL + SG+AL+ GGP SL + ++   + L  VI S
Sbjct: 39  NNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINS 98

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+A+  P+  GF+ Y+ R+VDP+ GFA   NY  ++ ++L   L A  L I YW    
Sbjct: 99  LGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDKI 158

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N L VK FGE E +L++ K+L ++   I  +++  GG P+    
Sbjct: 159 NSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGYL 218

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           GF+YW   GA  ++ G    KF G  +  V + F F G EMI +   E+ NP+K IPK++
Sbjct: 219 GFKYWNNPGA--FVGGTNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVIPKAA 276

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVH-AHSTDANASPFVIAISSSGIKVLPNFVN 326
              F+ +   YV  + ++G  +   +S+L++ A S DA ASP VIAI + GIK LP+ +N
Sbjct: 277 KRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLPSLMN 336

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ I+S AN+ +Y CSR +  +A  G  PK+   V++   P+   +   + G L+++
Sbjct: 337 AIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGLLSFI 396

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
                   VF+++++   +  I  W  I  + I + RA++ +  S+D++P+
Sbjct: 397 AASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPY 447

>NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.397
           YBR132C
          Length = 584

 Score =  233 bits (595), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 144/501 (28%), Positives = 244/501 (48%), Gaps = 18/501 (3%)

Query: 34  RELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFSLSEMA 92
           R L  R V L+ +   +GT + +  G  L +GGP  L +A+ ++   +LC+ + S +EM 
Sbjct: 75  RNLVNRHVQLIAISGVIGTAIFVAIGKPLYRGGPAFLLLAFAIWCIPILCITV-STAEMV 133

Query: 93  SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXXX 152
            F P+   F     + VD +    A WN++    + +   +     +I YWR D      
Sbjct: 134 CFMPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQIPYEIVTVNTIIHYWRDDYSAAIP 193

Query: 153 XXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRYW 212
                      +  AVK++GE+E  L  FK+++ + ++    I   GG P     GFRY+
Sbjct: 194 LVIQSLLYLLISLAAVKWYGEMEFWLASFKIVLAMGLFCFTFITMLGGNPKKDRFGFRYF 253

Query: 213 RESGALPYL-----VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
            ++    Y       G   G F G++ C++Q+ F   G E I ++ GE   P++ +P++ 
Sbjct: 254 HDTPFKKYFPDGIDRGSSAGYFQGFFICLIQASFTIAGGEYISMLAGEIEIPRRVLPRAF 313

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKL---VHAHSTDANASPFVIAISSSGIKVLPNF 324
             VF R+  L++     +G+  SP +S L   ++     A +SP+VIA+++ GI++LP+ 
Sbjct: 314 KQVFMRLTILFLGSCLCVGILCSPNDSSLTAAINEARPGAGSSPYVIAMNNLGIRILPDI 373

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           VN  L+    SS N   Y  SR LYG+A DG APKIF   N+  VP+       L  F++
Sbjct: 374 VNITLITAAFSSGNAYTYCSSRTLYGMALDGYAPKIFTRCNKQGVPIYAVGVSLLWAFIS 433

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
            +    ++A V +++ + ++   ++N+  + I Y+ + RA   +   + ++PF+ W+QPY
Sbjct: 434 LLQLNSNSAIVLNWLINIITASQLINFAILCITYLFFRRAYLLQKDKLPELPFKSWWQPY 493

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYF---KTKFV 500
            A              GY  F  K ++ + F+  Y+ +F NI + I YK  +   K K  
Sbjct: 494 TAIFGLVCAMVMMIVQGYTVFFPKNWNVQDFLFCYLMIFINIGIYIFYKFIWRLGKDKIK 553

Query: 501 KPSEISF----RTRNEHEGEE 517
            P+ ISF    R    HE E 
Sbjct: 554 DPATISFEDELREIENHELEH 574

>CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa]
           {ON} highly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease
          Length = 593

 Score =  233 bits (593), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 148/509 (29%), Positives = 251/509 (49%), Gaps = 19/509 (3%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIF 86
           ++ +  R+L  R V  + +   +GT L +  G  L +GGP +L +A+ L+   +LC+ + 
Sbjct: 74  ESTSTHRKLLNRHVQFIAISGVIGTALFVAIGKPLYRGGPANLLLAFALWCIPILCITV- 132

Query: 87  SLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
           S +EM SF P+   F     + VD + G  A WN++    + +   + +   +I YWR D
Sbjct: 133 STAEMVSFMPVSSPFLRLAKKCVDESLGVTASWNFWFLECVQIPYEIVSVNTIIHYWRDD 192

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            +  AVKY+GE+E  L  FK+++ V ++    I   GG P H  
Sbjct: 193 YSPAIPLVIQVVLYVLISVCAVKYYGEMEFWLASFKIILAVGLFCFTFITMLGGNPKHDR 252

Query: 207 TGFRYWRESGALPYLVGG--GTGK----FLGWWACVVQSIFGFMGSEMIGIVYGETANPK 260
            GFRY+ ES    Y   G  G GK    F G+  C++Q+ F   G E I ++ GE   P+
Sbjct: 253 YGFRYYGESPFKKYFPDGNEGAGKSAGYFQGFLTCLIQAAFTIAGGEYISMLAGEVKLPR 312

Query: 261 KTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKL---VHAHSTDANASPFVIAISSSG 317
           K +PK+   VF R+  +++     +G+  SP +S L   ++     A +SP+VIA+++  
Sbjct: 313 KVLPKAFKQVFVRLTVIFLGSCLCVGIVCSPNDSALTAAINEARPGAGSSPYVIAMNNLQ 372

Query: 318 IKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTG 377
           I+VLP+ VN AL+    S+ N   Y  SR LYG+A DG APKIF   N++ VP+      
Sbjct: 373 IRVLPDIVNIALITAAFSAGNAYTYCSSRTLYGMALDGYAPKIFTKCNKYGVPIYAVGVS 432

Query: 378 SLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
                L+ +    ++A V +++ + ++   ++N+ ++ + Y+ + RA   +   + ++PF
Sbjct: 433 LCWALLSLLQLNSNSAVVLNWLINLITASQLINFVFLCVIYLFFRRAYMTQKERLPELPF 492

Query: 438 RMWFQPYAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYF- 495
           + W+QPY                GY  F  K ++ + FI  Y+ VF +I + +  K  + 
Sbjct: 493 KSWWQPYTVIVGLVSVLIMILLQGYTVFFPKLWNGRDFIFCYLMVFLDIGIYVFTKFIWY 552

Query: 496 --KTKFVKPSEISF----RTRNEHEGEEA 518
             K     P+ I F    +   +HE E +
Sbjct: 553 KGKDPVKSPNSIDFVPELKEIEQHELEHS 581

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  233 bits (593), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 155/483 (32%), Positives = 245/483 (50%), Gaps = 14/483 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +NG L + LK R V L+ LG  +GTGL++GS   LA  GP  LF +YL   + +  ++ +
Sbjct: 66  ENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIMNA 125

Query: 88  LSEMASFAPMD----KGFSGYL-NRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGY 142
             EM  + P +     G S YL  +YVD + GFA+ WNY+  + I+++   TA   V+ Y
Sbjct: 126 FGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGVVEY 185

Query: 143 WR--PDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGG 200
           W                      N L V ++GE E      K+L ++ + I   I+  GG
Sbjct: 186 WAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSFILFWGG 245

Query: 201 APNHTTTGFRYWRESGALPYLVGGGTG-KFLGWWACVVQSIFGF-MGSEMIGIVYGETAN 258
            P+H   GFRYW+  GA    +  GTG  FL  +  V++  F F +G E++ +   E  +
Sbjct: 246 GPSHDRLGFRYWQRPGAFADHITDGTGGNFLDVYTGVIKGGFAFVLGPELVSLTSSECHD 305

Query: 259 PKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISS 315
            ++ I K+S    +R+   YV G   + + ++  +  L +A +     A +SPFVI I +
Sbjct: 306 QRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIGIQN 365

Query: 316 SGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCV 375
           +GIKVLP+ +N  ++    S+ N  ++  SR L  +A  G APK F  +NRF VP V   
Sbjct: 366 AGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPYVAVG 425

Query: 376 TGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDI 435
              L   LAY+N   S A VF++ ++  ++ G + W    +AYI + +AI    +  D +
Sbjct: 426 FSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDL-YDRL 484

Query: 436 PFRMWFQPYAAYXXXXXXXXXXXXNGYNAFIIKF-HYKTFITSYIGVFANILMVIGYKLY 494
           P++ + Q Y  +            NGY  FI +F  YK FI +YI +   I++ IG+KL 
Sbjct: 485 PYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWIGHKLV 544

Query: 495 FKT 497
            ++
Sbjct: 545 TRS 547

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  233 bits (593), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 134/408 (32%), Positives = 224/408 (54%), Gaps = 5/408 (1%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L   LK R + ++ +G A+GTGL +GSG AL   GP  + I +  TG+++  ++ ++ E+
Sbjct: 87  LKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAVGEL 146

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
           A   P+  GF+ Y  R++D +FGFA  +NY L++ I L   + +  + + YW  D     
Sbjct: 147 AVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAKYRD 206

Query: 152 XXXXXX-XXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   VK +GE E +  + K++ ++   I  +I+ CGG P     G +
Sbjct: 207 GFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYIGAK 266

Query: 211 YWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YW   GA    VG   G KF G+    + + F F GSE++G+   E+ NP+K++P ++  
Sbjct: 267 YWHHPGAF---VGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVPGAAKQ 323

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           VF+RI   YV  + ++G+ +   + +L+ A S DA ASPFVIA+ + GI+ LP+ +N  +
Sbjct: 324 VFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVIAVVNQGIRGLPSVINVVI 383

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L+ ++S  N+ IY+CSR L  LA+ G  PKI   ++R   P+V     S  G +A++   
Sbjct: 384 LISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLIAFVAES 443

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
                VF+++ +   +  + +W  I I +I + RA+ A+G S D++PF
Sbjct: 444 SHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPF 491

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  233 bits (593), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 141/497 (28%), Positives = 253/497 (50%), Gaps = 11/497 (2%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N  L + ++PR V +++LG+ +GTGL++G+G+ LA  GP  L I Y    S +  +I ++
Sbjct: 96  NEKLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAV 155

Query: 89  SEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            EMA ++  +  GF+ Y    VDPA  F+  W Y +++  V    L    + I YW    
Sbjct: 156 GEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTKV 215

Query: 148 XXXXXXXXXXXXXXXXN-FLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                           N F   + + E E +    K+L+++  +I  ++I CGGA N   
Sbjct: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G +YWR+ GA  +    G  +F G  + +V + F F  +E + I   E +NP+K IP +
Sbjct: 276 IGGKYWRDPGA--FRGSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSA 333

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           +  V +R   +Y+  + I+GL +   +S+L+ + S    ASP+V+A+S+ G++V+P+F+N
Sbjct: 334 AKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPYVLAVSTHGVRVVPHFIN 393

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ + S A++  Y  SR L  LA+ G APK+F  V+R   P +G + G+++  +A+ 
Sbjct: 394 AVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAVIAVMAFC 453

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MWFQ 442
                   VF+++ +   +  +  W  I +++I + RA+K +G SID+I ++    +W  
Sbjct: 454 ACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKSQVGVWGS 513

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKT--KFV 500
            YA                          + F   Y+ +   I++ +GYK++ +    F+
Sbjct: 514 AYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWKRDWRLFI 573

Query: 501 KPSEISF-RTRNEHEGE 516
           +  +I     R+ H+ E
Sbjct: 574 RAKDIDLISHRHIHDPE 590

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  233 bits (595), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 137/409 (33%), Positives = 228/409 (55%), Gaps = 5/409 (1%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           +++++L  R +  L +G A+GTGL + SGS+L  GGP SL I ++   + L  VI SL E
Sbjct: 140 DMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLGE 199

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           +A+  P+  GFS Y++++VDP+F FA   NY L++ ++L   L A  + I YW       
Sbjct: 200 LAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYWNSSINSD 259

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N L VK FGE E +L++ K+L ++  +I  +++ CGG P+H   G +
Sbjct: 260 AWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGGK 319

Query: 211 YWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YW + GA    VG  +G KF G  +  V + F F G EM  +   E+ NP++TIPK++  
Sbjct: 320 YWHDPGA---FVGTTSGSKFKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPKAAKR 376

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFVNAA 328
            F+ I   YV  + ++G  +   + +L++  S+ DA +SP VIAI +  I  LP+ +NA 
Sbjct: 377 TFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENGHIHGLPSLMNAI 436

Query: 329 LLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNT 388
           +L+ I+S AN+ +Y CSR +  ++K    PK+F  V+R   P+         G L+++  
Sbjct: 437 ILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLSFVAA 496

Query: 389 KKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
               A VF+++++   +  I  W  I + +I + + +  + IS+D++PF
Sbjct: 497 SDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPF 545

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  232 bits (592), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 136/408 (33%), Positives = 225/408 (55%), Gaps = 5/408 (1%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L   LK R  +++ +G A+G+GL +GS +AL  GGP  L I +  T +++  ++ +L E+
Sbjct: 103 LQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGEL 162

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW-RPDXXXX 150
           A   P+  GF+ Y  R+VD +FG+A  +NY L++ +VL   + +  + + YW  P     
Sbjct: 163 AVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRD 222

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   VK FGE E + ++ K+  ++   I  +++ CGG P     G +
Sbjct: 223 GFVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAK 282

Query: 211 YWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YW + GA    VG G+G +F G  +  V + F F GSE+IGI   E ANP+K+IP ++  
Sbjct: 283 YWHDPGAF---VGHGSGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIPGAAKQ 339

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           V +RI   Y+  + ++GL +   + +L+ A S DA ASPFVIAI + GIK LP+ +N  +
Sbjct: 340 VVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAASPFVIAIVTHGIKGLPSVINVVI 399

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L+ ++S  N+ I+ CSR +  L+  G  PK+F  ++R   P+VG    S  G LA++   
Sbjct: 400 LIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLLAFVAAS 459

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
           K    VF+++ +   +  +  W  I + +I +  A+KA+G   +++ F
Sbjct: 460 KKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTF 507

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  231 bits (590), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 151/481 (31%), Positives = 251/481 (52%), Gaps = 10/481 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           N++++L  R +  L +G A+GTGL + SG++L  GGP SL I +    + L  VI SL E
Sbjct: 85  NMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVINSLGE 144

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           +A+  P+  GF+ Y+ R+VDP+F F+   NY +++ ++L   L A  L I YW       
Sbjct: 145 LAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYWDDTINSD 204

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N L VK FGE E +L++ K+L ++  +I  +++TCGG P     G +
Sbjct: 205 AWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGGYIGGK 264

Query: 211 YWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YW + GA    VG   G +F G  +  V + F + G EMI +   E+ NP+KTIP ++  
Sbjct: 265 YWHDPGA---FVGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKTIPTAAKR 321

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFVNAA 328
            F+ I F Y+  + ++G  ++  +++L++  S+ D  ASP VIAI + GIK LP+ +NA 
Sbjct: 322 TFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIENGGIKGLPSLMNAI 381

Query: 329 LLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNT 388
           +L+ I+S AN+ +Y CSR +  +A  G  PK   +V++   P+    T    G L+++  
Sbjct: 382 ILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFFGLLSFVAA 441

Query: 389 KKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAYX 448
                 VF+++++   +  I  W  I IA+I + +A+  +  S+D++P+      Y +Y 
Sbjct: 442 SDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQTGIYGSYY 501

Query: 449 XXXXXXXXXXXNGYNAFI----IKFHYKTFITSYIGVFANILMVIGYKLYFKT-KFVKPS 503
                      + + +           + F   Y+     I   IG+KLYFK  + + P 
Sbjct: 502 GTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYFKNWRIMTPL 561

Query: 504 E 504
           E
Sbjct: 562 E 562

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  231 bits (589), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 136/423 (32%), Positives = 224/423 (52%), Gaps = 8/423 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N  L + ++PR V ++TLG+ VGTGL++G+G+ L+  GP  L I Y    + +  V+ ++
Sbjct: 96  NEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAV 155

Query: 89  SEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            EMA ++  +  GFS Y    +DP   FA  W Y +++  V    L    + I YW    
Sbjct: 156 GEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYWTTKV 215

Query: 148 XXXXXXXXXXXXXXXXN-FLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                           N F   + + E E    V K+L++   +I  +I+ CGGA N   
Sbjct: 216 NADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGAGNSGF 275

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G RYW   GA  +    G  +F G  + +V + F F G+E + I   E ANP+K IP +
Sbjct: 276 IGARYWHSPGA--FRGDNGINRFKGIVSTLVTAAFAFGGTEFLAITASEQANPRKAIPSA 333

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           +  V +R   +YV  + I+G  +   +S+L+ +      ASP+VIA++S GI+V+P+F+N
Sbjct: 334 AKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKASPYVIAVASHGIRVVPHFIN 393

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ + S A++  Y  SR L  LA+ G APKIF  V++   P +G V G+++  +++ 
Sbjct: 394 AVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGAIIAIISFC 453

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MWFQ 442
                 A VF+++ S   +  +  W  I +++I + RA+K +G S+D+I F+    +W  
Sbjct: 454 ACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFKSQAGVWGS 513

Query: 443 PYA 445
            YA
Sbjct: 514 VYA 516

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  229 bits (585), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 129/408 (31%), Positives = 226/408 (55%), Gaps = 5/408 (1%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L   LK R + ++ +G A+G+GL +GS +AL   GP  + I +  T +++  ++ +L E+
Sbjct: 95  LKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGEL 154

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWR-PDXXXX 150
           A   P+  GF+ Y  R++D +FGFA+ +NY L++   L   + +  + + YW+ P+    
Sbjct: 155 AVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRD 214

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   V+ FGE E + +  K+L ++   I  +++  GG P     G R
Sbjct: 215 GFVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGGR 274

Query: 211 YWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YW   GA    VG   G +F G  +  V + F F GSE++GI   E ANP+K++P+++  
Sbjct: 275 YWHNPGAF---VGDNAGTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPRAAKQ 331

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           V +RI   Y+  + ++GL +   + +L+ A S DA+ASPFVIAI + GI+ LP+ +N  +
Sbjct: 332 VVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASASPFVIAIVTHGIRGLPSVINVVI 391

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L+ ++S  N+ I+  SR +  L++ G  P+IF  ++R   P+VG +  S  G +A++   
Sbjct: 392 LIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIAFIAAS 451

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
           K    VF+++ +   +  +  W  I + +I +  A+KA+G S +++PF
Sbjct: 452 KKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPF 499

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  228 bits (582), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 137/412 (33%), Positives = 228/412 (55%), Gaps = 5/412 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            N NLS+EL  R +  L +G A+GTGL + +G+AL+ GGP SL I ++   + L  VI S
Sbjct: 82  NNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWVIISTCLFTVINS 141

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+++  P+  GF+ Y  R+V+P+F FA   NY  ++ ++L   L A  + I YW    
Sbjct: 142 LGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKI 201

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N L VK FGE E +L++ K+L ++   I  ++++CGG P+    
Sbjct: 202 NSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGIVLSCGGGPHGGYI 261

Query: 208 GFRYWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
           G +YW + GA    VG  +G KF G  +  V + F + G EM  +   E+ NP++TIPK+
Sbjct: 262 GGKYWNDPGA---FVGHDSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKA 318

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFV 325
           +   F+ I   YV  + ++G  +   + +L++  S+ DA +SP VIAI +  IK LP+ +
Sbjct: 319 AKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGLPSLM 378

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ ++S AN+ +Y CSR +  +A  G  PK    V++   P+   V     G L++
Sbjct: 379 NAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPINAIVLTLFFGLLSF 438

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
           +      A VF+++++   +  I  W  I +++I + +A+K +  S+D++PF
Sbjct: 439 VAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERSLDELPF 490

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  228 bits (581), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 129/409 (31%), Positives = 221/409 (54%), Gaps = 9/409 (2%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L R LK R + ++ +G ++GTGL +GSG AL  GGP ++ +A++ TGS++  V+ ++ E+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
               P+   +  Y++R++DP+FGFA  +NY +   + +   + A  + + YW  D     
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 152 -XXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT-TGF 209
                        NFL VK +GE E + ++ K+L +V   I  +++ CGG  N+T   G 
Sbjct: 204 GFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGT 263

Query: 210 RYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           +YW   G   +        F G+ A  V S F F GSEM  +   E+ NP++ +PK++  
Sbjct: 264 KYWHNPGGFAH-------GFKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPKAAKQ 316

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           VF+RI   Y+  + ++G  +   N  L  + S DA+ASPFVIAI  +GI  LP+ +N  +
Sbjct: 317 VFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPSVINVVI 376

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           LV ++S  NT ++  SR    LA  G  PK F  V+R   P+ G +   + G L+++++ 
Sbjct: 377 LVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLLSFLSSS 436

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
           K    VF ++ +   +     W  I + ++ + + ++A+G S D++ F+
Sbjct: 437 KHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFK 485

>KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {ON}
           Anc_3.397 YBR132C
          Length = 582

 Score =  227 bits (579), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 146/505 (28%), Positives = 248/505 (49%), Gaps = 16/505 (3%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIF 86
           ++ +  R+L  R V  + +   +GT L +  G  L +GGP  L IA+ L+   +LC+ + 
Sbjct: 61  RSTSTHRKLLNRHVQFIAISGVIGTALFVAIGKPLYRGGPAFLLIAFALWCIPILCITV- 119

Query: 87  SLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
           S +EM SF P+D  F     +  D +    A WN++    + +   + +   VI YWR D
Sbjct: 120 STAEMVSFFPVDSPFLRLSKKCCDESLAVMASWNFWFLECVQIPFEIVSVNTVINYWRDD 179

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            +  AVKY+GE+E  ++ FK+L+ + ++    I   GG P H  
Sbjct: 180 YSPAIPLVIQVALYALISVCAVKYYGEMEFWMSSFKILLALGLFCFTFITMVGGNPKHKA 239

Query: 207 TGFRYWRESGALPYL------VGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPK 260
            GF+ +R++    Y       +G   G F G+ AC++Q+ F   G E I ++ GE   P+
Sbjct: 240 YGFQNYRKNTFKKYFPDGNENIGSAAGYFQGFLACLIQASFTIAGGEYISMLAGEVKLPR 299

Query: 261 KTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISSSG 317
           K +P++   VF+R+  L++     +G+  S  +  L  A S     A +SP+VIA+++ G
Sbjct: 300 KVMPRAFKQVFWRLTVLFLGSCLCVGIVCSANDPNLTAAISESRPGAGSSPYVIAMNNLG 359

Query: 318 IKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTG 377
           IK+LP+ VNAAL+    S+ N   Y  SR L+G+A DG APK   + N+  VP+      
Sbjct: 360 IKILPDVVNAALITAAFSAGNAYTYCSSRTLHGMALDGYAPKFLAVCNKQGVPIYSVAIS 419

Query: 378 SLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
            +   L+ +    ++A V +++ + ++   ++N+  I I Y+ + RA   +  ++ D+PF
Sbjct: 420 LIWALLSLLQLNSNSAVVLNWLINIITASQLINFACICITYLFFRRAYLLQRDTLPDLPF 479

Query: 438 RMWFQPYAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYF- 495
           + W QPY A              GY  F  K ++ + F+  Y+ VF +  + + YK  + 
Sbjct: 480 KSWGQPYTAIFGLVCVLMMIIVQGYTVFFPKLWNVQDFLFYYLMVFIDAAIYLSYKFIWT 539

Query: 496 --KTKFVKPSEISFRTR-NEHEGEE 517
                F  P +I+F     E E  E
Sbjct: 540 RGSDSFKDPLKINFEPELKEIEMHE 564

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  228 bits (581), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 148/523 (28%), Positives = 253/523 (48%), Gaps = 19/523 (3%)

Query: 2   LEKKGTVVLERPASGXXXXXXXXXXXKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSA 61
           LEK  T     P +G           K+ +L + ++PR V ++ LG+ +GTGL++G+G+A
Sbjct: 96  LEKDETTDKIAPHTGH----------KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTA 145

Query: 62  LAKGGPISLFIAYLFTGSLLCVVIFSLSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWN 120
           L   GP  L I Y   GS+L  +I +  EMA  ++ +  G++ Y +  VD  FGFA  W 
Sbjct: 146 LVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWV 205

Query: 121 YFLKYAIVLSANLTAFGLVIGYWRPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTV 180
           Y L++  V    L    + I YW                    N    + + E E     
Sbjct: 206 YCLQWLCVCPLELVTASMTIKYWTTSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNC 265

Query: 181 FKLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGALPYLVGGGTGKFLGWWACVVQSI 240
            K+L++   +I  +II  GGA N    G +YW E GA   +      +F G  A +V + 
Sbjct: 266 CKILMMTGFFILGIIIDVGGAGNDGYIGGKYWHEPGAFNGV--HAIDRFKGVVATLVTAA 323

Query: 241 FGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAH 300
           F F GSE I I   E +NP+K IP ++  + +RI FL++  + I+G  +   + +L+ + 
Sbjct: 324 FAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIIVGFLVPYNSDQLLGSS 383

Query: 301 STDANASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKI 360
                ASP+VIAI+S G++V P+FVNA +L+ ++S AN+  Y  +R    L++ G APKI
Sbjct: 384 GGGTKASPYVIAIASHGVRVAPHFVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKI 443

Query: 361 FLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYIN 420
           F  ++R   P++     +L   +A+         VF+++ +   +  +  W  I +++I 
Sbjct: 444 FSYIDRAGRPLIAMCVSALFAVIAFCAASPKEDQVFTWLLAISGLSQLFTWTAICLSHIR 503

Query: 421 YDRAIKAKGISIDDIPFR----MWFQPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFIT 476
           + RA+K +G S+ ++ F+    +W   Y+                      K   + F  
Sbjct: 504 FRRAMKVQGRSLGELGFKSQTGVWGSIYSCIMMILILIGQFWVAIAPIGEGKLDAQAFFE 563

Query: 477 SYIGVFANILMVIGYKLYFKT--KFVKPSEISFRTRNEHEGEE 517
           +Y+ +   I++ +GYK++ K    F++  +I   +  +   EE
Sbjct: 564 NYLAMPILIVLYVGYKMWNKDWKLFIRADKIDLTSHRQIFDEE 606

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  227 bits (579), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 139/412 (33%), Positives = 226/412 (54%), Gaps = 5/412 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            N NL+++L  R +  L +G A+GTGL + SG++L  GGP SL I ++   + L  VI S
Sbjct: 84  NNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINS 143

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+A+  P+  GF+ Y+ R+++P+F FA   NY  ++ ++L   L A  + I YW    
Sbjct: 144 LGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDKI 203

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N L VK FGE E +L++ K+L ++   I  +++TCGG P+    
Sbjct: 204 NSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGGYI 263

Query: 208 GFRYWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
           G +YW   GA    VG   G +F G  +  V + F + G EM  +   E+ NPK+TIPK+
Sbjct: 264 GGKYWHNPGA---FVGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKETIPKA 320

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFV 325
           +   F+ I   YV  + ++G  +   + +L++  S+ DA ASP VIAI + GIK LP+ +
Sbjct: 321 AKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIAIENGGIKGLPSLM 380

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ I+S AN+ +Y CSR +  +A  G  PK    V++   P+   +     G L++
Sbjct: 381 NAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFFGLLSF 440

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
           +        VF+++++   +  I  W  I ++ I +  A+KA+G S+D++PF
Sbjct: 441 IAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPF 492

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  227 bits (578), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 135/412 (32%), Positives = 229/412 (55%), Gaps = 5/412 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            +  LS+ L  R +  L +G A+GTGL + SG++L  GGP S+ IA+    + L  ++ S
Sbjct: 105 NSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLISTCLFTIVNS 164

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+AS  P+  GF+ Y+ R+V+P+FGFA   +Y  ++A++L   L A  + I YW    
Sbjct: 165 LGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASITIKYWNNKI 224

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N L VK FGE E +L++ K+L +    I   ++ CGG P     
Sbjct: 225 NSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLICGGGPVGGFI 284

Query: 208 GFRYWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
           G +YW + GA    VG   G +F G  +  V + F + G+E++G+   E+ NP+ TIP++
Sbjct: 285 GAKYWHDPGAF---VGDTPGAQFKGLCSVFVTAAFSYSGTELVGVSAAESINPRYTIPRA 341

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFV 325
           S   F+ I   Y+  + I G  +   + +L++  S+ D  ASP VIAI + GI+ +P+ +
Sbjct: 342 SKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAASPLVIAIENGGIRGVPSLM 401

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ IIS AN+ +Y CSR +  +A+ G  PK+F  ++R   P+V  +   + G L++
Sbjct: 402 NAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPLVAILATLVFGLLSF 461

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
           +        +F+++++   +  +  WF I I++I + RA+ A+  S+D++P+
Sbjct: 462 VAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRSLDELPY 513

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  227 bits (578), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 140/497 (28%), Positives = 249/497 (50%), Gaps = 9/497 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K+ +L + ++PR V ++ LG+ +GTGL++G+G+AL   GP  L I Y   GS+L  +I +
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQA 171

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             EMA  ++ +  G++ Y +  VD  FGFA  W Y L++  V    L    + I YW   
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N    + + E E      K+L++   +I  +II  GGA N   
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGF 291

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G +YW + GA  +       +F G  A +V + F F GSE I I   E ANP+K +P +
Sbjct: 292 IGGKYWHDPGA--FNGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAVPGA 349

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           +  + +RI FL++  + +LG  +   +++L+ +      ASP+VIA++S G++V+P+F+N
Sbjct: 350 AKQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPHFIN 409

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ ++S AN+  Y  +R L  L++ G AP++F  +++   P++     +L G +A+ 
Sbjct: 410 AVILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIAFC 469

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MWFQ 442
                   VF+++ +   +  +  W  I +++I + RA+K +G S+ ++ FR    +W  
Sbjct: 470 AASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGS 529

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKT--KFV 500
            YA                      K   + F  +Y+ +   I + +GYK++ K    F+
Sbjct: 530 TYACIMMILILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWKKDWKLFI 589

Query: 501 KPSEISFRTRNEHEGEE 517
           +  +I   +  +   EE
Sbjct: 590 RADKIDLISHRQIFDEE 606

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  226 bits (575), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 136/420 (32%), Positives = 216/420 (51%), Gaps = 15/420 (3%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           NL R LK R + ++ +G ++GTGL IGSG ALA GGP++L I +   G+ +   I  L E
Sbjct: 84  NLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVGTIHGLGE 143

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           +    P+   F+ Y  R++DP+  F     Y +++  VL   + A  + I YW       
Sbjct: 144 ITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYWNQSIDPV 203

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N    + FGE E L +  K++ ++   I C+++ CGG P+H   G R
Sbjct: 204 VWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPDHDFVGAR 263

Query: 211 YWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNV 270
           YW + G L +        F G  + +V + +   G+EM+ +  GET NP++ +P +    
Sbjct: 264 YWHDPGCLSH-------GFPGVLSVLVVASYSLGGTEMVCLASGET-NPRE-LPSAIKQT 314

Query: 271 FFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAALL 330
           F+RI F ++  + ++G  +   N  L+   S   N SPFVIAI    IK LP+ VNA +L
Sbjct: 315 FWRILFFFLISLTLIGFLVPYTNPNLLGGSSV--NNSPFVIAIKLHHIKALPSIVNAVIL 372

Query: 331 VFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKK 390
           + I+S  N+ I+  SR L  +A  G  PK F  ++R   P+ G +T SL G LA++    
Sbjct: 373 ISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFGLLAFLVKSS 432

Query: 391 SAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF----RMWFQPYAA 446
           S   VF ++ +   +   + W  I I++I +  A+KA+G S+D++ F     MW   Y+A
Sbjct: 433 SMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSAVGMWGSAYSA 492

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  226 bits (575), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 136/412 (33%), Positives = 229/412 (55%), Gaps = 5/412 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            N NL+++L  R +  L +G A+GTGL + +G+AL+ GGP SL I ++  G+ L  VI S
Sbjct: 82  NNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASLVIDWVIIGTCLFTVINS 141

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+++  P+  GF+ Y  R+V+P+F FA   NY  ++ ++L   L A  + I YW    
Sbjct: 142 LGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKI 201

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N L VK FGE E +L++ K+L ++   I  ++++CGG P+    
Sbjct: 202 NSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFSILGIVLSCGGGPHGGYI 261

Query: 208 GFRYWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
           G +YWR  GA    VG  +G KF G  +  V + F + G EM  +   E+ NP++TIPK+
Sbjct: 262 GGKYWRNPGA---FVGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKA 318

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFV 325
           +   F+ I   YV  + ++G  +   + +L++  S+ DA +SP VIAI +  IK LP+ +
Sbjct: 319 AKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGRIKGLPSLM 378

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ ++S AN+ +Y CSR +  +A  G  PK    V++   P+   +     G L++
Sbjct: 379 NAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSF 438

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
           +      A VF+++++   +  I  W  I +++I + +A+K +  S+D++PF
Sbjct: 439 VAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQERSLDELPF 490

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  227 bits (579), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 145/515 (28%), Positives = 251/515 (48%), Gaps = 36/515 (6%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K+  L + +KPR V +++LG+ +GTGL++G GS+L + GP  L I +   GS L  +I +
Sbjct: 154 KSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQA 213

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
           + E+A +++ +  GF+ Y +  VD AF FA  W Y +++  V    L    + I YW   
Sbjct: 214 VGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTK 273

Query: 147 XXXXXXXXXXXXXXXXXNFLA-VKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHT 205
                            N L     + E E +    K+++++  +I  + + CGGA    
Sbjct: 274 VDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDG 333

Query: 206 TTGFRYWRESGALPYLVGGGTG--KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTI 263
             G +YW + GAL     G T   +F G  A +V + F F  SE IG+   E +NP+K I
Sbjct: 334 YIGAKYWHDPGALR----GDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKAI 389

Query: 264 PKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPN 323
           P ++  + +RI  +++  + I+G  +   + +L+ +  +   ASP+V+AIS+ G++V+P+
Sbjct: 390 PSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVPH 449

Query: 324 FVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFL 383
           F+NA +L+ ++S AN+  Y  SR L  LA+ G APKI+  ++R   P+VG  T ++ G +
Sbjct: 450 FINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGVI 509

Query: 384 AYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQP 443
           A+  T      VF ++ +   +  +  W  I I++I + RA+  +G SI ++ FR     
Sbjct: 510 AFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVGW 569

Query: 444 YAAYXXXXXXXXXXXXNGYNAFI-------IKFHYKTFITSYIGVFANILMVIGYKLY-- 494
           Y +               + A +       IK   K F  +Y+ +   +    GYK++  
Sbjct: 570 YGSAYAAIMMFMILIAQFWVALVPINADLTIKLDAKNFFENYLAMPILLAFYFGYKIWKK 629

Query: 495 -------------------FKTKFVKPSEISFRTR 510
                              F  + +K  E  +R R
Sbjct: 630 DWKLFIRAKNIDLISHRNIFDEELIKQEEDEYRER 664

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  226 bits (575), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 135/412 (32%), Positives = 229/412 (55%), Gaps = 5/412 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            N NLS++L  R +  L +G A+GTGL + +G+AL+ GGP SL I ++   + L  VI S
Sbjct: 82  NNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINS 141

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+++  P+  GF+ Y  R+V+P+F FA   NY  ++ ++L   L A  + I YW    
Sbjct: 142 LGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKI 201

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N L VK FGE E +L++ K+L ++   I  ++++CGG P+    
Sbjct: 202 NSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYI 261

Query: 208 GFRYWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
           G +YW + GA    VG  +G +F G  +  V + F + G EM  +   E+ NP++TIPK+
Sbjct: 262 GGKYWHDPGA---FVGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKA 318

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFV 325
           +   F+ I   YV  + ++G  +   + +L++  S+ DA +SP VIAI + GIK LP+ +
Sbjct: 319 AKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLM 378

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ ++S AN+ +Y CSR +  +A  G  PK    V++   P+   +     G L++
Sbjct: 379 NAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSF 438

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
           +      A VF+++++   +  I  W  I +++I + +A+K +  S+D++PF
Sbjct: 439 VAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPF 490

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  225 bits (574), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 134/412 (32%), Positives = 229/412 (55%), Gaps = 5/412 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            N NLS++L  R +  L +G A+GTGL + +G+AL+ GGP SL I ++   + L  VI S
Sbjct: 82  NNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINS 141

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+++  P+  GF+ Y  R+++P+F FA   NY  ++ ++L   L A  + I YW    
Sbjct: 142 LGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDKI 201

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N L VK FGE E +L++ K+L ++   I  ++++CGG P+    
Sbjct: 202 NSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYI 261

Query: 208 GFRYWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
           G +YW + GA    VG  +G +F G  +  V + F + G EM  +   E+ NP++TIPK+
Sbjct: 262 GGKYWHDPGA---FVGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKA 318

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFV 325
           +   F+ I   YV  + ++G  +   + +L++  S+ DA +SP VIAI + GIK LP+ +
Sbjct: 319 AKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGGIKGLPSLM 378

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ ++S AN+ +Y CSR +  +A  G  PK    V++   P+   +     G L++
Sbjct: 379 NAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSF 438

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
           +      A VF+++++   +  I  W  I +++I + +A+K +  S+D++PF
Sbjct: 439 VAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPF 490

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  224 bits (572), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 132/407 (32%), Positives = 216/407 (53%), Gaps = 11/407 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           NL R LK R + ++ +G ++GTGL IGSG ALA GGP+++ I +   G+ +   I  L E
Sbjct: 67  NLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIHGLGE 126

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           +    P+   F+ Y  R++DP+  F     Y L++  VL   + A  + + +W       
Sbjct: 127 VTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTTSVDPV 186

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   V++FG+ + + +V K++ +    I CL++  GG P H   G R
Sbjct: 187 VWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHEFIGAR 246

Query: 211 YWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNV 270
           YW + GAL          F G  A +V + +   GSEM  +  GET +PK+ IP +   +
Sbjct: 247 YWHDPGAL-------ANGFKGVAAVMVTASYSLGGSEMTCLASGET-DPKE-IPHAIKQI 297

Query: 271 FFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAALL 330
           F+RI F ++  + ++G  +   N +L+    ++ N SPFVIAI    I+VLP+ +N  +L
Sbjct: 298 FWRIIFFFLVSLTLVGFLVPYTNDQLLGG--SNVNNSPFVIAIKMHNIRVLPHIINGVIL 355

Query: 331 VFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKK 390
           V I+S  N+ I+  SR L  +A  G  P+IF  V+R   P+ G +T SL G LA++    
Sbjct: 356 VSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLLAFLVKSS 415

Query: 391 SAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
           S  TVF+++ +   +   + W  I +++I +  A+KA+G S+D++ F
Sbjct: 416 STGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEF 462

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  225 bits (573), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 140/480 (29%), Positives = 238/480 (49%), Gaps = 22/480 (4%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
              NL R LK R + ++ +G ++GTGL +GSG A+A GGP+++ I +   GS +   I  
Sbjct: 81  DTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGTIHG 140

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+    P+   F+ Y  R++DP+  F     Y +++  VL   + +  + + YW    
Sbjct: 141 LGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYWNQSI 200

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N    + FGE E + +  K+L +    I C+++ CGG P+H   
Sbjct: 201 DPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDHDFV 260

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW + G L +        F G  + +V + +   G+EM+ +  GET +PK+ +P + 
Sbjct: 261 GAKYWHDPGCLAH-------GFPGVLSVLVVASYSLGGTEMVCLASGET-DPKE-LPSAI 311

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
              F+RI F ++  + ++G  +   N  L+   S   N SPFVIAI    IKVLP+ VNA
Sbjct: 312 KQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSSV--NNSPFVIAIKLHQIKVLPSIVNA 369

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ I+S  N+ I+  SR L  +A  G  P+ F  ++R   P+ G +T SL G LA++ 
Sbjct: 370 VILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGLLAFLV 429

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF----RMWFQP 443
              S + VF ++ +   +   + W  I I++I +  A+KA+G S+D++ F     +W   
Sbjct: 430 KSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVGIWGSA 489

Query: 444 YAAYXXXXXXXXXXXX-----NGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTK 498
           Y+A                   G+    I+   K F  SY+     I++ +G+K++++ K
Sbjct: 490 YSAVINSLILVAQFYCALWPIGGWENSSIR--AKKFFQSYLCALIMIVLFVGHKIFYRYK 547

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  225 bits (574), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 138/497 (27%), Positives = 246/497 (49%), Gaps = 9/497 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K+ +L + ++PR V ++ LG+ +GTGL++G+G+AL   GP  L I Y   GS+L  +I +
Sbjct: 112 KSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             EMA  ++ +  G++ Y +  VD  FGFA  W Y L++  V    L    + I YW   
Sbjct: 172 CGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N    + + E E      K+L++   +I  +II  GGA N   
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGF 291

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G +YW + GA  +       +F G  A +V + F F GSE I I   E +NP+K IP +
Sbjct: 292 IGGKYWHDPGA--FNGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGA 349

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           +  + +RI FL++  + +LG  +   + +L+ +      ASP+VIA++S G++V+P+F+N
Sbjct: 350 AKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFIN 409

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ ++S AN+  Y  +R    L++ G APK+F  ++R   P++     +L   +A+ 
Sbjct: 410 AVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFC 469

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MWFQ 442
                   VF+++ +   +  +  W  I ++++ + RA+K +G S+ ++ F+    +W  
Sbjct: 470 AASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGS 529

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKT--KFV 500
            YA                      K   + F  +Y+ +   I + +GYK++ K    F+
Sbjct: 530 AYACIMMILILIAQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKVWHKDWKLFI 589

Query: 501 KPSEISFRTRNEHEGEE 517
           +  +I   +  +   EE
Sbjct: 590 RADKIDLDSHRQIFDEE 606

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  224 bits (572), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/409 (33%), Positives = 221/409 (54%), Gaps = 9/409 (2%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L R LK R + ++ +G ++GTGL +GSG AL  GGP ++ IA++ TGS++  V+ +L E+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
           A   P+   +  Y++R+++P+FGFA  +NY +   I +   L A  + + YW  D     
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKYAD 208

Query: 152 XXXXXXXXXXX-XNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAP-NHTTTGF 209
                        N   VK +GE E + +V K+  +V   I  +++ CGG P +    G 
Sbjct: 209 AFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIGA 268

Query: 210 RYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           RYW       Y  GG    F G+ A  V S F F GSEM  +   ET NP+K +P+++  
Sbjct: 269 RYW-------YNPGGFAHGFKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLPRAAKQ 321

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           VF+RI   YV  + ++G  +   +  L  A S DA+ASPFVIAI+ +GIK LP+ VN  +
Sbjct: 322 VFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLPSVVNVVI 381

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L+ ++S  N  +Y  SR +  LA  G  P+ F  V+R   P+VG +  ++ G L++++  
Sbjct: 382 LIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLSFLSAS 441

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
            +   VF ++ +   +     W  I + ++ + RA+  +G S D++ ++
Sbjct: 442 SNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYK 490

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  226 bits (576), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 130/425 (30%), Positives = 221/425 (52%), Gaps = 11/425 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K  NL + +KPR   +++LG+ +GTGL++G+   L   GP  L I Y   GS +  +I +
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 88  LSEMAS-FAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             E+A  ++ +  GF+ Y    VDPA GF+  W + L++  V    L    + I YW   
Sbjct: 201 CGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVK 260

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N    K + E +      K+L+++  +I  +II CGGA     
Sbjct: 261 VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGY 320

Query: 207 TGFRYWRESGALPYLVGGGT--GKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
            G +YWR+ GA      G T   +F G  A  V + F F  SE + +   E +NP+K IP
Sbjct: 321 IGSKYWRDPGAFR----GDTPIQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNPRKAIP 376

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
            ++  + +RI F+++  + ++G  +   + +L+ A  +   ASP+VIA+SS G++V+P+F
Sbjct: 377 SAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHF 436

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           +NA +L+ ++S AN+  Y  SR L  LAK G APK F  ++R   P V  +  +L G +A
Sbjct: 437 INAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVIA 496

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MW 440
           +  + K    VF+++ +   +  +  W  I +++I + RA+K +G S+ ++ ++    +W
Sbjct: 497 FCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVW 556

Query: 441 FQPYA 445
              YA
Sbjct: 557 GSAYA 561

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  224 bits (572), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 136/486 (27%), Positives = 241/486 (49%), Gaps = 9/486 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           +  L + +K R V +++LG+ +GTG+++G+G AL  GGP  L I Y   GS L  +I + 
Sbjct: 93  DNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAA 152

Query: 89  SEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            E+A  +  +  GF+ Y +  +DPA GF+  W Y L++  V+   L    + I YW    
Sbjct: 153 GELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTTSV 212

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N    + + E E     FK+L++    I  +I+ CGGA N    
Sbjct: 213 NPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGIIVNCGGAGNDGYI 272

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW + G+  +        F G  + +V + F F  +E I +   E ANP+K+IP ++
Sbjct: 273 GGKYWNDPGS--FSGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIPSAA 330

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             + +RI  LYV  + ++G  +   + +L+ +  +  +ASP+VIAI+S G+KV+P+ +NA
Sbjct: 331 KKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVVPHLINA 390

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ +IS  N+  Y  SR L  LA+ G AP     V+R   P +  V  S+ G ++++ 
Sbjct: 391 VILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTLAMVISSVFGLISFVA 450

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAY 447
                 TVF+++ +   +  +  W  I +++I + RA+K +G S+ ++ F+     + +Y
Sbjct: 451 ASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSY 510

Query: 448 XXXXXXXXXXXXNGYNAFII----KFHYKTFITSYIGVFANILMVIGYKLYFK--TKFVK 501
                         + A       K   + F  +Y+ +   I +  GYK++ +  T ++ 
Sbjct: 511 YATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIP 570

Query: 502 PSEISF 507
            S+I  
Sbjct: 571 ASKIDL 576

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  225 bits (573), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 141/497 (28%), Positives = 245/497 (49%), Gaps = 9/497 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K+G+L + ++PR V ++ LG+ +GTGL++G+G+AL   GP  L I Y   GS+L  +I +
Sbjct: 112 KSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             E+A  ++ +  G++ Y +  VD  FGFA  W Y L++  V    L    + I YW   
Sbjct: 172 CGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N    + + E E      K+L++   +I  +II  GGA N   
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGF 291

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G +YW + GA  +       +F G  A +V + F F GSE I I   E +NP+K IP +
Sbjct: 292 IGGKYWHDPGA--FNGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGA 349

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           +  + +RI FL++  + +LG  +   + +L+ +      ASP+VIAI+S G++V+P+FVN
Sbjct: 350 AKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPHFVN 409

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ ++S AN+  Y  +R    L++ G APK F  ++R   P++     +L   +A+ 
Sbjct: 410 AVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVIAFC 469

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MWFQ 442
                   VF+++ +   +  +  W  I  ++I + RA+K +G S+ ++ F+    +W  
Sbjct: 470 AASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGVWGS 529

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKT--KFV 500
            YA                      K   + F  +Y+ +   I + +GYK++ K    F+
Sbjct: 530 MYACIMMLLILIGQFWVAIAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDWKLFI 589

Query: 501 KPSEISFRTRNEHEGEE 517
           +  +I   +  +   EE
Sbjct: 590 RADKIDLESHRQIFDEE 606

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  225 bits (574), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 129/424 (30%), Positives = 221/424 (52%), Gaps = 7/424 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K+ +L + +KPR V L++LG+ +GTGL++G+GSAL K GP  L I Y   GS L  +I +
Sbjct: 127 KDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAIMGSCLYCIIQA 186

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             EMA +++ +   F+ Y +  VD AFGF+  W Y L++  V+   L    + I YW   
Sbjct: 187 CGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVTASMTIQYWTTT 246

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N    K + E E      K+L++   +I  ++I  GGA N   
Sbjct: 247 VNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGY 306

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G +YW   GA  +       +F    +    + F F  SE I I   E +NP++ IP +
Sbjct: 307 IGAKYWHNPGA--FRGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSA 364

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           +  + +RI F+++  + ++G  +   +++L+ + S    ASP+VIA++S G++V+P+F+N
Sbjct: 365 AKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIAVASHGVRVVPHFIN 424

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ ++S AN+  Y   R LY L++ G AP  F  ++R   P    +  +L   +A+ 
Sbjct: 425 AVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFC 484

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MWFQ 442
                   VF+++ +   +  +  W  I +++I + RA+K +G S+D+I F+    +W  
Sbjct: 485 ACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGS 544

Query: 443 PYAA 446
            YAA
Sbjct: 545 SYAA 548

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  225 bits (573), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 131/417 (31%), Positives = 212/417 (50%), Gaps = 3/417 (0%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L + +KPR V +++LG+ +GTGL++G+  AL   GP  L I Y   GS +  +I +  EM
Sbjct: 142 LKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEM 201

Query: 92  AS-FAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           A  ++ +  GF+ Y +  VDP FGFA  W Y L++  V    L    L I YW       
Sbjct: 202 AVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTTVNPD 261

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                             + + E E      K+L+++  YI  +II  GGA N    G +
Sbjct: 262 AFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAK 321

Query: 211 YWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNV 270
           YW + GA  +    G  +F G  A  V + F F  +E I +   E +NP+K IP ++  V
Sbjct: 322 YWHDPGA--FRGTNGIQRFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKV 379

Query: 271 FFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAALL 330
            +R+  ++V  + +LG  +   + +L+ A  +   ASP+V+AIS  G++V+P+F+NA +L
Sbjct: 380 LYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVPHFINAVIL 439

Query: 331 VFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKK 390
           + + S AN+  Y  SR L GLA+ G APK F  V+R   P       +L G +A+     
Sbjct: 440 ISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASP 499

Query: 391 SAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAY 447
               VF+++ +   +  +  W  I +++I + RA+  +G S+ +I F+     Y +Y
Sbjct: 500 KEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSY 556

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  223 bits (569), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 136/411 (33%), Positives = 225/411 (54%), Gaps = 5/411 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N NL++ L  R +  L +G A+G GL + SG+ALA GGP SL I ++   + L  VI +L
Sbjct: 67  NVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINAL 126

Query: 89  SEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXX 148
            EMA+  P+  GF+ Y+ R+VDP+ GFA   NY  ++ ++L   L A  + I YW     
Sbjct: 127 GEMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNDTIN 186

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          N L VK FGE E +L++ K+L ++   I  ++++CGG P     G
Sbjct: 187 SDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYLG 246

Query: 209 FRYWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
            +YW   G+    VG  +G KF G  +  V + F + G EM  +   E+ +P++TIPK++
Sbjct: 247 GKYWHNPGS---FVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTIPKAA 303

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFVN 326
              F+ I   Y+  + ++G  +     +L+   S+ DA +SP VIAI + GIK LP+ +N
Sbjct: 304 KRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVIAIENGGIKGLPSLMN 363

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ IIS AN+ +Y CSR +  +A  G  P++   +++   PV   +     G L+++
Sbjct: 364 AIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGLLSFV 423

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
                 A VF+++++   +  I  W  I I++I + +A+K +  S+D++P+
Sbjct: 424 AASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPY 474

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  224 bits (572), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 129/422 (30%), Positives = 219/422 (51%), Gaps = 11/422 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           NL + +KPR + +++LG+ +GTGL++G+   L   GP  L I Y   GS +  +I +  E
Sbjct: 142 NLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMGSCIYCIIQACGE 201

Query: 91  MAS-FAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXX 149
           +A  ++ +  GF+ Y +  VDPA GF+  W Y L++  V    L    + I YW      
Sbjct: 202 LAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTVKVDP 261

Query: 150 XXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGF 209
                         N    K + E +      K+L+++  +I  +II CGGA      G 
Sbjct: 262 DVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGYIGS 321

Query: 210 RYWRESGALPYLVGGGTG--KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           RYW   GA      G TG  +F G  A  V + F F  SE + +   E +NP+K IP ++
Sbjct: 322 RYWHNPGAFR----GNTGIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAA 377

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             + +RI F+++  + ++G  +   + +L+ A  +   ASP+VIA++S G++V+P+F+NA
Sbjct: 378 KKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATKASPYVIAVASHGVRVVPHFINA 437

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ ++S AN   Y  SR L  LAK G APK F  ++R   P V  +  S+ G +A+  
Sbjct: 438 VILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSSIFGIIAFCA 497

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MWFQP 443
           +      VF+++ +   +  +  W  I +++I + RA+K +G S+ ++ ++    +W   
Sbjct: 498 SSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGIWGSM 557

Query: 444 YA 445
           YA
Sbjct: 558 YA 559

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  223 bits (568), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 134/425 (31%), Positives = 225/425 (52%), Gaps = 10/425 (2%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N  L + ++PR V +++LG+ +GTGL++G+G+ L   GP  L I Y+   S +  +I + 
Sbjct: 77  NNQLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQAC 136

Query: 89  SEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            EMA ++  +  GF+ Y +  VD A+ FA  W Y +++  V    L    + I YW    
Sbjct: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196

Query: 148 XXXXXXXXXXXXXXXXN-FLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                           N F   + + E E    + K+L++   +I  +I+ CGGA     
Sbjct: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGY 256

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G  YW   GA      G   +F G  + +V + F F  +E + I   E +NP+K IP +
Sbjct: 257 IGVSYWNNPGAFRGHTPGT--RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSA 314

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNS-KLVHAHSTDANASPFVIAISSSGIKVLPNFV 325
           +  V +R  F+YV  + I+G  + P NS +L+ + S+   ASP+VIA++S GI++ P+F+
Sbjct: 315 AKKVIYRALFIYVGSIIIVGFLV-PYNSPELLGSKSSQTKASPYVIAVASHGIRIAPHFI 373

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ ++S AN+  Y  SR L  LAK G APKIF  ++R   P+ G +  SLL  +A+
Sbjct: 374 NAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAF 433

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MWF 441
             +      VFS++ +   +  +  W  I +++I + RA+K +G S++++ ++    +W 
Sbjct: 434 CASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWG 493

Query: 442 QPYAA 446
             YAA
Sbjct: 494 SIYAA 498

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  223 bits (569), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 139/497 (27%), Positives = 243/497 (48%), Gaps = 9/497 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           KN  L + +KPR V L++LG+ +GTGL++G+  AL   GP  L I Y   G+ L  +I +
Sbjct: 102 KNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQA 161

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             E+A S++ +  GF+ Y +  VDPAFGF+  W Y +++  V    L    + I YW   
Sbjct: 162 AGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTT 221

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N    + + E E      K+L+++  +I  ++I  GGA N   
Sbjct: 222 VNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGY 281

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G RYW   GA  +        F G  A +V + F F  +E I +   E +NP+K IP +
Sbjct: 282 IGDRYWHTPGA--FAGDRPIDHFKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAIPSA 339

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           +  V +RI F+++  + ++G  +   + +L+ +  +   ASP+V+A+S+ G+KV+P+F+N
Sbjct: 340 AKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKASPYVLAVSTHGVKVVPHFIN 399

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ ++S  N+  Y  SR LY LA+ G APK F  V+R   P    V   +   +++ 
Sbjct: 400 AVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAIISFC 459

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAA 446
                   VF+++ +   +  +  WF I +++I + +A+  +  S+ +I F+     + +
Sbjct: 460 AASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGS 519

Query: 447 YXXXXXXXXXXXXNGYNAFII----KFHYKTFITSYIGVFANILMVIGYKLYFK--TKFV 500
           Y              + A       K   + F  +Y+ +   IL  +GYK++ K  + F+
Sbjct: 520 YYVCFMLVMILIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYKIWKKDWSLFI 579

Query: 501 KPSEISFRTRNEHEGEE 517
           + + I      +   EE
Sbjct: 580 RANNIDLDKHRQIFDEE 596

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  223 bits (567), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 132/410 (32%), Positives = 216/410 (52%), Gaps = 11/410 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            + NL + LK R + ++ +G ++GTGL IGSG ALA GGP++L I +   G+ +   I  
Sbjct: 69  HSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWTVAGTQMVGTIHG 128

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+    P+   F+ Y  R+++P+  F     Y L++  VL   + A  + + YW    
Sbjct: 129 LGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWGSSV 188

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N L V+ FGE E + ++ K+L ++   I C+++ CGG P H   
Sbjct: 189 PPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCVVLICGGGPKHEFV 248

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW + G L          F G  A  V + +   G+EM  +  GET +PK+ +P + 
Sbjct: 249 GAKYWSDPGPL-------ANGFKGVAAVFVIASYSLGGTEMACLASGET-DPKE-LPSAI 299

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             VF+RI F ++  + ++G  +   N  L+   S D   SPFVIAI   GIK LP+ VNA
Sbjct: 300 KQVFWRIVFFFLVSLTLVGFLVPYTNENLMGGSSVDN--SPFVIAIRLHGIKALPSVVNA 357

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +LV ++S  N+ I+  SR L  +A  G  P+IF  ++R   P+VG +T    G LA++ 
Sbjct: 358 VILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVGILTNLAFGLLAFLV 417

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
              S+  VF+++ +   +   + W  I +++I +  A+KA+G+S+D++ F
Sbjct: 418 KSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLDELEF 467

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  224 bits (570), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 128/425 (30%), Positives = 220/425 (51%), Gaps = 11/425 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K  NL + +KPR   +++LG+ +GTGL++G+   L   GP  L I Y   GS +  +I +
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 88  LSEMAS-FAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             E+A  ++ +  GF+ Y +  VDPA GF+  W + L++  V    L    + I YW   
Sbjct: 201 CGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVK 260

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N    K + E +      K+L++   +I  +II CGGA     
Sbjct: 261 VNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGY 320

Query: 207 TGFRYWRESGALPYLVGGGTG--KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
            G RYWR+ GA      G T   +F G  A  V + F F  SE + +   E +NP+K IP
Sbjct: 321 IGSRYWRDPGAFR----GDTSIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIP 376

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
            ++  + +RI F+++  + ++G  +   + +L+ A  +   ASP+VIA+SS G++V+P+F
Sbjct: 377 SAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHF 436

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           +NA +L+ ++S AN+  Y  SR L  LAK G APK F  ++R   P V  +  ++ G +A
Sbjct: 437 INAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIA 496

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MW 440
           +  + K    VF+++ +   +  +  W  I +++I + + +K +G S+ ++ ++    +W
Sbjct: 497 FCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGVW 556

Query: 441 FQPYA 445
              YA
Sbjct: 557 GSAYA 561

>TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {ON}
           Anc_3.397 YBR132C
          Length = 585

 Score =  222 bits (566), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 141/498 (28%), Positives = 240/498 (48%), Gaps = 14/498 (2%)

Query: 33  SRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFSLSEM 91
            R L  R V  + +   +GT L +  G  L +GGP SL +A+ L+   +LC+ + S +EM
Sbjct: 76  QRRLLNRHVQFIAISGVIGTALFVAIGKPLYRGGPGSLLLAFILWCVPILCITV-STAEM 134

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
             F P+   F    N+ VD +    A WN+++   + +   + +   +I YW  +     
Sbjct: 135 VCFLPISSPFLRLANKCVDNSMAMMASWNFWVLECVQIPLEIVSVNTIIQYWTDNYSPAF 194

Query: 152 XXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRY 211
                       +F AVKY+GE+E  L  FK+++ + ++        G  P H   GFR 
Sbjct: 195 PLLIQVLLYLLISFCAVKYYGELEFWLASFKIILAIGLFCFTFFTILGANPKHDRYGFRN 254

Query: 212 WRESGALPYLVGGGT------GKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           + ES    Y   G T      G F G+  C++Q+ F   G E I ++ GE   P++ +PK
Sbjct: 255 FSESPFKTYFPNGNTSSGDMYGYFHGFANCLIQASFTMAGGEYISMLAGEVKLPREVLPK 314

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKL---VHAHSTDANASPFVIAISSSGIKVLP 322
           +   VF+R+  +++     +GL  SP +  L   ++     A +SP+VIA+++ GI+++P
Sbjct: 315 AFKQVFYRLTIIFIGSCICVGLICSPNDKNLTASINEARPGAGSSPYVIAMNNLGIRIVP 374

Query: 323 NFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGF 382
           + VN  L+    S+ N   Y  SR LYG+A DG APKIF    +  VP+       L   
Sbjct: 375 DIVNGGLITAAFSAGNAYTYCSSRTLYGMALDGYAPKIFTTCTKNGVPLYAVGVSLLWAV 434

Query: 383 LAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQ 442
           L+ +    ++A V +++ + V+   ++N+  + I Y+ + +A   +  S+ ++PF+ W Q
Sbjct: 435 LSLLQLNSNSAIVLNWLINLVTASQLINFVNLCIIYLFFRKAYLLQKDSLPELPFKSWGQ 494

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYF-KTKFV 500
           P+ AY             GY  F    + ++ F+  Y  VF +I + I  K++    +F 
Sbjct: 495 PFTAYFGLFSALIMTFVQGYTVFYSNLWTFRDFLFCYFMVFLDIGLYIYCKIFQGPDEFK 554

Query: 501 KPSEISFRTR-NEHEGEE 517
            P  + F T   E E  E
Sbjct: 555 SPENVDFATDLKEIEAHE 572

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  224 bits (570), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 130/425 (30%), Positives = 219/425 (51%), Gaps = 11/425 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K  NL + +KPR   +++LG+ +GTGL++G+   L   GP  L I Y   GS +  +I +
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 88  LSEMAS-FAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             E+A  ++ +  GF+ Y    VDPA GF+  W + L++  V    L    + I YW   
Sbjct: 201 CGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTS 260

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N    K + E +      K+L++V  +I  +II CGGA     
Sbjct: 261 VNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGY 320

Query: 207 TGFRYWRESGALPYLVGGGT--GKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
            G +YWR+ GA      G T   +F G  A  V + F F  SE + +   E +NP+K IP
Sbjct: 321 IGSKYWRDPGAFR----GDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIP 376

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
            ++  + +RI F+++  + ++G  +   + +L+ A  +   ASP+VIA+SS G++V+P+F
Sbjct: 377 SAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPHF 436

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           +NA +L+ ++S AN   Y  SR L  LAK G APK F  ++R   P    +  +L G +A
Sbjct: 437 INAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIA 496

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MW 440
           +  + K    VF+++ +   +  +  W  I +++I + RA+K +G S+ ++ ++    +W
Sbjct: 497 FCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVW 556

Query: 441 FQPYA 445
              YA
Sbjct: 557 GSAYA 561

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  223 bits (569), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 139/493 (28%), Positives = 246/493 (49%), Gaps = 10/493 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K+  L   +KPR V +++LG+ +GTG+++G+G++LA  GP  L I Y   GS +  +I +
Sbjct: 119 KSEELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQA 178

Query: 88  LSEMAS-FAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             EMA  ++ +  GF+ Y +  ++PA GF+  W Y +++  V    L    + I YW   
Sbjct: 179 TGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTK 238

Query: 147 XXXXXXXXXXXXXXXXXNFLA-VKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHT 205
                            N L     + E E      K+L+L+  +I  +I+ CGGA +  
Sbjct: 239 VDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDG 298

Query: 206 TTGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
             G RYW + GA  +       +F G  + +V + F F  SEMIG+   E +NP+K IP 
Sbjct: 299 YIGGRYWHDPGA--FRGEHAIDRFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKAIPS 356

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFV 325
           ++  + +RI  +Y+  V I+G  +   + +L+ +      ASP+V+A+S+ G++V+P+F+
Sbjct: 357 AAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGVRVVPHFI 416

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ ++S AN+  Y  SR L GLA+ G APKIF  V+R   P +G    +L+  +++
Sbjct: 417 NAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNVISF 476

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYA 445
             T      VF ++ +   +  +  W  I +++I + RA+  +G S+ +I F+     + 
Sbjct: 477 CATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCGVWG 536

Query: 446 AYXXXXXXXXXXXXNGYNAFII----KFHYKTFITSYIGVFANILMVIGYKLYFKT--KF 499
           ++              + A       +   + F  +Y+     I +  GYK+Y K    F
Sbjct: 537 SWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYTKDWRLF 596

Query: 500 VKPSEISFRTRNE 512
           ++  +I      +
Sbjct: 597 IRAKDIDLDINRD 609

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  222 bits (566), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 134/409 (32%), Positives = 228/409 (55%), Gaps = 5/409 (1%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            ++++L  R +  L +G A+GTGL + SG+AL+ GGP SL I ++   + L  V+ SL E
Sbjct: 95  QMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIISTCLFTVVNSLGE 154

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           +A+  P+  GF+ Y+ R++DP+FGFA   NY  ++ ++L   L A  + I YW       
Sbjct: 155 LAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITIRYWNDKINSD 214

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N L VK FGE E +L++ K+L +V   I  ++++CGG P     G +
Sbjct: 215 AWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCGGGPKGGYIGGK 274

Query: 211 YWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YW + GA    VG  +G KF G  +  V + F + G E+  +   E+ NP++TIPK++  
Sbjct: 275 YWHDPGA---FVGETSGTKFKGLCSVFVTAAFSYSGMELTAVSAAESLNPRETIPKAAKR 331

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFVNAA 328
            F+ I   YV  + ++G  +   N KL++  S+ DA +SP VIAI + GI+ LP+ +NA 
Sbjct: 332 TFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLVIAIENGGIRGLPSLMNAI 391

Query: 329 LLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNT 388
           +L+ I+S AN+ +Y CSR +  +A+    P+    V+R   P+   +     G L+++  
Sbjct: 392 ILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATLLTLFFGLLSFIAA 451

Query: 389 KKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
                 VF+++++   +  I  W  I +++I + +A+  +GIS+D++P+
Sbjct: 452 SDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDELPY 500

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  222 bits (565), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 134/408 (32%), Positives = 222/408 (54%), Gaps = 5/408 (1%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L  +LK R + ++ +G A+GTGL +GSG AL   GP  + I +  TG+++  ++ +L E+
Sbjct: 88  LQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMALGEL 147

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWR-PDXXXX 150
           A   P+  GF+ Y  R++D +FGFA  +NY L++ +VL   + A  + + YW  P     
Sbjct: 148 AVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVRYTD 207

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   V+ +GE E + ++ K+  ++   I  +++ CGG P     G R
Sbjct: 208 GFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYVGAR 267

Query: 211 YWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YW   GA    VG  +G KF G+ +  V + F F GSE+IG+   E  NP+K +P ++  
Sbjct: 268 YWHNPGAF---VGSTSGQKFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVPSAAKQ 324

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           VF+RI   Y+  + ++G  +   + +L+ + S DA+ASPFVIAI + GI  LP+ +N  +
Sbjct: 325 VFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVTHGISGLPSVINVVI 384

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L+ ++S  N+ IY CSR L  L++ G  PKI   ++R   P+VG    S  G +A++   
Sbjct: 385 LISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIAFVAAS 444

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
                +F+++ +   +     W  I I +I +  A+KA+G   D++PF
Sbjct: 445 NKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPF 492

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  221 bits (564), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 149/474 (31%), Positives = 244/474 (51%), Gaps = 9/474 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N +L+++L  R +  L +G A+G GL + SG+ALA GGP SL I ++   + L  VI SL
Sbjct: 75  NKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSL 134

Query: 89  SEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXX 148
            E+A+  P+  GF+ Y+ R+VDP+F FA   NY  ++ ++L   L A  + I YW     
Sbjct: 135 GELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNSTIN 194

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          N L VK FGE E +L++ K+L ++   I  ++++CGG P     G
Sbjct: 195 SDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLG 254

Query: 209 FRYWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
            +YW   GA    VG  +G KF G  +  V + F + G EM  +   E+ +P+KTIPK++
Sbjct: 255 GKYWHNPGA---FVGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPKAA 311

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFVN 326
              F+ I   YV  + ++G  +   + +L+   S+ DA ASP VIAI + GIK L + +N
Sbjct: 312 KRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAASPLVIAIENGGIKGLDSLMN 371

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ IIS AN+ +Y CSR +  +A  G  PK    V++   P+   +     G L+++
Sbjct: 372 AIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLSFI 431

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MWFQ 442
                   VF+++++   +  I  W  I I++I + +A+  +  S+D++P+     +W  
Sbjct: 432 AASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGVWGS 491

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFK 496
            Y               + +         ++F   Y+ +   I+  IG+KLYFK
Sbjct: 492 LYGVVVLFLVLVASFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLYFK 545

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  221 bits (563), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 130/412 (31%), Positives = 229/412 (55%), Gaps = 5/412 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K+  L+++L  R +  L +G A+GTGL + SG +L+ GGP SL IA+    + L  ++ S
Sbjct: 60  KDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNS 119

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+++  P+  GF+ Y+ R+V+P+FGFA  +NY  ++AI+L   L A  + I YW    
Sbjct: 120 LGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILLPLELCAASITIRYWNKSI 179

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N L VK FGE E +L++ K+L ++   I  +++ CGG P+    
Sbjct: 180 NPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFI 239

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW + GA  ++      +F G  A  + + F + G E++G+   E+ NP+ T+PK++
Sbjct: 240 GGKYWNDPGA--FVGDTPAQRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLPKAA 297

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLV--HAHSTDANASPFVIAISSSGIKVLPNFV 325
              F+ I   Y+  + ++G  + P N  L+     S DA ASP VIAI + GIK LP+ +
Sbjct: 298 KRTFWLITMSYLVILTLIGCLV-PSNDPLLLNGTSSVDAAASPLVIAIQNGGIKGLPSLM 356

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ ++S AN+ +Y CSR +  +A+ G  P+    V++   P+       L+G L++
Sbjct: 357 NAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLLSF 416

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
           +        VF+++++   +  +  WF I +A++ +  A+K +  S++++P+
Sbjct: 417 IAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPY 468

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  222 bits (565), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 148/488 (30%), Positives = 248/488 (50%), Gaps = 10/488 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K+  L + +KPR V +++LG+ +GTGL++G GS+L   GP  L + +   G+ L  +I +
Sbjct: 145 KSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQA 204

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
           + EMA +++ +  GF+ Y +  VDPAFGF+  W Y L++  V    L    + I YW   
Sbjct: 205 VGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTK 264

Query: 147 XXXXXXXXXXXXXXXXXNFLA-VKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHT 205
                            N +     + E E +    K+L+++  +I  +II CGGA N  
Sbjct: 265 VDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDG 324

Query: 206 TTGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
             G +YW E GA  +       +F G  A +V + F F  SE IG+   E +NP+K IP 
Sbjct: 325 YIGGKYWHEPGA--FRGEHAIDRFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPS 382

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFV 325
           ++  + +RI  +++  + I+G  +   + +L+ +      ASP+V+A+S+ G+KV+P+F+
Sbjct: 383 AAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVKVVPHFI 442

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ ++S AN+  Y  SR L  LA+ G APKIF  ++R   P+VG    SL G +A+
Sbjct: 443 NAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAF 502

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MWF 441
             T      VF ++ +   +  +  W  I ++++ + RA+  +G SI ++ FR     W 
Sbjct: 503 CATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWG 562

Query: 442 QPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFK--TKF 499
             YAA                     K   K F  +Y+ +   + +  GYK+Y K  T F
Sbjct: 563 SSYAAIMMVCILIAQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKNWTIF 622

Query: 500 VKPSEISF 507
           ++  +I  
Sbjct: 623 IRAKDIDL 630

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  219 bits (559), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 133/410 (32%), Positives = 226/410 (55%), Gaps = 7/410 (1%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           NL+++L  R +  L +G ++GTGL + SG++L  GGP SL I ++   S L  VI +L E
Sbjct: 77  NLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGE 136

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           +A+  P+  GF+ Y+ R+VDP+F FA   NY + + + L   L A  + I YW  +    
Sbjct: 137 LAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYWNREINSD 196

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N + VK+F E E ++++ K+L +V  +I  +++  GG P     G +
Sbjct: 197 AWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGK 256

Query: 211 YWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YW + GA     G   G +F G  +  V + F + G EM  +   E+ NP+KTIPK++  
Sbjct: 257 YWNDPGAFH---GDSAGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKATKR 313

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSK--LVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
            F+ I F Y+  + ++G+ + P N K  L  + S DA+ASP VIAI ++GIK LP+ +NA
Sbjct: 314 TFWVITFSYISILTLIGILV-PYNDKRLLSGSSSVDASASPLVIAIENAGIKGLPSLMNA 372

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ ++S AN+ +Y+CSR +  +A     PK+F  V++   P+        +G L+++ 
Sbjct: 373 IILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIA 432

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
                  VF+++++   +  I  W  I +A+I +  A+K +  S+D++ +
Sbjct: 433 ASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAY 482

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  220 bits (560), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 143/476 (30%), Positives = 244/476 (51%), Gaps = 9/476 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K+  L + +KPR V +++L + +GTG+++G+G +L  GGP SL I Y    ++L  VI S
Sbjct: 83  KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142

Query: 88  LSEMAS-FAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
            SE+A  +  +  GF+ Y    VD AF F+  W Y L++  +L   L    + I YW   
Sbjct: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            NF+    + E E      K+L+L+  +I  +I+ CGGA N   
Sbjct: 203 INPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGNDGY 262

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G  YW + GA  +    G  +F G  A +V + F + G+E   +   E  NP+K+I  +
Sbjct: 263 LGSVYWHDPGA--FRGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSA 320

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNS-KLVHAHSTDANASPFVIAISSSGIKVLPNFV 325
           S  + +RI  +Y+    +LG  + P NS +L+ + S   +ASPFVIAI+S G+KV+P+ +
Sbjct: 321 SKKLVYRIIGIYLMTAALLGFLV-PYNSPELLGSGSAATHASPFVIAIASHGVKVVPHII 379

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ ++S AN+ +Y  SR L  L++ G APK+F  V+R   PV   +   + G L +
Sbjct: 380 NAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLLCF 439

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYA 445
           +       TVF+++ +   +  +  WF I ++++ + R++  +G S+D++ ++ W   + 
Sbjct: 440 VAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGVWG 499

Query: 446 AYXXXXXXXXXXXXNGYNAFII----KFHYKTFITSYIGVFANILMVIGYKLYFKT 497
           AY              + A       K     F  +Y+ +   I + +GYKL+++ 
Sbjct: 500 AYYAMIMILLILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYRD 555

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  220 bits (561), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 144/492 (29%), Positives = 243/492 (49%), Gaps = 9/492 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K  +L + +KPR V +++LG+ +GTGL++G+  AL   GP  L I Y   GS +  +I +
Sbjct: 121 KEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYAIMGSCIYCIIQA 180

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             EMA +++ +  GF+ Y +  V P  GFA  W Y+L++A V    L    + I YW   
Sbjct: 181 AGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELVTASMTIKYWTTK 240

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N    + + E E      K+L++   +I  +II CGGA N   
Sbjct: 241 VNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGIIINCGGAGNDGY 300

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G +YW + GA  +       +F G  A +V + F F GSE I +   E +NP+K IP +
Sbjct: 301 IGGKYWHDPGA--FRGDKAIDRFKGVAATLVTAAFAFGGSEFIALTASEQSNPRKAIPAA 358

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           +  + +RI  +++  + ++G  +   + +L+ + S+   ASP+VIAISS G++V+P+FVN
Sbjct: 359 AKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVIAISSHGVRVVPHFVN 418

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ ++S  N+  Y  SR L  L++ G APK F  ++R   P    V G+L   +A+ 
Sbjct: 419 AVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPARAMVIGALFAVIAFC 478

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MWFQ 442
                   VF+++ +   +  I  W  I +++I + RA+  +G S+ +I F+    +W  
Sbjct: 479 AASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKSELGVWGS 538

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFK--TKFV 500
            YAA                   + K   ++F  SY+ +   I   +GY  + K  T F+
Sbjct: 539 YYAAGMMFLVLIAQFWVGLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFWKKDWTLFI 598

Query: 501 KPSEISFRTRNE 512
           +  +I      +
Sbjct: 599 RAKDIDLDHHRQ 610

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  219 bits (558), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 134/412 (32%), Positives = 223/412 (54%), Gaps = 5/412 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            N NL++ L  R +  L +G ++G GL + SG+ALA GGP SL I ++   + L  VI +
Sbjct: 71  NNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINA 130

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L EMA+  P+  GF+ Y+ R++DP+ GFA   NY  ++ ++L   L A  + I YW    
Sbjct: 131 LGEMAAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNETI 190

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N L VK FGE E +L++ K+L ++   I  +++ CGG P+    
Sbjct: 191 NSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGFI 250

Query: 208 GFRYWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
           G +YW   G+    VG  +G KF G  +  V + F + G EM  +   E+ +P+ TIPK+
Sbjct: 251 GGKYWNHPGS---FVGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKA 307

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFV 325
           +   F+ I   YV  + ++G  +   + +L+   S+ DA +SP VIAI + GIK LP+ +
Sbjct: 308 AKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLPSLM 367

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ IIS AN+ +Y CSR +  +A  G  P+I   V+    P+   +     G L++
Sbjct: 368 NAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSF 427

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
           +      A VF+++++   +  I  W  I +++I + +++  +  S+D++PF
Sbjct: 428 VAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPF 479

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  218 bits (554), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 132/407 (32%), Positives = 214/407 (52%), Gaps = 11/407 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           +L R LK R + ++ +G ++GTGL +GSG ALA GGP+++ I +L  G+ +   I  L E
Sbjct: 76  SLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMVGTIHGLGE 135

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           +    P+   F+ Y  R++DP+  F     Y L++  VL   + A  + I +W       
Sbjct: 136 ITVRFPVVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQFWNTSIDPV 195

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   V+ FGE E L +  K++ +    I C+++  GG P H   G R
Sbjct: 196 VWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGPTHEYVGAR 255

Query: 211 YWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNV 270
           YW + GAL +        F G  +  V + +   GSEM  +  GET +PK+ +P +   V
Sbjct: 256 YWHDPGALAH-------GFKGVASVFVTASYSLGGSEMACLASGET-DPKE-LPSAIKQV 306

Query: 271 FFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAALL 330
           F+RI F ++  + ++G  +   N  L+   S   N SPFVIA +   IKVLP+ +NA +L
Sbjct: 307 FWRIIFFFLVSLTLVGFLVPYTNQNLLGGSSV--NNSPFVIACNLYHIKVLPSIINAVIL 364

Query: 331 VFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKK 390
           V I+S  N+ I+  SR L  +A  G  P+IF  V+R   P+VG +T SL G LA++    
Sbjct: 365 VSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLFGLLAFLVKSS 424

Query: 391 SAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
           S + VF+++ +   +   + W  I +++I +  A+KA+  ++D++ F
Sbjct: 425 SMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDELEF 471

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  218 bits (554), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 146/501 (29%), Positives = 241/501 (48%), Gaps = 28/501 (5%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
              NL R LK R + ++ +G ++GTGL IGSG ALA GGP+++ I +   GS +   I  
Sbjct: 59  DTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWTIAGSQIVGTIHG 118

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+    P+   F+ Y  R++DP+  F     Y +++  VL   + A  + I YW    
Sbjct: 119 LGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIASAITIQYWNSSI 178

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N    + FGE E + +  K + +    I C+++ CGG P+H   
Sbjct: 179 DPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIVLICGGGPDHEFI 238

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW + GAL +        F G  + +V + +   G+EM  +  GET +PK+ +P + 
Sbjct: 239 GAKYWHDPGALAH-------GFPGVLSVLVVASYSLGGTEMTCLASGET-DPKE-LPSAI 289

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             VF+RI F ++  + ++G  +   N  L+   S D   SPFVIAI    IK LP+ VNA
Sbjct: 290 KQVFWRILFFFLASLTLVGFLVPYTNENLLGGSSVDN--SPFVIAIKLHHIKALPSIVNA 347

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ I+S  N+ I+  SR L  +A  G  P+ F  ++R   P+ G VT SL G LA++ 
Sbjct: 348 VILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAGIVTNSLFGLLAFLV 407

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MWFQP 443
              S + VF ++ +   +   + W  I +++I +  A+KA+  ++D++ F     +W   
Sbjct: 408 KSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLDELEFVSAVGIWGSA 467

Query: 444 YAAYXXXXXXXXXXXXN-----GYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTK 498
           Y+A             +     G+         K F  SY+     +L+   +K+Y++  
Sbjct: 468 YSALINVLILIAQFYISLWPIGGWTDS--SQRAKKFFQSYLCALIMLLIFCIHKVYYRVS 525

Query: 499 F-----VKP-SEISFRTRNEH 513
           F     VKP  +I   T  ++
Sbjct: 526 FGKWWDVKPLKDIDLETGRKN 546

>NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON} 
          Length = 558

 Score =  217 bits (553), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 140/510 (27%), Positives = 246/510 (48%), Gaps = 15/510 (2%)

Query: 4   KKGTVVLERPASGXXXXXXXXXXXKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALA 63
           KK  VV+E   S               +L R LKPR ++++++   +GTGL + +  +L 
Sbjct: 26  KKNEVVVELDPSLTTEEDYDPEANIREDLQRALKPRHINMISIAGVIGTGLYLSTAKSLY 85

Query: 64  KGGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFL 123
           +GGP SLF+ Y   G ++ + +  L EM+++ P+   F  Y  ++   +F  A  WNY+ 
Sbjct: 86  QGGPASLFMNYTIMGGVVYLTLLCLGEMSTYMPISGSFCSYAKKFGSESFACALMWNYWF 145

Query: 124 KYAIVLSANLTAFGLVIGYWRPDXX---XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTV 180
             A+ +++++TA  LV+ YW  +                    N + V+++GE E  L +
Sbjct: 146 NDAVSVASDMTALQLVMDYWDTEASGFPYWAASLLFWFLVVLLNVIHVRFYGEAEYWLAM 205

Query: 181 FKLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGALPYLVGGGTGKFLGWWACVVQSI 240
            K++ ++I +I  +++  G  P H   GF+ W   G  P++ G     F G+ +  V + 
Sbjct: 206 LKVIAIIIFFILSIVVNVGHNPQHEYIGFKNWNH-GEAPFVDG-----FKGFASLFVSAS 259

Query: 241 FGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAH 300
           F + G+E I +  GE ANP +  PK    VF+RI   YV   F + + I P +   +   
Sbjct: 260 FAYGGTESITLTNGEAANPLRNTPKIVKTVFWRILVFYVGSTFFIAMNI-PYDYPGLDTK 318

Query: 301 STDANASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAP-K 359
           S     SPF +    +G K   +F+NA ++  +IS+ N  ++  SR +Y +  +G  P K
Sbjct: 319 S--VVTSPFTLVFQMAGTKAAGSFMNAVIMTSVISACNHALFAGSRVMYNMGLEGFLPKK 376

Query: 360 IFLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYI 419
           I    NR+KVP V  +  S +G L +  +   A TV++++ + V V   + W  I I  I
Sbjct: 377 IVSRTNRYKVPYVSVLITSSIGLLCFGASFIGAGTVWTWLQNIVGVSNQIAWLCIGITSI 436

Query: 420 NYDRAIKAKGISIDDIPFRMWFQPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYI 479
            + + ++ +G    ++ ++ W  PY  Y             G++AF   +    F + Y+
Sbjct: 437 RFRKGLEKQG-KTHELRYKNWTYPYGPYFLVIFVTFIILVQGWSAF-DPWDVTNFFSYYL 494

Query: 480 GVFANILMVIGYKLYFKTKFVKPSEISFRT 509
            +F      I + LY + +FVK  ++ F T
Sbjct: 495 DLFVFPFCFIIWWLYKRDRFVKLEDMDFVT 524

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  215 bits (547), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 127/410 (30%), Positives = 213/410 (51%), Gaps = 11/410 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            + NL + LK R + ++ +G ++GTGL IGSG ALA GGP++L I +   G+ +   I  
Sbjct: 69  HSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHG 128

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+    P+   F+ Y  R+++P+  F     Y L++  VL   + A  + + YW    
Sbjct: 129 LGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSV 188

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N + V+ FGE E + ++ K++ +V   I C+++ CGG P     
Sbjct: 189 SPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFV 248

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW + G L          F G    +V + +   G+EM  +  GET +PK+ +P + 
Sbjct: 249 GAKYWHDPGPL-------ANGFKGVAGVLVIASYSLGGTEMACLASGET-DPKE-LPSAI 299

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             VF+RI F ++  + ++G  +   N  L+   S D   SPFVIAI   GI  LP+ VNA
Sbjct: 300 KQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSSVDN--SPFVIAIRLHGINALPSIVNA 357

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +LV ++S  N+ I+  SR L  +A  G  P++F  ++R   P+ G +T  L G LA++ 
Sbjct: 358 VILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLV 417

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
              SA  VF+++ +   +   + W  I I++I +  A+KA+G+ ++++ F
Sbjct: 418 KSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEF 467

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  215 bits (547), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 127/410 (30%), Positives = 213/410 (51%), Gaps = 11/410 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            + NL + LK R + ++ +G ++GTGL IGSG ALA GGP++L I +   G+ +   I  
Sbjct: 69  HSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMVGTIHG 128

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+    P+   F+ Y  R+++P+  F     Y L++  VL   + A  + + YW    
Sbjct: 129 LGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEYWDTSV 188

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N + V+ FGE E + ++ K++ +V   I C+++ CGG P     
Sbjct: 189 SPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGPKKEFV 248

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW + G L          F G    +V + +   G+EM  +  GET +PK+ +P + 
Sbjct: 249 GAKYWHDPGPL-------ANGFKGVAGVLVIASYSLGGTEMACLASGET-DPKE-LPSAI 299

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             VF+RI F ++  + ++G  +   N  L+   S D   SPFVIAI   GI  LP+ VNA
Sbjct: 300 KQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSSVDN--SPFVIAIRLHGINALPSIVNA 357

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +LV ++S  N+ I+  SR L  +A  G  P++F  ++R   P+ G +T  L G LA++ 
Sbjct: 358 VILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLFGLLAFLV 417

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
              SA  VF+++ +   +   + W  I I++I +  A+KA+G+ ++++ F
Sbjct: 418 KSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEF 467

>KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.397
           YBR132C
          Length = 592

 Score =  217 bits (552), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 144/506 (28%), Positives = 234/506 (46%), Gaps = 17/506 (3%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N    R+L  R V  + +   +GT L +  G  L  GG   L IA+      +  +  S 
Sbjct: 77  NIRTHRKLLNRHVQFIAISGVIGTALFVAIGKGLYYGGAGFLLIAFAMWCVPILAITVST 136

Query: 89  SEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXX 148
           +EM SF P+   F     + VD +    A WN++    + +   + +   VI YWR D  
Sbjct: 137 AEMVSFFPVSSPFLRLAKKCVDESLAVMASWNFWFLECVQIPYEIVSVNTVIHYWRDDYN 196

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          +  AVKY+GE+E  L  FK+++ V ++   L+   GG P H   G
Sbjct: 197 PAIPLVVQSVMYILISVCAVKYYGEMEFWLASFKIVLAVGLFFFTLVTMVGGNPKHDVYG 256

Query: 209 FRYWRESGALPYLVGGGT------GKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKT 262
           FR +R      Y   G        G F G+  C++++     G E I ++ GE   P+K 
Sbjct: 257 FRNFRIDSFKKYYPDGNDAHSRSVGYFQGFLVCLIRAAATIAGGEYIAMLAGEVKEPRKV 316

Query: 263 IPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISSSGIK 319
           +PK+   VF R+  L++     +G+  S  +  L  A S     A +SP+VIA+++ GI+
Sbjct: 317 LPKAFRQVFVRLTVLFLGSCLCVGIVCSSNDPALTAAISESRPGAGSSPYVIAMNNLGIR 376

Query: 320 VLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSL 379
           VLP+ VN AL+    S+ N   Y  SR LYG+A DG APKIF   N+  VP+        
Sbjct: 377 VLPDIVNIALITAAFSAGNAYTYCSSRTLYGMALDGYAPKIFKKCNKQGVPMFAVAVSLC 436

Query: 380 LGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRM 439
              ++ +    ++A V +++ + +    ++N+  + I Y+++ RA   +  ++  +PF+ 
Sbjct: 437 WALISLLQLNSNSAVVLNWLINIIVSSQLINFVALCIIYLHFRRAYLLQQDNLPGLPFKS 496

Query: 440 WFQPYAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYF--- 495
           W+QP+ A              GY  F  K +  + F+  Y+ VF ++ + + YK  +   
Sbjct: 497 WWQPWTAIFGMSCSVAMILIQGYTVFFPKLWKARDFLFYYLMVFIDVGIYLFYKFVWTHG 556

Query: 496 KTKFVKPSEISF----RTRNEHEGEE 517
           K K   P+ I F    R   EHE E 
Sbjct: 557 KDKVKDPTLIDFSEDLREIEEHELEH 582

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  217 bits (552), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 131/411 (31%), Positives = 224/411 (54%), Gaps = 5/411 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N NL+++L  R +  L +G ++G GL + SG+ALA GGP SL I ++   + L  VI +L
Sbjct: 89  NENLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINAL 148

Query: 89  SEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXX 148
            E+A+  P+  GF+ Y+ R+VDP+  FA   NY  ++ ++L   L A  + I YW     
Sbjct: 149 GELAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYWNDTIN 208

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          N L VK FGE E +L++ K+L ++   I  +++ CGG P     G
Sbjct: 209 SDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLG 268

Query: 209 FRYWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
             YW + G+    VG   G +F G  +  V + F + G E+  +   E+ +P+KTIPK++
Sbjct: 269 GHYWHDPGS---FVGDKPGTQFKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKTIPKAT 325

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFVN 326
              F+ +   YV  + I+G  +   + +L++  S+ DA ASP VI+I ++GIK L + +N
Sbjct: 326 KRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAASPLVISIKNAGIKGLDSLMN 385

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ I+S AN+ +Y CSR +  +A  G  PK+   V++   PV   ++    G L+++
Sbjct: 386 AIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFGLLSFI 445

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
                 A VF+++++   +  I  W  I  ++I +  A+K +  ++D++P+
Sbjct: 446 AASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELPY 496

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  216 bits (549), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/410 (32%), Positives = 212/410 (51%), Gaps = 11/410 (2%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           + NL R+LK R + ++ +G ++GTGL +GSG ALA GGP+++ I +   GS +   I  L
Sbjct: 67  SDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHGL 126

Query: 89  SEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXX 148
            E+    P+   F+ Y  R +DP+  F     Y  ++  VL   L A  + + +W     
Sbjct: 127 GEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWTTKVD 186

Query: 149 XXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                          N   VK FGE E   ++ K++ ++   I  +I+ CGG P+H   G
Sbjct: 187 PVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFIG 246

Query: 209 FRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSM 268
             YW   GAL          F G  +  V + +   GSEM+ +   ET +PK+ +P +  
Sbjct: 247 TEYWHHPGAL-------ANGFKGVASVFVTASYSLGGSEMVCLCSAET-DPKE-LPHAIK 297

Query: 269 NVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAA 328
            VF+RI F ++  + ++G  +   N  L+   S   N SPFVIAI  SGI+VLP+ +NA 
Sbjct: 298 QVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSSV--NNSPFVIAIKLSGIRVLPSIINAV 355

Query: 329 LLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNT 388
           +L+ I+S  N+ I+  SR L  +A  G  P++F  V+R   P+VG +  SL G LA++  
Sbjct: 356 ILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAFLVK 415

Query: 389 KKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
             S   VF ++ +   +   + W  I I++I +  A+KA+  S+D++ F+
Sbjct: 416 SASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFK 465

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  214 bits (546), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 131/409 (32%), Positives = 221/409 (54%), Gaps = 5/409 (1%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           L  +LK R + ++ +G A+GTGL +GSG AL   GP  + I +  TG+++  ++ +L E+
Sbjct: 88  LQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMVMALGEL 147

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWR-PDXXXX 150
           A   P+  GF  Y  R++D +FGFA  +NY  ++ + L   + A  + + YW  P     
Sbjct: 148 AVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWETPVRYTD 207

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   V+ +GE E + ++ K++ ++   I  +I+ CGG P     G R
Sbjct: 208 GFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVGGYVGGR 267

Query: 211 YWRESGALPYLVGGGTGK-FLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YW + GA     G   G+ F G+ +  V + F F GSE++GI   E+ NP+K++P+++  
Sbjct: 268 YWHDPGAF---AGHSPGRRFKGFCSVFVTAAFSFAGSELVGIASAESKNPRKSVPQAAKQ 324

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
           VF+RI   Y+  + ++GL +   + +L+ +   DA+ASPFVIAI + GI  LP+ VN  +
Sbjct: 325 VFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVIAIVTHGISGLPSVVNVVI 384

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L+ ++S  N+ IY CSR L  L++ G  PK    ++R   P+VG    S  G +A++   
Sbjct: 385 LISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFGLIAFVAAS 444

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
                +F+++ +   +   L W  I   +I +  A+K  G S D++PF+
Sbjct: 445 NKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFK 493

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  214 bits (545), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 130/409 (31%), Positives = 224/409 (54%), Gaps = 5/409 (1%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           NL+++L  R +  L +G A+GTGL + SG++L  GGP SL I ++   + L  VI SL E
Sbjct: 88  NLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVINSLGE 147

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           +A+  P+  GFS Y+ R++DP+  F+   NY +++ ++L   L A  + I YW       
Sbjct: 148 LAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYWNDKINSD 207

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N L VK FGE E +L+  K+L ++   I  ++++CGG P     G +
Sbjct: 208 AWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGGYIGGK 267

Query: 211 YWRESGALPYLVGGGTG-KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           YW + GA    VG   G +F G  +  V + F + G EMI +   E+ +P+KTIP ++  
Sbjct: 268 YWHDPGA---FVGHTAGSQFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPRKTIPVAAKR 324

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHST-DANASPFVIAISSSGIKVLPNFVNAA 328
            F+ I   YV  + ++G  +   + +L++  S+ D  +SP VIAI + GIK LP+ +NA 
Sbjct: 325 TFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPLVIAIENGGIKGLPSLMNAI 384

Query: 329 LLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNT 388
           +L+ ++S AN+ +Y CSR +  +A  G  PK    +++   P+   +     G ++++  
Sbjct: 385 ILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFFGLISFVAA 444

Query: 389 KKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
               A VF+++++   +  I  W  I I++I + RA+  +G S++++P+
Sbjct: 445 SDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPY 493

>Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C
           (AGP2) - Amino acid permease [contig 255] FULL
          Length = 579

 Score =  214 bits (544), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 133/481 (27%), Positives = 236/481 (49%), Gaps = 11/481 (2%)

Query: 34  RELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFSLSEMA 92
           R+L  R V L+ +   +GT L +  G AL  GG   L +   ++   +LC+ + S +EM 
Sbjct: 65  RKLHERHVMLIGISGVIGTALFVSIGKALYHGGSAFLLLGMAVWCIPMLCITV-STAEMV 123

Query: 93  SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXXX 152
            + P+D  F     R VD +   AAGWN++    + +   + A   +I YWR D      
Sbjct: 124 CYLPLDSPFLRLTARCVDDSVAVAAGWNFWFLECVQIPFEIVAVNTIIHYWRDDYSAAIP 183

Query: 153 XXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRYW 212
                      +  AV+Y+GE+E  L  FK+++ + ++   L+   GG P+    GFR +
Sbjct: 184 LVVQVVLYFGISVFAVRYYGEMEFWLASFKIILALGLFTFTLVAMLGGNPHKDRFGFRNF 243

Query: 213 RESGALPYLVGG-----GTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
            ++    Y   G       G F G+ AC++Q+ F   G + + ++ GET  P+K +P + 
Sbjct: 244 GDAPFKQYFPSGVVGTPSAGYFQGFLACLIQASFTIAGPDYVSMIAGETHLPRKVLPVAF 303

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKL---VHAHSTDANASPFVIAISSSGIKVLPNF 324
            +VF R+  L++     +G+  S  +  L   ++     A +SP+VIA+ + GI+ LP+ 
Sbjct: 304 KHVFNRLTVLFLGSSLCVGILCSANDPDLTAAINEARPGAGSSPYVIAMKNLGIRALPDV 363

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           VNAAL+    S+ N   +  SR L+G+A DG AP+IF   NR  VP+           L+
Sbjct: 364 VNAALITAAFSAGNAYTFCSSRTLHGMALDGNAPRIFRRCNRHGVPIYAVAVSLTWALLS 423

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
            +   K++A V +++ + ++   ++N+  + + Y+ + RA  ++  ++  +PF+ W QPY
Sbjct: 424 LLQLNKNSAVVLNWLINLITASQLINFACLCLTYLYFRRAYLSQQHNLPSLPFKSWGQPY 483

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPS 503
            A              GY+ F    ++ K F+  Y+ VF +I + + +K         P+
Sbjct: 484 TALLGLFASLLMALVQGYSVFQNSLWNVKDFLFCYLMVFVDIAIYLFHKFVISRGRKGPA 543

Query: 504 E 504
           +
Sbjct: 544 D 544

>NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa]
           {ON} Anc_3.397
          Length = 586

 Score =  214 bits (544), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 139/500 (27%), Positives = 234/500 (46%), Gaps = 16/500 (3%)

Query: 33  SRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFSLSEM 91
            R+L  R V L+ +   +GT L +  G  L +GG   L + + ++   +LC+ + S +EM
Sbjct: 74  QRKLLNRHVQLIAISGVIGTVLFVAIGKPLYRGGAAFLLLGFAIWCIPILCITV-STAEM 132

Query: 92  ASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXX 151
             F P+   F     + VD +    A WN++    + +   +     +I YWR D     
Sbjct: 133 VCFMPVSSPFLRLTKKCVDDSLAMMASWNFWFLECVQIPFEIVTVNTIIHYWRDDYSPAI 192

Query: 152 XXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRY 211
                       +F AVKY+GE E  +   K+++ + +++   I   GG P     GFRY
Sbjct: 193 PLIVQIILYVLISFCAVKYYGETEFWMASLKIIMAMGLFLFTFITMLGGNPKRDRFGFRY 252

Query: 212 WRESGALPYLVGGGT------GKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           + E+    Y   G        G F G+  C++Q+ F   G E I ++ GE   P+K +P 
Sbjct: 253 FGETPFKMYFPNGDVSQGHSAGYFQGFLTCLIQASFSIAGGEYISMLAGEIKIPRKVLPI 312

Query: 266 SSMNVFFRIGFLYVFGVFILGLAIS---PVNSKLVHAHSTDANASPFVIAISSSGIKVLP 322
           +   VF R+  L++     +G+  S   P  +  ++     A +SP+VIA+++ GI++LP
Sbjct: 313 AFKQVFIRLTILFLGSCLCVGILCSANDPALTAAINEARPGAGSSPYVIAMNNMGIQILP 372

Query: 323 NFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGF 382
           + VN  L+    SS N   Y  SR LYG+A DG APKIF   N+  VP+         GF
Sbjct: 373 DIVNVILITAAFSSGNAYTYCSSRTLYGMAMDGYAPKIFTRCNKQGVPIYAVGISVAWGF 432

Query: 383 LAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQ 442
           ++ +    ++A V +++ + ++   ++N+  I I Y+ + RA   +   +  +PF+ W Q
Sbjct: 433 ISLLQLNSNSAVVLNWLINIITTSQLINFACICITYLFFRRAYLLQKDDLPHLPFKSWGQ 492

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYKLYF---KTK 498
           PY                GY+ F    ++ + F+  Y+ VF ++ + + YK  +   K K
Sbjct: 493 PYTVIVGLVSVIIMIFVQGYSVFYKSLWNKQDFLFCYLMVFVDLGIYLIYKFIWKRGKDK 552

Query: 499 FVKPSEISFRTR-NEHEGEE 517
              P  ISF     E E  E
Sbjct: 553 LKNPKIISFENELREIENHE 572

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  214 bits (544), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 140/480 (29%), Positives = 233/480 (48%), Gaps = 22/480 (4%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
              NL R LKPR + ++ +G ++GTGL +GSG A+A+GGP+ + I +   GS +   I  
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIGTIHG 133

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+    P+   F+ Y  R++DP+  F     Y L++  VL   + A  + + YW    
Sbjct: 134 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 193

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   V+ FGE E   +  K + +    I C+++ CGG P+H   
Sbjct: 194 DPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPDHEFI 253

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW + G L          F G  + +V + +   G EM  +  GET +PK  +P + 
Sbjct: 254 GAKYWHDPGCL-------ANGFPGVLSVLVVASYSLGGIEMTCLASGET-DPKG-LPSAI 304

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             VF+RI F ++  + ++G  +   N  L+   S D   SPFVIAI    IK LP+ VNA
Sbjct: 305 KQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSSVDN--SPFVIAIKLHHIKALPSIVNA 362

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ ++S  N+ I+  SR L  +A  G  P  F  ++R   P+VG +  SL G LA++ 
Sbjct: 363 VILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLV 422

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF----RMWFQP 443
              S + VF+++ +   +   + W  I +++I +  A+KA+G S+D++ F     +W   
Sbjct: 423 KSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSA 482

Query: 444 YAAYXXXXXXXXXXXXN-----GYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTK 498
           Y+A             +     G+ +   K   K F  +Y+     + + I +K+Y+K +
Sbjct: 483 YSALINCLILIAQFYCSLWPIGGWTSG--KERAKIFFQNYLCALIMLFIFIVHKIYYKCQ 540

>KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} similar
           to uniprot|P38090 Saccharomyces cerevisiae YBR132C AGP2
           Plasma membrane carnitine transporter expression is
           down-regulated by osmotic stress also functions as a
           low-affinity amino acid permease
          Length = 582

 Score =  213 bits (542), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 130/469 (27%), Positives = 231/469 (49%), Gaps = 11/469 (2%)

Query: 34  RELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAY-LFTGSLLCVVIFSLSEMA 92
           R L+ R V L+ +   +GT L +  G  L +GG + L +   L+   +LC+ + S +EM 
Sbjct: 66  RTLRERHVLLIGISGVIGTALFVSIGKGLFRGGSVFLLLGMALWCIPMLCITV-STAEMV 124

Query: 93  SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXXXX 152
            + P+D  F    +R VD +    AGWN++    + +   + A   ++ YWR D      
Sbjct: 125 CYLPLDSPFLCLASRCVDDSLAIMAGWNFWFLECVQIPFEIVAVNTILHYWRDDYSAAIP 184

Query: 153 XXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFRYW 212
                      + LAV+++GE+E  L  FK+++   +++  L+   GG P     GFR +
Sbjct: 185 LVVQVILYFAISVLAVRFYGEMEFWLASFKIILAAGLFVFTLVAMLGGNPKKDRFGFRNF 244

Query: 213 RESGALPYLVGGGTGK-----FLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
            ++    Y   G  G      F G+ AC++Q+ F   G + + ++ GET  P+K +P + 
Sbjct: 245 ADAPFKQYFPSGKPGSPSAGYFQGFLACLIQASFTIAGPDYVAMIAGETRLPRKILPVAF 304

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISSSGIKVLPNF 324
             VF R+  L++     +G+  S  +  L+ A S     A ASP+V+A+ + GIK LP+ 
Sbjct: 305 KQVFNRLTILFLGSSLCVGILCSANDPSLMAAISEARPGAGASPYVLAMKNLGIKTLPDV 364

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           VNAAL+    S+ N   +  SR L+G+A  G AP +F   NR  VP+           L+
Sbjct: 365 VNAALVTAAFSAGNAYTFCSSRTLHGMALVGNAPAVFKRCNRHGVPIYAVAVSLTWALLS 424

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
            +   K++A V +++ + ++   ++N+  + + Y+ + RA  A+  ++ ++PF+ W QPY
Sbjct: 425 LLQLNKNSAVVLNWLINMITASQLINFAVLCVTYLYFRRAYHAQCGALPELPFKSWGQPY 484

Query: 445 AAYXXXXXXXXXXXXNGYNAFIIK-FHYKTFITSYIGVFANILMVIGYK 492
            A              GY  F    +  + F+  Y+ +F +I + + +K
Sbjct: 485 TALVGLVAVLIMVLVQGYAVFCSSLWDVQEFLFCYLMIFIDIAIYVVHK 533

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  214 bits (544), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 147/510 (28%), Positives = 248/510 (48%), Gaps = 26/510 (5%)

Query: 28  KNGN----LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCV 83
           KNG+    L + ++PR V +++LG+ +GTGL++G+GSAL+K GP +L I Y   GS L  
Sbjct: 111 KNGDDDAHLQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYC 170

Query: 84  VIFSLSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGY 142
           +I +  EMA  ++ +   F+ Y +  VD    F   W Y L++  V+   L    + I Y
Sbjct: 171 IIQACGEMAVCYSGLPGNFNAYPSFLVDEGMAFGVAWVYCLQWLCVMPLELVTASMTIDY 230

Query: 143 WRPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAP 202
           W                    N    K + E E      K+L++   +I  ++I  GGA 
Sbjct: 231 WTTKVNSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAG 290

Query: 203 NHTTTGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKT 262
           N    G +YW   GA  +       +F    +    + F F  SE I I   E +NP++ 
Sbjct: 291 NDGYIGAKYWHNPGA--FRGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRA 348

Query: 263 IPKSSMNVFFRIGFLYVFGVFILGLAISPVNSK--LVHAHSTDANASPFVIAISSSGIKV 320
           IP ++  + +RI F+++  + ++G  + P +S   L    S  + ASP+VIA++S G++V
Sbjct: 349 IPSAAKTMIYRILFIFLTSITLVGFLV-PYDSTELLGSGGSASSQASPYVIAVASHGVRV 407

Query: 321 LPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLL 380
           +P+F+NA +L+ ++S AN+  Y   R LY LA+ G APK F  ++R   P    +  ++ 
Sbjct: 408 VPHFINAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIF 467

Query: 381 GFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR-- 438
           G +A+ +       VF+++ S   +  +  W  I +++I + RA+K +G S+D+I F+  
Sbjct: 468 GVIAFCSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQ 527

Query: 439 --MWFQPYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFK 496
             +W   YAA             +           + F  +Y+ +   I++  GYK+Y K
Sbjct: 528 VGVWGSGYAAIMMILALIAEFWVSIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKK 587

Query: 497 T--KFVKPSE---ISFRT-------RNEHE 514
               F++  +   IS RT       R E E
Sbjct: 588 DWKLFIRAKDIDLISHRTIFDGELVRQEEE 617

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  212 bits (539), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 130/410 (31%), Positives = 217/410 (52%), Gaps = 8/410 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N  L R LK R + ++ +G A+GTGL +GSG +LA  GP  + I +  TG+++  ++ ++
Sbjct: 73  NAPLKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAM 132

Query: 89  SEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW-RPDX 147
            E+A   P+  G++ Y +R+VD +FGFA    Y + + I L   + A  + + YW  P  
Sbjct: 133 GELAVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAK 192

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   VK +GE E + +  K++ ++   I  +I+ CGG P     
Sbjct: 193 YRDAFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYI 252

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G R W   GA           F G  +  V + F F GSE++G+   ETANP+K+IP ++
Sbjct: 253 GGRLWHNPGAF-------ANGFKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIPSAA 305

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             VF+RI   Y+  + ++GL +   + +L+   S DA ASPFVI+I ++GIK LP+ +N 
Sbjct: 306 KQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSVINV 365

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ ++S  N  ++ CSR +  LA  G+ PKIF  ++R   P+VG V   + G L+++ 
Sbjct: 366 VILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLSFIA 425

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
                  VF ++ +   +  +  W  IL+ +I   RA+ A+  +  ++ F
Sbjct: 426 ASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSF 475

>Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 598

 Score =  212 bits (539), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 140/482 (29%), Positives = 245/482 (50%), Gaps = 8/482 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K+  L + ++PR V +++L + +GTG+++G+G +L  GGP SL I Y    S+L  VI S
Sbjct: 77  KHKTLKQNIRPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLVIGYAIVSSMLYCVIQS 136

Query: 88  LSEMAS-FAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
            SE+A  +  +  GF+ Y +  VD AFGF+  W Y L++  VL   L    + I YW   
Sbjct: 137 ASELAIIYTSLAGGFNAYPSLLVDKAFGFSVSWVYCLQWLCVLPLELVTASMTIKYWNQT 196

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            NF+    + E E      K+L+++  +I  +II CGGA N   
Sbjct: 197 INPDAFVTIFYVVLVAINFVGAAGYAEAEFFFNCCKVLMIIGFFILGIIINCGGAGNDGY 256

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G RYW + GA  +       +F G  A +V + F + G+E   +   E  NP+K+I  +
Sbjct: 257 LGARYWHDPGA--FRGSDSINRFKGIVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSIRSA 314

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           S  + +RI  +Y+    +LG  +   + +L+ +  +  +ASPFVIA++S G++V+P+F+N
Sbjct: 315 SKKLVYRILGIYIMTAILLGFLVPWNSDELLGSGGSATHASPFVIAVASHGVRVVPHFIN 374

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ ++S AN+ +Y  SR L  L++ G AP+    V+R   PV+  +   + G L+++
Sbjct: 375 AVILLSVLSVANSALYSSSRILLSLSEQGFAPRFLNYVDRCGRPVLCLLVSCVFGLLSFV 434

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAA 446
                  TVF+++ +   +  +  WF I ++++   RA+  +G S D++ +  W   + A
Sbjct: 435 AASPKEETVFTWLLAISGLSELFTWFSISLSHVRLRRAMTVQGRSADELGYVAWTGVWGA 494

Query: 447 YXXXXXXXXXXXXNGYNAFII----KFHYKTFITSYIGVFANILMVIGYKLYFKT-KFVK 501
           Y              + A       K     F  +Y+ +   I + +GYK++ +  + + 
Sbjct: 495 YYAMAMIVAILVGQFWVAISPVGSNKLDANNFFENYLAMPILIFLYLGYKIWTRDWRLLI 554

Query: 502 PS 503
           PS
Sbjct: 555 PS 556

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  212 bits (540), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 124/409 (30%), Positives = 216/409 (52%), Gaps = 3/409 (0%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K+ +L + +KPR V +++LG+ +GTGL++G+G  L+K GP +L I Y   G+ L  +I +
Sbjct: 116 KSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQA 175

Query: 88  LSEMAS-FAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             E+A  ++ ++ GF+ Y +  VDPA GF+  W Y L++  V    L    + I YW   
Sbjct: 176 AGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTTK 235

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N    + + E E      K+L++   +I  +IIT GGA N   
Sbjct: 236 VDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGNDGY 295

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G +YW + GA  +       +F G     V + F F  +E I +   E +NP+K IP +
Sbjct: 296 LGAKYWHDPGA--FNGDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSA 353

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           +  V +RI  +++  + ++G  +   + +L+ +  +   ASP+VIA+SS G++V+P+F+N
Sbjct: 354 AKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKASPYVIAVSSHGVRVVPHFIN 413

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ ++S  N+  Y  SR L  LA+ G APK F  V+R   P    +  +L G +A+ 
Sbjct: 414 AVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVIAFC 473

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDI 435
            T      VFS++ +   +  +  W  I +++I + RA++ +G S+ ++
Sbjct: 474 ATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEV 522

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  211 bits (537), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 131/486 (26%), Positives = 242/486 (49%), Gaps = 9/486 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           +  L + +K R V +++LG+ +GTG+++G+G AL  GGP  L I Y   GS L  +I + 
Sbjct: 93  DNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAIMGSCLYCIIQAA 152

Query: 89  SEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            E+A  +  +  GF+ Y +  +DPA GF+  W Y L++  V+   L    + I YW    
Sbjct: 153 GELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVTASITIKYWTTSV 212

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N    + + E E      K+L++   +I  +I+ CGGA N    
Sbjct: 213 NPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGYI 272

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW + G+  +        F G  + +V + F F  +E I +   E ANP+K+IP ++
Sbjct: 273 GGKYWNDPGS--FSGDKPIDHFKGVVSTLVTAAFAFGATEFIALTAAEQANPRKSIPSAA 330

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             V +RI  +++  + ++G  +   + +L+ +  +  +ASP+VIAI+S G+KV+P+F+NA
Sbjct: 331 KKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASPYVIAIASHGVKVVPHFINA 390

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ ++S  N+  Y  SR L  LA+ G AP     V+R   P +  +  ++ G ++++ 
Sbjct: 391 VILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTLAMIISAVFGLISFVA 450

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAY 447
                 TVF+++ +   +  +  W  I +++I + RA+K +G S+ ++ F+     + +Y
Sbjct: 451 ASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSY 510

Query: 448 XXXXXXXXXXXXNGYNAFII----KFHYKTFITSYIGVFANILMVIGYKLYFK--TKFVK 501
                         + A       K   + F  +Y+ +   I +  GYK++ +  T ++ 
Sbjct: 511 YATGMMLLILIGQFWTAIAPIGEGKLDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIP 570

Query: 502 PSEISF 507
            S+I  
Sbjct: 571 ASKIDL 576

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  210 bits (535), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 114/411 (27%), Positives = 213/411 (51%), Gaps = 3/411 (0%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
             +L + +K R V ++TLG+ +GTGL++ + S L   GP  L +AY     +   +I + 
Sbjct: 98  ESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYGLVSFVTYFMIQAA 157

Query: 89  SEMASFAPMDKG-FSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            EMA   P   G F+ Y++ +V   FGFA  W + L++  VL   L    L I YW    
Sbjct: 158 GEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELITSSLTIKYWNDKI 217

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           +F  V+ +GE E +    K+L++    I  +++ CGGA +    
Sbjct: 218 NSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSIVVNCGGAGHDGYI 277

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW + GA  +      G+F G    +V + F + G+E+  +   E  NP+K+ P+++
Sbjct: 278 GGKYWHDPGA--FTSHTNIGRFKGICFILVTAYFSYGGTELYVLSVNEQENPRKSTPQAA 335

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
               +RI  +Y+  + ++G  +   N +L+ +H +  +ASP+V+A S  G++++P+F+NA
Sbjct: 336 KQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHASPYVLAASIHGVRIVPHFINA 395

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ +IS AN+ +Y   R L  LA+ G APK    ++R   P+    T SL G + +  
Sbjct: 396 VILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPLTALATCSLFGVIGFAA 455

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
                  VF+++ +   +  +  W  I+++++ + +A+K +G  ++++ ++
Sbjct: 456 ASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRDLNELGYK 506

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  210 bits (534), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 139/477 (29%), Positives = 232/477 (48%), Gaps = 22/477 (4%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
              NL + LK R + ++ +G ++GTGL IGSG ALA GGP+++ I +   GS +   I  
Sbjct: 82  DTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQIIGTIHG 141

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+    P+   F+ Y  R++DP+  F     Y +++  VL   + +  + + YW    
Sbjct: 142 LGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQYWNESI 201

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   V+ FGE E + +  K++ +    + C+I+  GG P+H   
Sbjct: 202 DPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGGGPDHVYV 261

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G RYW   G L          F G  + +V + +   G+EM  +  GET +PK+ +P + 
Sbjct: 262 GSRYWHNPGCL-------ANGFPGVLSVMVVASYSLGGTEMTCLASGET-DPKE-LPSAI 312

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             VF+RI F ++  + ++G  +   N  L+   S D   SPFVIAI    IKVLP+ VNA
Sbjct: 313 KQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSSVDN--SPFVIAIKIHHIKVLPSIVNA 370

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ I+S  N+ I+  SR L  +A     P  F  ++R   P+VG +T SL G LA++ 
Sbjct: 371 VILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIITNSLFGLLAFLV 430

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF----RMWFQP 443
              S + VF ++ +   +   + W  I +++I +  A+KA+G S++++ F     +W   
Sbjct: 431 KSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELEFVSAVGIWGSV 490

Query: 444 YAAYXXXXXXXXXXXXN-----GYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYF 495
           Y+A             +     G+     +   K F  SY+     + + IG+K+Y+
Sbjct: 491 YSAIINCLILVAQFYISLWPIGGWKNS--EDRAKKFFQSYLCALIMVCIWIGHKIYY 545

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  209 bits (533), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 136/483 (28%), Positives = 235/483 (48%), Gaps = 22/483 (4%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
              NL R LKPR + ++ +G ++GTGL +GSG A+A+GGP+ + + +   GS +   +  
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTVHG 133

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+    P+   F+ Y  R++DP+  F     Y L++  VL   + A  + + YW    
Sbjct: 134 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 193

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N    + FGE E   +  K + +    I C+++ CGG P+H   
Sbjct: 194 DPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIVLICGGGPDHEFI 253

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW + G L +        F G  + +V + +   G EM  +  GET +PK  +P + 
Sbjct: 254 GAKYWHDPGCLAH-------GFPGVLSVLVVASYSLGGIEMTCLASGET-DPKG-LPSAI 304

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             VF+RI F ++  + ++G  +   N  L+   S D   SPFVIAI    IKVLP+ VNA
Sbjct: 305 KQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSSVDN--SPFVIAIKLHHIKVLPSIVNA 362

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ ++S  N+ I+  SR L  +A  G  P  F  ++R   P+VG +  SL G LA++ 
Sbjct: 363 VILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLV 422

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF----RMWFQP 443
              S + VF+++ +   +   + W  I ++++ +  A+KA+G S+D++ F     +W   
Sbjct: 423 KSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLDELEFVSAVGIWGSV 482

Query: 444 YAAYXXXXXXXXXXXXN-----GYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTK 498
           Y+A             +     G+ +   K   K F  +Y+     + + + +K+Y++ +
Sbjct: 483 YSALINCLILIAQFYCSLWPIGGWTSS--KERAKIFFQNYLCALIMVFIFVIHKIYYRCQ 540

Query: 499 FVK 501
             K
Sbjct: 541 MGK 543

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  209 bits (533), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 126/407 (30%), Positives = 211/407 (51%), Gaps = 11/407 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           N+ R LK R + ++ +GS++GTGL +GSG ALA GGP++L I +   G+ +   I  L E
Sbjct: 77  NMKRALKSRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWTLAGTQMIGTIHGLGE 136

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           +    P+   F+ Y  R++DP+  F     Y +++  VL   + A  + + +W       
Sbjct: 137 LTVRLPVVGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIASCITMRFWTQSVDPI 196

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N L V+ FGE E + +  K++ +    I C+++  GG P H   G R
Sbjct: 197 IWVALFYTMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIVLILGGGPTHQYVGSR 256

Query: 211 YWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNV 270
           YW + G L          F G  A +V + +   GSEM  +  GET +PK+ +P +   +
Sbjct: 257 YWHDPGPL-------ANGFKGVAAVMVTASYSLGGSEMTCLASGET-DPKE-LPHAIKQI 307

Query: 271 FFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAALL 330
           F+RI F ++  + ++G  +   N  L+   S  A  SPFV+A+    +KV+P+ VN  +L
Sbjct: 308 FWRILFFFLVSLTLVGFLVPYTNENLLGGSS--AENSPFVLALYLHHVKVVPHIVNGVIL 365

Query: 331 VFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKK 390
           V I+S  N+ I+  SR L  +A  G  P IF  V+R   P+VG +  S+ G LA++    
Sbjct: 366 VSILSVGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVGILANSIFGLLAFLVKFS 425

Query: 391 SAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF 437
           S + VFS++ +   +   + W  I ++++ +  A+KA+  S+D++ F
Sbjct: 426 SISNVFSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLDELQF 472

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  209 bits (532), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 139/483 (28%), Positives = 230/483 (47%), Gaps = 32/483 (6%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
             GNL + LK R + ++ +G ++GTGL IGSG ALA GGP+++ I +   GS +   I  
Sbjct: 74  HTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAVAGSQIVGTIHG 133

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+    P+   F+ Y  R++DP+  F     Y L++  VL   + A  + + YW    
Sbjct: 134 LGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIASAITVQYWNDSI 193

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N    + FGE E + +  K++ +    I C+++  GG P+H   
Sbjct: 194 DPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVLIAGGGPDHEYI 253

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW   G+L +        F G  + +V + +   G+EM  +  GET +PK+ +P + 
Sbjct: 254 GAKYWHNPGSLAH-------GFKGVLSVLVVASYSLGGTEMTCLASGET-DPKE-LPSAI 304

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             VF+RI F ++  + ++G  +   N  L+   S D   SPFVIAI    IKVLP+ VNA
Sbjct: 305 KQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSSVD--NSPFVIAIKIHNIKVLPSIVNA 362

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +LV I+S  N+ I+  SR L  +A     P  F  ++R   P+ G +  SL G LA++ 
Sbjct: 363 VILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGIIINSLFGLLAFLV 422

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MWFQP 443
              S   VF ++ +   +   + W  I I ++ +  A+KA+  ++D++ F     +W   
Sbjct: 423 KSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDELEFVSAVGIWGSV 482

Query: 444 Y----------AAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKL 493
           Y          A +            +G  A       K F  +Y+     I++ IG+K+
Sbjct: 483 YSGIVNALILVAQFYIALWPIGGWTDSGTRA-------KKFFQNYLCALILIVLFIGHKI 535

Query: 494 YFK 496
           Y++
Sbjct: 536 YYR 538

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  210 bits (534), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 131/497 (26%), Positives = 243/497 (48%), Gaps = 9/497 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            N  L + ++PR V +++LG+ +GTGL++G+G+AL   GP  L I Y   GS++  +I +
Sbjct: 126 DNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQA 185

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             EMA +++ +  G++ Y +  V+  FGFA  W Y +++  V    L    L I YW   
Sbjct: 186 TGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTTS 245

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N    K + E E      K+L+++  +I  + IT GGA N   
Sbjct: 246 VNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGY 305

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G  YW   GA  +        F G    +V + F + G+E + +   E +NP+  IP +
Sbjct: 306 LGGLYWHTPGA--FRGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPRAAIPSA 363

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           +  V +RI  +Y+  + ++G  +   +++L+ +  +  +ASP+V+A S  G++V+P+F+N
Sbjct: 364 AKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASLHGVRVVPHFIN 423

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ ++S  N+  Y  SR L  LA+ G APK F  ++R   P    +  +L G +A+ 
Sbjct: 424 AVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFGVIAFC 483

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MWFQ 442
                   VF+++ +   +  +  W  I +++I +  A+K +G S+ ++ +     +W  
Sbjct: 484 AASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQTGVWGS 543

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFK--TKFV 500
            YA +                    +   + F  +Y+ +   I++ +GYK+Y+K  T  +
Sbjct: 544 WYALFMMFLIYIAQFWVAIAPIGSGELSAQNFFENYLAMPILIVLYLGYKIYYKDWTLLI 603

Query: 501 KPSEISFRTRNEHEGEE 517
           K  +I  ++  +   E+
Sbjct: 604 KAEDIDLQSHRQIFDED 620

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  208 bits (529), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 138/497 (27%), Positives = 242/497 (48%), Gaps = 17/497 (3%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           +  + + +K R + +++LG+ +GTGL++G+G+ALAK GP  L I Y    ++L  +I + 
Sbjct: 61  SSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYGVASAMLYCIIQAA 120

Query: 89  SEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            E+   ++ M   ++ Y +  VDPA GF+  W Y +++  V    L    + I YW  D 
Sbjct: 121 GELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLVTAAITIKYWT-DT 179

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N    K + E E L    K+L++V   I  +II CGGA N    
Sbjct: 180 NPDIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGIIINCGGAGNDGYI 239

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G RYW   GA        TG F G       + F + G E++ +   E  NP+K+IP + 
Sbjct: 240 GARYWHTPGAF------STG-FKGVCYVFCYAAFAYGGIEVMVLTASEQENPRKSIPSAC 292

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             V +RI  +Y+    I+   + P ++  + +  + + ASPFVIAI+S GI V+P+ +NA
Sbjct: 293 KKVIYRILLIYMLTTLIVCFLV-PYDAPELTSTGSASRASPFVIAIASHGISVVPHIINA 351

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +LV ++S  N+ +Y   R L  L++ G APK+F  V+R   P++  +    +G LA++ 
Sbjct: 352 VILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLLCFLVAMFVGLLAFIA 411

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAY 447
              +   VFS++ +   +  +  W  I ++++ +  A+KA+G S+ ++ ++     + ++
Sbjct: 412 ASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSLGEVGYKSQTGYWGSW 471

Query: 448 XXXXXXXXXXXXNGYNAFII-----KFHYKTFITSYIGVFANILMVIGYKLYFKT-KFVK 501
                         + A        K   K F  SY+     I +  GYK+Y+K  +   
Sbjct: 472 FAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIFIYFGYKIYYKDWRLCI 531

Query: 502 P-SEISFRTRNEHEGEE 517
           P +E+   +  +   E+
Sbjct: 532 PATEVDLNSHRKIFDED 548

>KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}
           YFL055W
          Length = 571

 Score =  207 bits (528), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 132/482 (27%), Positives = 233/482 (48%), Gaps = 14/482 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           +L R+L PR ++++++   +GTGL + +  +L  GGP SLF+ Y   G ++ + +  L E
Sbjct: 67  DLKRDLSPRHINMISIAGVIGTGLYLSTSKSLHVGGPASLFMNYSIFGGVVYLTMMCLGE 126

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXX- 149
           M+++ P+   F  Y  ++   +F  A  WNY+   A+ ++++LTA  LV+ YW+      
Sbjct: 127 MSTYMPISGSFCSYAKKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWKTKDHHF 186

Query: 150 --XXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N ++V+ +GE E  L + K++ ++I +I  +++  G  P H   
Sbjct: 187 PYWAASLLFWVFVLLLNVISVRLYGEAEYWLALLKVIAIIIFFILSIVVNVGHNPEHKYI 246

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           GF  W   G  P++ G     F G+ +  V + F + G+E I +  GE  NP +  PK  
Sbjct: 247 GFHNWNH-GDAPFVNG-----FKGFASLFVSASFAYGGTESITLTNGEATNPVRNTPKVI 300

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             VF+RI   YVF  F + + + P +   +   S     SPF I    +G K   +F+NA
Sbjct: 301 KTVFWRILIFYVFSAFFIAMNV-PYDYPGLATKSV--MTSPFTIVFQMAGSKGAGSFMNA 357

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            ++  +IS+ N  ++  SR +Y ++ DG  PK     NR+K P V       +G L +  
Sbjct: 358 VIMTSVISACNHALFAGSRVMYNMSLDGYLPKWVTKTNRYKAPYVAVAITWAVGGLCFGA 417

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAY 447
           +   A TV+ ++ + V V   + W  I I  I + R ++ +G    ++ F+ W  P+  Y
Sbjct: 418 SFIGAGTVWIWLQNIVGVSNQIAWLCIAITSIRFRRGLELQG-KTHELKFKNWTYPWGPY 476

Query: 448 XXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSEISF 507
                        G++AF   +    F + Y+ +F      + + LY + KF+K  ++ F
Sbjct: 477 FLVVFVSFVILIQGWSAF-DPWSTSNFFSVYLELFVFPACYLIWWLYKRDKFIKYEDMDF 535

Query: 508 RT 509
            T
Sbjct: 536 VT 537

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  208 bits (529), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 116/409 (28%), Positives = 213/409 (52%), Gaps = 3/409 (0%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           +L + +K R V ++ +G+ +GTGL++ + S L+ GGP SL I Y+    +   +I +  E
Sbjct: 74  HLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAGE 133

Query: 91  MASFAPMDKG-FSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXX 149
           MA   P   G F+ Y + ++   FGFA  W +F+++  V    L    L I YW      
Sbjct: 134 MAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDKINA 193

Query: 150 XXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGF 209
                         +F  VK +GE E +    K+L++    I  ++I CGGA      G 
Sbjct: 194 DVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIGA 253

Query: 210 RYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           +YWR+ G+  +  G    KF G    +V + F + G+E+  +   E  NP+K+ P+++  
Sbjct: 254 KYWRDPGS--FAEGDSVEKFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQAAKQ 311

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
             +RI  +Y+  + ++G  +   N +L+ +  +  +ASP+V+A S  G+KV+P+F+NA +
Sbjct: 312 SIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPHFINAVI 371

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L+ +IS AN+ +Y   R +  LA+ G APK    V+R   P+   +  ++ G + +++  
Sbjct: 372 LISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGFVSAS 431

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
                VF+++ +   +  +  W  I+++++ + + +K  G S ++I FR
Sbjct: 432 SKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFR 480

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  207 bits (528), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 138/480 (28%), Positives = 232/480 (48%), Gaps = 22/480 (4%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
              NL R LKPR + ++ +G ++GTGL +GSG A+A+GGP+ + + +   GS +   I  
Sbjct: 75  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHG 134

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+    P+   F+ Y  R++DP+  F     Y L++  VL   + A  + + YW    
Sbjct: 135 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 194

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N    + FGE E   +  K + +    I  +++ CGG P+H   
Sbjct: 195 DPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIVLICGGGPDHEFI 254

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW + G L          F G  A +V + +   G EM  +  GET +PK  +P + 
Sbjct: 255 GAKYWHDPGCL-------ANGFPGVLAVLVVASYSLGGIEMTCLASGET-DPKG-LPGAI 305

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             VF+RI F ++  + ++G  +   N  L+   S D   SPFVIA+    IKVLP  VNA
Sbjct: 306 KQVFWRILFFFLASLTLVGFLVPYTNQNLLGGSSVDN--SPFVIAMKLHHIKVLPTIVNA 363

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ ++S  N+ I+  SR L  +A  G  P  F  ++R   P+VG +  SL G LA++ 
Sbjct: 364 VILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLV 423

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF----RMWFQP 443
              S A VF+++ +   +   + W  I +++I +  A+KA+G S+D++ F     +W   
Sbjct: 424 KSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAVGIWGSA 483

Query: 444 YAAYXXXXXXXXXXXXN-----GYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTK 498
           Y+A             +     G+++   K   K F  +Y+     + + + +K+Y+K +
Sbjct: 484 YSALINCLILIAQFYCSLWPIGGWSSG--KERAKLFFQNYLCALIMLFIFVVHKIYYKCQ 541

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  208 bits (529), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 125/414 (30%), Positives = 219/414 (52%), Gaps = 7/414 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K  +L R++KPR V +++L + +GTGL++G+G ALA GGP  L I Y   GS L  +I +
Sbjct: 98  KGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQA 157

Query: 88  LSEMASFAPMDKG-FSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             E+A   P   G F+ Y +  VDPA  FA    Y +++  V    + +  + I YW   
Sbjct: 158 AGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTS 217

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N      + E +      K+L+    +I  +II CGGA +   
Sbjct: 218 INPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVY 277

Query: 207 TGFRYWRESGALPYLVGGGTG--KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
            G +YW + GA      G TG  +F    + +V + F F  SE + +   E ANP+K IP
Sbjct: 278 IGGKYWNDPGAF----NGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIP 333

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
            ++  V +RI  +Y+  + ++G  +   + +L+ + S+  ++SP+VIA++S G+KV+P+F
Sbjct: 334 SAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPSF 393

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           +NA +L+ ++S  N   Y  SR L  L++ G APK F  V+R   P+   + G+L+G + 
Sbjct: 394 INAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCIC 453

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
           +++   +  +VF+++ +   +  +  W  I I+++ + +A++ +  SI ++ FR
Sbjct: 454 FVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFR 507

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  207 bits (527), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 132/500 (26%), Positives = 244/500 (48%), Gaps = 23/500 (4%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K+ NL + +K R + +++LG+ +GTGL++GSG+AL  GGP    I +L  G  +  VI +
Sbjct: 86  KHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQA 145

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYW--- 143
             E+A  +  +  GF+ Y +  +DPA GFA  W Y L++  V    L    + I +W   
Sbjct: 146 AGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGS 205

Query: 144 ---RPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGG 200
               PD                 NF   + + E E      K+L+++  +I  ++I  G 
Sbjct: 206 RSVNPDIYVAIFYVLIIVI----NFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGA 261

Query: 201 APNHTTTGFRYWRESGALPYLVGGGT--GKFLGWWACVVQSIFGFMGSEMIGIVYGETAN 258
                  G +YWR+ G+L    GG T    F G  A +V + F    SE + +   E AN
Sbjct: 262 VGTSGYIGGKYWRDPGSL----GGRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQAN 317

Query: 259 PKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGI 318
           P+K+IP ++  + ++I  +++  V ++G  +   + +L+ ++ +D + SP+VIA+   G+
Sbjct: 318 PRKSIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGV 377

Query: 319 KVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGS 378
            V+P+F+NA +L+ ++S  N+  Y  SR L+ LA+   APKIF  ++R   P++  +   
Sbjct: 378 NVVPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISI 437

Query: 379 LLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
           L G + ++        VF ++ +   +  +  W  I +++I + RA+  +G S D++ F+
Sbjct: 438 LFGTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFK 497

Query: 439 MWFQPYAAYXXXXXXXXXXXXNGYNAFI----IKFHYKTFITSYIGVFANILMVIGYKLY 494
                  +Y              + + +     +   ++F T Y+ +   +L   GYK++
Sbjct: 498 AQTGIIGSYVSAIMMVLALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIW 557

Query: 495 FKT--KFVKPSEISFRTRNE 512
            K    F++  +I   +   
Sbjct: 558 NKDWRLFIRADQIDLVSHRR 577

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  207 bits (526), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 117/428 (27%), Positives = 219/428 (51%), Gaps = 4/428 (0%)

Query: 13  PASGXXXXXXXXXXXKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFI 72
           P  G            +G L R ++PR V+++++ + +GTGL++ +G +L  GGP  L I
Sbjct: 60  PQGGDLETASVQTDLTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLII 119

Query: 73  AYLFTGSLLCVVIFSLSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSA 131
            Y     +  +++ +  EMA ++  M   F+ Y + ++   FGFA+ W Y L++  V   
Sbjct: 120 GYAAVSVVAYIMMQAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPL 179

Query: 132 NLTAFGLVIGYWRPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYI 191
            L    L I YW                    +F   + +GE E +  + K+L++    I
Sbjct: 180 ELITASLTIKYWTDSVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVI 239

Query: 192 TCLIITCGGAPNHTTTGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGI 251
             ++I CGGA N    G RYW + GA  + VG    KF G+   +V   F + G+E+  +
Sbjct: 240 LAIVINCGGAGNSGYIGARYWHDPGA--FAVGDPASKFKGFCYVLVTGYFSYGGTELYAM 297

Query: 252 VYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDA-NASPFV 310
              E ++P++ I  ++    +RI  +Y+  + ++G  +   + +L+ +    A +ASP+V
Sbjct: 298 TVNEQSSPRRAIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYV 357

Query: 311 IAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVP 370
           +A+S  G+KV+P+ VNA +L+ ++S  N+ +Y   R L  LA+ G APK    ++R   P
Sbjct: 358 LAVSLHGVKVVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRP 417

Query: 371 VVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGI 430
           ++  +  S++G LA++        VF+++ +   +  +  W  IL+++I + +A+K  G 
Sbjct: 418 LMALIACSVIGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGY 477

Query: 431 SIDDIPFR 438
           S+  + ++
Sbjct: 478 SLSQLGYK 485

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  207 bits (527), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 136/495 (27%), Positives = 244/495 (49%), Gaps = 10/495 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + +KPR V +++LG+ +GTG+++G+G++LA  GP  L I Y   GS +  +I +  E
Sbjct: 108 ELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGE 167

Query: 91  MAS-FAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXX 149
           +A  +  +  GF+ Y +  +DPAFGFA  W Y +++  V    L    + I YW      
Sbjct: 168 LAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELVTASMTIKYWTTKVDP 227

Query: 150 XXXXXXXXXXXXXXNFLA-VKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                         N L     + E E     FK+L+L   +I  +++ CGGA N    G
Sbjct: 228 DVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILGIVVICGGAGNDGYIG 287

Query: 209 FRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSM 268
            R W   G+  +       +F G  + +V + F F  SE +G+   E +NP+K IP ++ 
Sbjct: 288 TRLWHNPGS--FRGDKPVDRFKGVVSTLVNAAFAFGMSEFLGVTASEQSNPRKAIPSAAK 345

Query: 269 NVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAA 328
            + +RI  +Y+  V I+G  +   + +L+ +      ASP+V+AIS  G++V+P+F+NA 
Sbjct: 346 KMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKASPYVLAISLHGVRVVPHFINAV 405

Query: 329 LLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNT 388
           +L+ ++S  N+  Y  SRQL  L++ G AP     V+R   P+      +L+G +A+  T
Sbjct: 406 ILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAFCAT 465

Query: 389 KKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAYX 448
                 VF ++ +   +  +  WF I ++++ + RA++ +G S+ ++ F+     Y +  
Sbjct: 466 SPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLY 525

Query: 449 XXXXXXXXXXXNGYNAFII----KFHYKTFITSYIGVFANILMVIGYKLYFKT--KFVKP 502
                        + A +     K   + F  +Y+ +   I++  G+K++ K    F++ 
Sbjct: 526 SCVMMVLILIAQFWTALVPVGEGKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRA 585

Query: 503 SEISFRTRNEHEGEE 517
            +I   +  E   EE
Sbjct: 586 EDIDLVSHREIFDEE 600

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  206 bits (525), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 140/497 (28%), Positives = 241/497 (48%), Gaps = 10/497 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           ++ +L + ++PR V + +L + VGTGL++G+GSAL K GP  L I Y   G+ L  +I +
Sbjct: 123 EDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             EMA S++ +   F+ Y    VD  FGFA  W Y +++  V+   L    + I YW   
Sbjct: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N    K + E +      K+L++   +I  +II  GGA     
Sbjct: 243 VNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAGGAGTSGY 302

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G +YW + GA  +       +F    A    + F F  SE I I   E +NP++ IP +
Sbjct: 303 IGAKYWHDPGA--FRGDRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRAIPSA 360

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           +  + +RI F+++  + ++G  +   +S+L+ + S    ASP+V+AISS G++V+P+F+N
Sbjct: 361 AKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPHFIN 420

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ ++S +N+  Y   R L+ L++ G AP+ F  ++R   P    +   L G +A+ 
Sbjct: 421 AVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFC 480

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MWFQ 442
                   VF+++ +   +  I  W  I +++I + RA+  +G SI ++ FR    +W  
Sbjct: 481 ACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGS 540

Query: 443 PYAAYXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKT--KFV 500
            YAA             +           K+F  +Y+ +   I+   GYK+Y +    F+
Sbjct: 541 VYAATMLFLALIAEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFI 600

Query: 501 KPSEISFRT-RNEHEGE 516
           +   I   T RN  + E
Sbjct: 601 RAKNIDLITHRNIFDAE 617

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  205 bits (522), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 128/423 (30%), Positives = 210/423 (49%), Gaps = 15/423 (3%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
              NL R LKPR + ++ +G ++GTGL +GSG A+A+GGP+ + + +   GS +   I  
Sbjct: 74  DTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWTIAGSQIIGTIHG 133

Query: 88  LSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
           L E+    P+   F+ Y  R++DP+  F     Y L++  VL   + A  + + YW    
Sbjct: 134 LGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYWNSSI 193

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N   V+ FGE E   +  K + +    I C+++  GG P+H   
Sbjct: 194 DPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIVLIFGGGPDHEYV 253

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW + G L          F G  + +V + +   G EM  +  GET +PK  +P + 
Sbjct: 254 GAKYWYDPGCL-------ANGFPGILSVLVVASYSLGGIEMTCLASGET-DPKG-LPSAI 304

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             VF+RI F ++  + ++G  +   N  L+   S D   SPFVIAI    IKVLP+ VN 
Sbjct: 305 KQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSSVDN--SPFVIAIKLHHIKVLPSIVNV 362

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ ++S  N+ I+  SR L  +A  G  P  F  ++R   P+VG +  SL G LA++ 
Sbjct: 363 VILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLV 422

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPF----RMWFQP 443
              S   VF+++ +   +   + W  I +++I +  A+KA+G  +D++ F     +W   
Sbjct: 423 KSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLDELEFVSAVGIWGSA 482

Query: 444 YAA 446
           Y+A
Sbjct: 483 YSA 485

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  204 bits (519), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 136/495 (27%), Positives = 241/495 (48%), Gaps = 19/495 (3%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           +L+R L PR ++++++   +GTGL + +  +L  GGP SLFI Y   G ++ + +  L E
Sbjct: 56  SLNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYLTMLCLGE 115

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXX- 149
           M++F P+   F  Y  ++   +F FA   NY+   A+ ++++LTA  LV+ YW+      
Sbjct: 116 MSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKSSQHNF 175

Query: 150 --XXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N + V+ +GE E  L + K++ +VI +I  +++  G  P+H   
Sbjct: 176 PYWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVGHNPDHEYI 235

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           GF+YW    A P++ G     F G+    V S F + G+E I +  GE  NP +  P+  
Sbjct: 236 GFKYWSYKEA-PFVNG-----FKGFVTIFVSSAFSYGGTESITLTAGEARNPIRNTPRIV 289

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             VF+RI   YV  +F + + I P +   +   S     SPF I    +G K   +F+NA
Sbjct: 290 KTVFWRILIFYVATMFFISMNI-PYDYPNLSTKS--VMTSPFTIIFQMAGTKAAGSFMNA 346

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDG-AAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
            +L  I+S+ N  ++  SR LY +  +G   PK+    NR++ P V  +    +G L + 
Sbjct: 347 VILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVILTWAVGGLCFG 406

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAA 446
            +   A T+++++ + V V   + W  I +  I + + +  +G    ++ F+ W  PY  
Sbjct: 407 ASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQG-KTQELQFKNWTYPYGP 465

Query: 447 YXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSEIS 506
           Y             G++AF   +    F + Y+ +F      + + ++ + +FVKP ++ 
Sbjct: 466 YFLVIFVTLIILVQGWSAF-DPWSTSDFFSYYLELFVFPTCWLIWWIFKRDRFVKPEDMD 524

Query: 507 FRT----RNEHEGEE 517
           F T    ++  E EE
Sbjct: 525 FITDRYIQSPQEIEE 539

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  204 bits (520), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 126/440 (28%), Positives = 229/440 (52%), Gaps = 8/440 (1%)

Query: 3   EKKG-TVVLERPASGXXXXXXXXXXXKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSA 61
           E +G T+  E+  +G               + + +K R +++++LG+ +GTGL++ +G A
Sbjct: 46  EPQGQTIREEKLENGLETVRTNDYNATQKKMKQTMKSRHITMISLGTGIGTGLLVANGKA 105

Query: 62  LAKGGPISLFIAYLFTGSLLCVVIFSLSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWN 120
           L  GGP  L I Y+ T ++L  VI +  E+  S+A +   ++ Y +  VD  F FA  W 
Sbjct: 106 LHFGGPGGLVIGYVTTSTMLYCVIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWV 165

Query: 121 YFLKYAIVLSANLTAFGLVIGYWRPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTV 180
           Y L++AIVL   L    + I YW                    +F   + + E E +   
Sbjct: 166 YGLQWAIVLPLELVTSSMTIKYWNDSINPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNS 225

Query: 181 FKLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGALPYLVGGGTGKFLGWWACVVQSI 240
            K+L++V   I  + + CG + +    G +YW   GA  ++       F G  +  VQS 
Sbjct: 226 CKVLMMVGFIIMGISVNCGASKSGYIGG-KYWHTPGA--FVGEKAIDHFKGICSVWVQSA 282

Query: 241 FGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAH 300
           F + GSE I +   E  NP+K++PK++    +R+  +++  + ++G  + P +S L+   
Sbjct: 283 FAYGGSEFIALTAAEQTNPRKSVPKATKRWLYRVLIVFLTPIILVGFLV-PYDSPLLLGS 341

Query: 301 STDA--NASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAP 358
              A  +ASPFVIA +S G+KV+P+ +NA +L+ +IS  N+  Y   R L  LA+ G  P
Sbjct: 342 PGQAASHASPFVIAAASHGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAEQGMGP 401

Query: 359 KIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAY 418
           K+F  V+R   P+V  +  ++ G ++++    +  TVF+++++ VS+  +  W  I +++
Sbjct: 402 KVFTYVDRKGRPLVTMLFVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSAISLSH 461

Query: 419 INYDRAIKAKGISIDDIPFR 438
           I +  A+K +G S+ ++ ++
Sbjct: 462 IRFRDAMKTQGRSLGELGYK 481

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  205 bits (522), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 139/492 (28%), Positives = 243/492 (49%), Gaps = 9/492 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           ++ +L + +KPR V +++LG+ +GTGL++G+ S L+  GP  L I Y   GS L  +I +
Sbjct: 118 ESDDLQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLYCIIQA 177

Query: 88  LSEMAS-FAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             EMA  ++ ++ GF+ Y +  +DPA GF+  W Y L++  V    L    L I YW   
Sbjct: 178 AGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIKYWTTK 237

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N    + + E E    V K+L+++  +I  +IIT GGA N   
Sbjct: 238 VDPDVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGGAGNDGY 297

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G +YW E GA  +       +F G     V + F F  +E I +   E +NP+K IP +
Sbjct: 298 LGAKYWHEPGA--FRGEHAVDRFKGVMDTFVAAAFAFGATEFIALTAAEQSNPRKAIPSA 355

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           +  V +RI  +++  + +LG  +   + +L+ +  +   ASP+V+A+S  G++V+P+F+N
Sbjct: 356 AKKVLYRIVLIFLVSIIMLGFLVPYDSDQLLGSSGSGVKASPYVLAVSLHGVRVVPHFIN 415

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ ++S  N+  Y  SR L  L++ G APK F  V+R   P    +  +L G +A+ 
Sbjct: 416 AVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAMLMSALFGVIAFC 475

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAA 446
            T      VF+++ +   +  +  WF I ++++ +  A+K +G SI ++ F      Y +
Sbjct: 476 ATSPKETDVFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEVGFHSQTGVYGS 535

Query: 447 YXXXXXXXXXXXXNGYNAFII----KFHYKTFITSYIGVFANILMVIGYKLYFKT--KFV 500
                          + A       K   + F  SY+ +   I +  GYKLY++    ++
Sbjct: 536 LYAATMMILALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFGYKLYYRDWKLYI 595

Query: 501 KPSEISFRTRNE 512
           K  +I   +  +
Sbjct: 596 KADKIDLISHRQ 607

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  203 bits (517), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 136/483 (28%), Positives = 234/483 (48%), Gaps = 15/483 (3%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           +L+R L PR ++++++   +GTGL + +  +L  GGP SLF+ Y   G ++ + +  L E
Sbjct: 45  DLTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVYLTMLCLGE 104

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXX- 149
           M++F P+   F  Y  ++   +F  A  WNY+   A+ ++++LTA  LV+ YW       
Sbjct: 105 MSTFMPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDYWHTADHHF 164

Query: 150 --XXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N + V+ +GE E  L + K++ +VI +I  +I+  G  P H   
Sbjct: 165 PYWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVGKNPQHEYI 224

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           GF+ W   G  P++ G     F G+ +  V + F + G+E I +  GE +NP +  PK  
Sbjct: 225 GFKNWTH-GEAPFVNG-----FKGFASLFVSACFAYGGTESITLTGGEASNPVRNTPKIV 278

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             VF+RI   YV   F +G+ I P +   +   S     SPF +    +G +   +F+NA
Sbjct: 279 KTVFWRILIFYVLSTFFIGMNI-PYDYPGLSTKS--VMTSPFTLVFQMAGTRGAGSFMNA 335

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAP-KIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
            +L  +IS+ N  ++  SR +Y +A DG  P KI    NR+K P V  +    +G L   
Sbjct: 336 VILTSVISACNHALFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVLITWAVGGLCLG 395

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAA 446
            +   A T+++++ + V V   + W  I I  I + + ++ +G   D + F+ W  P+  
Sbjct: 396 ASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQG-KTDLLQFKNWTYPFGP 454

Query: 447 YXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSEIS 506
           Y             G+ AF   +    F + Y+ +F    + I + L+ +  FVK  ++ 
Sbjct: 455 YFLVIFTVFIILIQGWQAF-DPWSVTDFFSVYLELFVFPFVYIIWWLWKRDWFVKYEDMD 513

Query: 507 FRT 509
           F T
Sbjct: 514 FVT 516

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  204 bits (520), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 129/485 (26%), Positives = 241/485 (49%), Gaps = 12/485 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K+  L + ++PR V +++LG+ +GTGL++G+G AL  GGP  L + +   G+ +  VI +
Sbjct: 85  KHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMGTCVYCVIQA 144

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             EMA ++  +  GF+ Y +  VDP FGFA  W Y +++  V    L    + I YW   
Sbjct: 145 AGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTASITIKYWTTA 204

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            NF   + + E E      K+L+++  +I  +++  G A N   
Sbjct: 205 INPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVNTGAAGNDGY 264

Query: 207 TGFRYWRESGALPYLVGGGTG--KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
            G +YWRE G+     GG T    F G  + +V + F    SE + +   E ANP+K++P
Sbjct: 265 IGAKYWREPGSF----GGHTAIDHFKGVVSTLVNAAFSLGCSEFVALTAAEQANPRKSVP 320

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
            ++  + +++  +++  V ++G  +   +S+L+ +  +  + SP+VIA++S G++V+P+F
Sbjct: 321 SAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPYVIAVASHGVRVVPHF 380

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           +NA +L+ ++S  N+  Y  SR L  LA+ G AP +F  ++R   P++  +    +G L 
Sbjct: 381 INAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAMMVSITMGCLC 440

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPY 444
           ++       TVF ++ +   +  +  W  I I++I + +A+  +G   D + F+     +
Sbjct: 441 FVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDGLGFKAQTGVW 500

Query: 445 AAYXXXXXXXXXXXXNGYNAFI----IKFHYKTFITSYIGVFANILMVIGYKLYFKT-KF 499
            +Y              +   I     K + ++F   Y+     + +  GYK+Y K  + 
Sbjct: 501 GSYYSAVIMILTFIAQFWTCLIPMGSSKPNAESFFEGYLAFPIFVALYFGYKIYNKNWQL 560

Query: 500 VKPSE 504
             P+E
Sbjct: 561 FIPAE 565

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  205 bits (522), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 117/410 (28%), Positives = 208/410 (50%), Gaps = 7/410 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N  L + +KPR V +++LG+ +GTGL++G+   LA  GP  L I Y   G+ +  +I + 
Sbjct: 156 NAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYCIIQAC 215

Query: 89  SEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            EMA ++  +   F+ + +  VDP F FA  W Y +++  V    L    + I YW    
Sbjct: 216 GEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQYWTTKV 275

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           NF   K + E E +    K+L++   +I  + I  G A      
Sbjct: 276 DPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAGTDGYI 335

Query: 208 GFRYWRESGALPYLVGGGTG--KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           G +YW + GA      G T   +F G     V + F F  +E I +   E +NP+K IP 
Sbjct: 336 GAKYWNDPGAFR----GQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPS 391

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFV 325
           ++  + +R+  +++  + ++G  +   + +L+ +  +   ASP+V+AIS  G++V  +FV
Sbjct: 392 AAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKASPYVLAISLHGVRVAQHFV 451

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ +IS  N+  Y  SR L  LA+ G+APKIF  V+R   P++     +++  +A+
Sbjct: 452 NAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCSAVIAVIAF 511

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDI 435
             T      VF+++ +   +  +  WF I ++++ + RA+K +G S+ ++
Sbjct: 512 CATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEM 561

>KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  202 bits (515), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 138/491 (28%), Positives = 244/491 (49%), Gaps = 15/491 (3%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           +L+R LKPR ++++++   +GTGL + + ++L KGGP SLFI Y   G ++ + +  L+E
Sbjct: 49  DLTRALKPRHINMISIAGIIGTGLYLSTSTSLHKGGPASLFINYSLIGGIVYLTLLCLAE 108

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXX- 149
           M+++ P+   F  Y  ++   +F  A  WNY+   A+ ++++LTA  LV+ YW  D    
Sbjct: 109 MSTYMPISGSFCTYAKKFGSDSFAMALMWNYWFNDAVSVASDLTALQLVMDYWNTDSNHF 168

Query: 150 --XXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N + V+++GE E  L + K++ ++I +I  +I+  G  P H   
Sbjct: 169 PYWAASLIFWFFVLSLNVIHVRFYGEAEYWLAMLKVIAIIIFFIMSIIVNVGHNPQHEYI 228

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           GF+ W   G  P++ G     F G+ +  V + F + G+E I +  GE+ NP +  PK  
Sbjct: 229 GFKNW-TVGEAPFVDG-----FKGFASLFVSASFAYGGTESITLTSGESDNPLRNTPKIV 282

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             VF+RI F Y+   F + + + P N   + + S     SPF I    +G     +F+NA
Sbjct: 283 KTVFWRILFFYIGTTFFIAMNV-PYNYPGLSSGSVV--TSPFTIVFKMAGTAGAGSFMNA 339

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPK-IFLLVNRFKVPVVGCVTGSLLGFLAYM 386
            ++  +IS+ N  ++  SR +Y +  +G  PK I    NR+KVP V  +    +G L + 
Sbjct: 340 VIMTSVISACNHALFAGSRIMYNMGLEGYLPKSIVSRTNRYKVPYVAVLITWAVGGLCFG 399

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAA 446
            +   A T+++++ + V V   L W  I I  I + + ++A+     ++ F+ W  P+  
Sbjct: 400 ASFIGAGTLWTWLQNIVGVSNQLAWLCIAITSIRFRQGLEAQN-KTHELKFKNWTYPFGP 458

Query: 447 YXXXXXXXXXXXXNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVKPSEIS 506
           Y             G+++F   ++   F + YI +F      I + LY +  FVK  ++ 
Sbjct: 459 YFLVVAVTFIILVQGWSSF-APWNVSNFFSVYIELFVFPFCFIIWWLYKRDPFVKCKDMD 517

Query: 507 FRTRNEHEGEE 517
           F T      +E
Sbjct: 518 FVTDKYVPSQE 528

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  203 bits (517), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 116/413 (28%), Positives = 211/413 (51%), Gaps = 7/413 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           +  L + +K R V ++TLG+ +GTGL++ +   L  GGP +L I Y     +   +I + 
Sbjct: 88  DSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQAA 147

Query: 89  SEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            EMA ++  +   F+ Y + ++   FGFA  W Y  ++  VL   L    + I +W    
Sbjct: 148 GEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFWNDTI 207

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           +F  VK +GE E +    K+L++    I  ++I CGGA N    
Sbjct: 208 NPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGNDGYI 267

Query: 208 GFRYWRESGALPYLVGGGT--GKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           G +YWR  GA      G T  G+F      +V + F F G E+  +   E ANP+KT P 
Sbjct: 268 GGKYWRNPGAF----AGDTSAGRFKNVCYILVTAYFSFGGMELFALSVQEQANPRKTTPV 323

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFV 325
           ++    +RI  +Y+  + ++G  +   + +L+ A  +  +ASP+V+A S  G+KV+P+ +
Sbjct: 324 AAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKVVPHII 383

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ +IS AN+ +Y   R +  LA+ G  PK    V+R   P++  +  S+ G + +
Sbjct: 384 NAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSVFGVIGF 443

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
           +        VF+++ +   +  +  W  I+++++ + +A+K +G S+D++ ++
Sbjct: 444 VAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYK 496

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  204 bits (519), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 140/495 (28%), Positives = 242/495 (48%), Gaps = 10/495 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + ++PR V L++LG+ +GTGL++G+G+ LA+ GP  L I Y   GSL+  +I +  E
Sbjct: 115 KLKKTIQPRHVILISLGTGIGTGLLVGNGATLAQAGPAGLVIGYGIMGSLIYCIIQACGE 174

Query: 91  MA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXX 149
           MA ++  +  GF+ Y    +DP F FA  W Y L++  V    L    + I YW      
Sbjct: 175 MAVNYLTLVGGFNAYPTFLIDPGFSFATAWVYCLQWLCVCPLELVTASMTIKYWTTKVDP 234

Query: 150 XXXXXXXXXXXXXXNFLA-VKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTG 208
                         N L   + + E E +    K+L+++  +I  +II CGGA      G
Sbjct: 235 DVFVIIFYVFILGINILGGARGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGTDGYIG 294

Query: 209 FRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSM 268
            RYW + GA  +       +F G  A +V + F F  SE I +   E +NP++ IP ++ 
Sbjct: 295 GRYWHDPGA--FRGERAVDRFKGVVATLVTAAFSFGQSEFIAVTASEQSNPRRAIPSAAK 352

Query: 269 NVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAA 328
            + +R   +Y+  + +LG  +   +S+L+ A S    ASP+V+A+++ G++V+P+F+NA 
Sbjct: 353 KIIYRALCIYLASIILLGFLVPYNSSQLLGAQSNGIKASPYVLAVANHGVRVVPHFINAV 412

Query: 329 LLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNT 388
           +++ ++S +N+  Y   R L  L++ G APKIF  V+R   P +G +  SL   +A+  T
Sbjct: 413 IIISVLSVSNSAFYSSPRMLLTLSQQGFAPKIFSYVDRAGRPTMGIIVASLFAVIAFCAT 472

Query: 389 KKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAYX 448
                 VF+++ +   +  I  W  I ++++ + RA+  +G S+ +  F      Y +  
Sbjct: 473 SPKEDQVFTWLLAVSGLSQIFTWMSICLSHLRFRRAMTVQGRSLGECGFLSQVGIYGSAY 532

Query: 449 XXXXXXXXXXXNGYNAF----IIKFHYKTFITSYIGVFANILMVIGYKLYFKT--KFVKP 502
                        + A       K    +F  +Y+     I + IGYK Y K    ++K 
Sbjct: 533 SFFVLALILVGQFWVALKPVGSKKVDANSFFENYLAAPIWIALYIGYKCYTKDWRLYIKS 592

Query: 503 SEISFRTRNEHEGEE 517
            +I      +   E+
Sbjct: 593 QDIDLVAHRQIYDED 607

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  204 bits (518), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 127/413 (30%), Positives = 212/413 (51%), Gaps = 5/413 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +N +L + +K R V L++LG+ +GTGL++G+   L   GP  L I Y   GS L  +I +
Sbjct: 113 ENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQA 172

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             E+A  ++ +   F+ Y    VD AFGFA  W Y L++  V    L    + I YW   
Sbjct: 173 CGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 232

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N    + + E E      K+L++   +I  +IITCGGA     
Sbjct: 233 VNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGY 292

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G +YW   GA  +        F G  A    + F F  SE I +   E +NP+K IPK+
Sbjct: 293 IGAKYWHSPGA--FNGNRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSNPRKAIPKA 350

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDA-NASPFVIAISSSGIKVLPNFV 325
           +  + +RI F+++  + ++G  + P NS  +    +DA  ASP+V+A++S G++V+P+F+
Sbjct: 351 AKMMIYRILFVFLSSITLIGFLV-PYNSPYLLGSGSDATKASPYVVAVASHGVRVVPHFI 409

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ ++S  N+  Y  SR L  LA+ G APK+F  +++   P+V  V  +L   +A+
Sbjct: 410 NAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLFMTIAF 469

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
                    VF+++ +   +  +  W  I I+++ + RA+K +G S+ +I F+
Sbjct: 470 CAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFK 522

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  204 bits (518), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 120/414 (28%), Positives = 215/414 (51%), Gaps = 7/414 (1%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +N  L + +KPR V +++LG+ +GTGL++G+G+ LA+ GP  L I Y   G+ L  +I +
Sbjct: 146 ENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGIMGTCLYCIIQA 205

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             E+A +++ ++  F+ + +  VDP F FA  W Y +++  V    L    + I YW   
Sbjct: 206 CGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTSSMTIKYWTTK 265

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            NF   K + E E      K+++++  +I  + I  G A     
Sbjct: 266 VDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAICINTGAAGTDGY 325

Query: 207 TGFRYWRESGALPYLVGGGTG--KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIP 264
            G +YW + GA      G T   +F G     V + F F  +E I +   E +NP+K IP
Sbjct: 326 IGAKYWNDPGAF----RGQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIP 381

Query: 265 KSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNF 324
            ++  V +RI  +++  + ++G  +   + +L+ + S   +ASP+V+A S  G+ V+ +F
Sbjct: 382 SAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSASPYVLAASLHGVHVVQHF 441

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           +NA +L+ ++S AN+  Y  SR L GLA+ G APK F  V+R   P+   +  +++  +A
Sbjct: 442 INAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLRSMLCAAIIAVIA 501

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
           +  T      VF+++ +   +  I  WF I +++I + R ++ +G S+ ++ FR
Sbjct: 502 FCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSLGELGFR 555

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  202 bits (514), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 129/474 (27%), Positives = 230/474 (48%), Gaps = 8/474 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N +L + +K R V +++LG+ +GTGL++ +   L   GP SL I Y+    +   ++ + 
Sbjct: 83  NNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFVTYFMVQAA 142

Query: 89  SEMASFAPMDKG-FSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            EM    P   G F+ Y + +V  +FGFA  W + +++  VL   L    + I YW    
Sbjct: 143 GEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDTI 202

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           +F  VK +GE E +    K+L++    I  +II CGGA      
Sbjct: 203 NADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSVIINCGGAGVDGYI 262

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G  YWR  G+  +  G    +F G    +V + F F G E+  +   E ANP+K+ P ++
Sbjct: 263 GGEYWRNPGS--FADGSSATRFKGICFILVTAYFSFGGIELFVLSINEQANPRKSTPVAA 320

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
               +RI  +Y+  + ++G  +   N +L+ + S+  +ASP+V+A S  G+KV+P+ +NA
Sbjct: 321 KRSIYRILIIYLLTMILIGFNVPHDNDQLMGSGSSATHASPYVLAASIHGVKVIPHIINA 380

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ +IS AN+ +Y   R +  LA+ G APK    ++R   P+   V  S +G + ++ 
Sbjct: 381 VILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSFVGLVGFVA 440

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAY 447
                   F+++ +   +  I  W  I++++I + +A+K +G S+D++ ++     + +Y
Sbjct: 441 CSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKSNTGIWGSY 500

Query: 448 XXXXXXXXXXXXNGYNAFII-----KFHYKTFITSYIGVFANILMVIGYKLYFK 496
                         + A        K   ++F  SY+     I M +GY +Y K
Sbjct: 501 YGVIFNILVFMAQFWVALSPPGSDGKCDVESFFQSYLAAPLWIFMYLGYMIYNK 554

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  200 bits (509), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 115/409 (28%), Positives = 210/409 (51%), Gaps = 3/409 (0%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           +L + +K R V ++++G+ +GTGL++ +   L   GP SL I Y+    +   +I +  E
Sbjct: 52  HLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGE 111

Query: 91  MASFAPMDKG-FSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXX 149
           MA   P   G F+ Y + ++   FGFA  W +F+++  V    L    L + YW      
Sbjct: 112 MAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWNDKINA 171

Query: 150 XXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGF 209
                         +F  VK +GE E +    K+L++    I  ++I CGGA      G 
Sbjct: 172 DVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYIGA 231

Query: 210 RYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           +YW + G+  +  G    +F G    +V + F + G+E+  +   E  NP+K+ P ++  
Sbjct: 232 KYWHDPGS--FADGPPITRFKGVCFILVSAYFSYGGAELFSLSVNEQENPRKSTPAAAKQ 289

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
             +RI  +Y+  + ++G  +   + +L+ A S   +ASP+V+A S   +KV+P+F+NA +
Sbjct: 290 SIYRILIIYLATMILIGFNVPHNSDELMGAGSAATHASPYVLAASLHSVKVVPHFINAVI 349

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L+ +IS AN+ +Y   R +  LA+ G APK    V+R   P+ G +  +L G + +++  
Sbjct: 350 LISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSAS 409

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
                VF+++ +   +  +  W  I++++I + +A+K  G S D+I F+
Sbjct: 410 SKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFK 458

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  201 bits (510), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 113/408 (27%), Positives = 210/408 (51%), Gaps = 3/408 (0%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           + NL + +K R V +++LG+ +GTGL++ +   L   GP SL I Y     +   VI + 
Sbjct: 74  DDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYFVIQAA 133

Query: 89  SEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            EMA ++  +  GF+ Y + +V   FGFA  W + +++  VL   L    + I YW    
Sbjct: 134 GEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDKI 193

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           +F  V+ +GE E +    K+L++    I  +++ CGGA      
Sbjct: 194 NADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAGVDGYI 253

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YWR+ GA  +       +F G    +V + F + G E+  +   E  NP+++ P ++
Sbjct: 254 GGKYWRDPGA--FASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENPRRSTPAAA 311

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
               +RI  +Y+  + ++G  +   + +L+ A  +  +ASP+V+A+S  G+KV+P+ +NA
Sbjct: 312 KQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVKVVPHIINA 371

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ + S AN+ +Y   R L  LA+ G APK F  V+R   P+   +  S+ G +A+  
Sbjct: 372 VILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCA 431

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDI 435
                  +F+++ +   +  +  W  IL++++ +  A+KA+G S++++
Sbjct: 432 CSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNEL 479

>TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.368
           YOL020W
          Length = 590

 Score =  201 bits (510), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 146/484 (30%), Positives = 235/484 (48%), Gaps = 22/484 (4%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
           NL R LK R + ++ +G ++GTGL IGSG ALA GGP++L + +   GS +   I  L E
Sbjct: 75  NLKRSLKSRHLIMIAIGGSIGTGLFIGSGQALANGGPLALVLGWSIAGSQIVGTIHGLGE 134

Query: 91  MASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           +    P+   F+ Y  R++DP+  F     Y L++  VL   + +  + + YW       
Sbjct: 135 ITVRFPVVGAFANYQTRFLDPSLSFVISTIYVLQWFFVLPLEILSSAITVQYWNDTIDPV 194

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        N   V+ FGE E + +  K++ +    I C+I+ CGG P H   G +
Sbjct: 195 VFVAIFYCAIVSINLFGVRGFGEAEFVFSTIKVITVTGFIILCIILICGGGPTHEFIGAK 254

Query: 211 YWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNV 270
           YW + G L          F G+ + ++ + +   G+EM  +  GET +PK+ +P +   V
Sbjct: 255 YWHDPGCL-------ANGFRGFLSVLITASYSLGGTEMTCLASGET-DPKE-LPSAIKQV 305

Query: 271 FFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAALL 330
           F+RI F ++  + ++G  +   N  L+   S D   SPFVIAI    IKVLP+ VNA +L
Sbjct: 306 FWRILFFFLVSLTLVGFLVPYTNENLLGGSSVDN--SPFVIAIKLHNIKVLPSIVNAVIL 363

Query: 331 VFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKK 390
           + I+S  N+ I+  SR L  +A  G  P  F  ++R   P+ G V  SL G LA++    
Sbjct: 364 ISILSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLTGIVINSLFGLLAFLVKSS 423

Query: 391 SAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR----MWFQPYAA 446
           S + VF ++ +   +   + W  I I +I +  A+KA+  +ID++ F     +W   Y+A
Sbjct: 424 SVSEVFDWLMAIAGLATCIVWLSINICHIRFRLAMKAQNKTIDELEFVSAVGVWGSVYSA 483

Query: 447 YXXXXXXXXXXXXN-----GYNAFIIKFHYKTFITSYIGVFANILMVIGYKLYFKTKFVK 501
                        +     G+     K     F  +Y+    +++  I +KLYF+ K  K
Sbjct: 484 IINSLILIVQFYVSLWPIGGWTDS--KDRAGKFFQNYLCAIVSLIFFICHKLYFRYKTKK 541

Query: 502 PSEI 505
             EI
Sbjct: 542 WWEI 545

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  200 bits (509), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 114/420 (27%), Positives = 214/420 (50%), Gaps = 3/420 (0%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           +  L + +K R V +++LG+ +GTGL++ +   L K GP  L IAY     +   +I + 
Sbjct: 72  DTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAA 131

Query: 89  SEMASFAPMDKG-FSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            EMA   P   G F+ Y++ ++   FGFA  W +F+++  VL   L    + + YW    
Sbjct: 132 GEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYWNDSI 191

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           +F  VK +GE E +  + K+L +    I  +++  GGA N    
Sbjct: 192 NADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSGYI 251

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW + GA  +      G+F G    +V + F + G E+  +   E  NP+++ P ++
Sbjct: 252 GAKYWHDPGA--FTSDTNAGRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRSTPTAA 309

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
               +RI  +Y+  + ++G  +   +++L+ +  +  +ASP+V+A S  G+KV+P+ VNA
Sbjct: 310 KQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTHASPYVLAASIHGVKVVPHIVNA 369

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ +IS  N+ +Y   R +  LA+ G APK    V+R   P+   +  S+ G + ++ 
Sbjct: 370 VILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGVIGFVA 429

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAY 447
                  VF+++ +   +  +  W  I+I++I + +A+K +  S+D++ ++  F  Y +Y
Sbjct: 430 CSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFGVYGSY 489

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  200 bits (509), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 115/438 (26%), Positives = 222/438 (50%), Gaps = 9/438 (2%)

Query: 3   EKKGTVVLERPASGXXXXXXXXXXXKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSAL 62
           EK  T     P++G            +  L R +KPR V+++++ + +GTGL++ +G +L
Sbjct: 59  EKHST-----PSNGDLEHATTHSVASSSPLKRSIKPRHVAMMSICTGIGTGLLVANGKSL 113

Query: 63  AKGGPISLFIAYLFTGSLLCVVIFSLSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNY 121
             GGP  L I Y     +  +++ +  EMA ++  +   F+ Y ++ +   FGFA  W Y
Sbjct: 114 RFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWLY 173

Query: 122 FLKYAIVLSANLTAFGLVIGYWRPDXXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVF 181
            +++  VL   L    L I YW                    +F   + +GE E +  + 
Sbjct: 174 CIQWLTVLPLELITASLTIKYWNDSINADVFIAIFYVFILFIHFFGSRGYGESEFIFGIC 233

Query: 182 KLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIF 241
           K+L+++   I  ++I CGGA +    G +YW + GA  + VG G  KF G    +V   F
Sbjct: 234 KVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGA--FAVGSGATKFKGVAYVLVTGYF 291

Query: 242 GFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHS 301
            + G+E+  +   E +NP++ I   +    +RI  +Y+  + ++G  +   +S+L+ +  
Sbjct: 292 SYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSG 351

Query: 302 TDA-NASPFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKI 360
             A +ASP+V+A+S  G+K++P+ +NA +L+ +IS  N+ +Y   R L  LA+ G AP+ 
Sbjct: 352 KSATHASPYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRF 411

Query: 361 FLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYIN 420
              V+R   P+V  +  S+ G LA++        VF+++ +   +  +  W  I+++++ 
Sbjct: 412 LAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVR 471

Query: 421 YDRAIKAKGISIDDIPFR 438
           + +A++     + ++ ++
Sbjct: 472 FRQAMRYNNRPLSELGYK 489

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  200 bits (509), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 115/408 (28%), Positives = 216/408 (52%), Gaps = 4/408 (0%)

Query: 32  LSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSEM 91
           + + LK R V +++LG+ +GTGL++ +  +LA GGP SL I Y+    ++  +I +  EM
Sbjct: 90  MKKSLKARHVIMMSLGTGIGTGLLVANAKSLAYGGPASLIIGYVIVSFIVYFMIQAAGEM 149

Query: 92  ASFAPMDKG-FSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXXX 150
           A   P   G F+ Y + ++  ++GFA  W + +++  VL   L    L I YW  D    
Sbjct: 150 AVTYPTLPGNFNTYQSIFISKSWGFATVWLFCIQWITVLPLELITSSLTIQYWT-DLNGD 208

Query: 151 XXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGFR 210
                        +F+ VK +GE E +  + K+L++    I  +++ CGGA N    G +
Sbjct: 209 IFVVIFYVFLLLIHFIGVKAYGETEFIFNLCKILMISGFIIFSIVVNCGGAGNDGYIGGK 268

Query: 211 YWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNV 270
           YW   G+  +  GG T +F G    +V   F + G+E+  +   E A P+K  P ++   
Sbjct: 269 YWHTPGS--FAEGGPTSRFKGICYVLVAGYFSYGGTELYVLSVNEQAEPRKATPAAAKKS 326

Query: 271 FFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAALL 330
            +RI  +Y+  + ++G  +   + +L+ A  +  +ASP+V+A S  G+KV+P+ +NA +L
Sbjct: 327 IYRILVIYLLTMILIGFNVPHNSDQLMGAGGSSTHASPYVLAASIHGVKVVPHIINAVIL 386

Query: 331 VFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKK 390
           + ++S AN+ +Y   R L  LA+ G APK    ++R   P+V  +  ++ G +A++ +  
Sbjct: 387 ISVVSVANSSLYASPRLLASLAEQGYAPKALTYIDREGRPLVALLLCAVFGCIAFVASSD 446

Query: 391 SAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
               VF+++ +   +  +  W  I+ +++ +  A+K +   ID++ ++
Sbjct: 447 KEEQVFTWLAAIAGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYK 494

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  200 bits (508), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 116/409 (28%), Positives = 211/409 (51%), Gaps = 3/409 (0%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L + +K R V L++LG+ +GTGL++ + S+L  GGP  L I Y F   +  +++ +  E
Sbjct: 70  KLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVSIISYIMMQAAGE 129

Query: 91  MASFAPMDKG-FSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXX 149
           MA   P   G F+ Y + ++   FGFA  W + +++  +L   L    +V+ YW      
Sbjct: 130 MAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWTTILPLELITSSIVVKYWTTKINA 189

Query: 150 XXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGF 209
                         +F   + +GE E +    K+L++    I  ++I CG   +    G 
Sbjct: 190 DIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGILINCGAVGDDGYIGG 249

Query: 210 RYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           +YW E GA  +  G G  +F G    +V + F + G E+  +   E  NP+K IP +   
Sbjct: 250 KYWHEPGA--FAAGSGIDRFKGIAYVLVTAYFSYGGMELYALSVNELPNPRKAIPSACAK 307

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNAAL 329
             +RI  +Y+  + I+G  +   ++KL+ + S+  + SP+V+A+S  GIK++P+ +NA +
Sbjct: 308 GVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSSGVHPSPYVLALSLHGIKIVPHIINAVI 367

Query: 330 LVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTK 389
           L+ +IS  N+ +Y   R L  LA+ G APKI   V+R   P++  +  S+ G +A++   
Sbjct: 368 LISVISVGNSAMYSGPRLLCSLAQQGYAPKILDYVDRQGRPLMALIICSVFGLIAFVAAS 427

Query: 390 KSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
           K    +F ++ +   +  +  W  I +++  + RA+K +G S++ + +R
Sbjct: 428 KYEEDIFGWLAAISGLSELFTWTAICLSHFRFRRAMKLQGRSLETLGYR 476

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  200 bits (508), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 110/414 (26%), Positives = 218/414 (52%), Gaps = 6/414 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N  L + LK R V++++LG+ +GTGL+I +G  L+  GP  L I Y         ++ + 
Sbjct: 96  NAGLKQALKTRHVAMMSLGTGIGTGLLIANGKGLSNAGPAPLLIGYGLVSVNTYFMVQAA 155

Query: 89  SEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            E+A +F  +   F+ Y ++ V   FGFA  W +F+++  +    L A    + +W    
Sbjct: 156 GELAVAFPTIPGSFNAYTSQLVSRPFGFATTWLFFVQWLTMFPMELIAMTFAVRFWTTRV 215

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           +F+ V+ +GE E  L +FK+L+++   I  + +  GGA +    
Sbjct: 216 DADVFVLIFFVFLFIVHFIGVEAYGETEFFLNLFKVLMVIGFVIFAICVAAGGAGDSGYI 275

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YW + GA  ++     G+F G    +V + F + G+E+  +   E  NP+KTIP ++
Sbjct: 276 GAKYWHDPGA--FVSHTAEGRFKGVCYVLVSAYFSYGGTELFVLSVNEQENPRKTIPTAT 333

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLV---HAHSTDANASPFVIAISSSGIKVLPNF 324
               +RI F+Y+  + ++G  +   + +L+   +A     + SP+V+A S   ++VLP+F
Sbjct: 334 KTTIYRIIFIYLLTMVLVGFTVPNNHPRLMGSPYAKEGVQSVSPYVLAASYHHVRVLPHF 393

Query: 325 VNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLA 384
           +NA +++ ++S +N+ +Y   R +  LA+ G  PK F  ++R   P    V   ++G +A
Sbjct: 394 INAVVMLALVSMSNSAMYAAPRLICSLAQQGYCPKYFDYIDRRGRPTRALVLCFIIGVIA 453

Query: 385 YMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
           + ++ +   T+FS++++   +  +  W  I+++++ +  AIK +G  I+++ ++
Sbjct: 454 FASSSEKRETIFSWLSAIAGLSELFTWSSIMLSHVRFRAAIKVQGKDINELGYK 507

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  200 bits (508), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 119/411 (28%), Positives = 209/411 (50%), Gaps = 14/411 (3%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L++ +KPR + +++LG+ +GTGL++G+G  L+K GP  L I Y     ++  V+ +  E
Sbjct: 105 QLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMIYCVVQAAGE 164

Query: 91  MA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXX 149
           +   ++ +   ++ Y    +DPA GFA    Y L++  VL   L    + I YW  +   
Sbjct: 165 LGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTIRYWTTNVNP 224

Query: 150 XXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGF 209
                         N    K + E E      KLL++    I  ++I CGGA +    G 
Sbjct: 225 DIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIVINCGGAGDKEYIGV 284

Query: 210 RYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSSMN 269
           +YW+  GA           F G  A    + F + G E++ +   E ANP+K IP +   
Sbjct: 285 KYWQTPGAF-------ANGFKGVAAVFCYAAFSYGGIEVLVLTANEQANPRKAIPDACRK 337

Query: 270 VFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTD---ANASPFVIAISSSGIKVLPNFVN 326
           V +R+ FLY+    I+   + P NS  +   + D   ++ASPFVIA++S G++V+P+ +N
Sbjct: 338 VVYRVLFLYMLTTIIVCFLV-PYNSPALLGSNNDGSGSDASPFVIAVASHGVQVVPHIIN 396

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           AA+L+ +IS AN+ +Y   R L  L++ G APK F  ++R   P++  +    +G +A++
Sbjct: 397 AAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRRGRPIICVLVSVAMGLIAFL 456

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAK--GISIDDI 435
               +   VF+++ +   +  I  W  I I+++ +  AI+++  G+   D+
Sbjct: 457 AAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRFRDAIRSQLGGLRARDV 507

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  199 bits (505), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 111/411 (27%), Positives = 213/411 (51%), Gaps = 3/411 (0%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N +L + +K R V +++LG+ +GTGL++ +   L+  GP SL I Y+    +   ++ + 
Sbjct: 83  NNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAA 142

Query: 89  SEMASFAPMDKG-FSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            EM    P   G F+ Y + ++  +FGFA  W + +++  VL   L    + + YW    
Sbjct: 143 GEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWNDTI 202

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           +F  VK +GE E +    K+L++    I  ++I CGGA      
Sbjct: 203 NADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYI 262

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YWR+ G+  +  G G  +F G    +V + F F G E+  +   E +NP+K+ P ++
Sbjct: 263 GGKYWRDPGS--FAEGSGATRFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAA 320

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
               +RI  +Y+  + ++G  +   N +L+ +  +  +ASP+V+A S   ++V+P+ +NA
Sbjct: 321 KRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHKVRVIPHIINA 380

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ +IS AN+ +Y   R +  LA+ G APK    ++R   P+   V  SL+G + ++ 
Sbjct: 381 VILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVGVVGFVA 440

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
                   F+++ +   +  +  W  I++++I + +A+K +G S+D++ ++
Sbjct: 441 CSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYK 491

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  199 bits (506), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 137/497 (27%), Positives = 235/497 (47%), Gaps = 10/497 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           K   L R++  R +  + +GS VGTGL++G+ S L   GP  L I Y   G+ +  VI +
Sbjct: 113 KKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVYCVIQA 172

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             E+  ++A +  GF+ Y    V P+F F+ GW Y L++  +    L    L I YW   
Sbjct: 173 AGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIKYWTTK 232

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            NF   K + E +      KL ++   +I  +++ CGGA +   
Sbjct: 233 VDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGAGHDGY 292

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G +YW   GA  +        F G  +  V S F F GSE + +   E ANP+K+IP +
Sbjct: 293 LGGKYWHNPGA--FRGEKAIDHFKGVSSVFVTSAFAFGGSEFVALSASEQANPRKSIPSA 350

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           +  + +RI ++Y+  + ILG  + P +S  +   S     SP+V+AI+  G+KV+P+ +N
Sbjct: 351 AKLILYRIIWVYLTSITILGFLV-PWDSPQLQPSSDGKKTSPYVVAIAMHGVKVVPHLIN 409

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ ++S +N+  +  SR L  L++ G APK F  V+R   PV   +  +L G + + 
Sbjct: 410 AVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGVICFC 469

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAA 446
            T K    VFS++ +   +  I  +F I +++I    A+K +G S+ ++ FR     Y +
Sbjct: 470 ATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVGTYGS 529

Query: 447 YXXXXXXXXXXXXNGYNAFII----KFHYKTFITSYIGVFANILMVIGYKLYFKT--KFV 500
           +              + A       K   ++F  +Y+     I+   GY ++ K    F+
Sbjct: 530 FYACLLLVLSLMAEFWVALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDFRIFI 589

Query: 501 KPSEISFRTRNEHEGEE 517
           +  +I    + +   E+
Sbjct: 590 RSKDIDLDFKRQVFDED 606

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  198 bits (504), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 116/415 (27%), Positives = 214/415 (51%), Gaps = 9/415 (2%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
           +   L + +  R + +++LG+ +GTG+++G+G AL  GGP  L I Y   GS +  +I +
Sbjct: 75  RETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCIIQA 134

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             EMA S++ +   F+ Y +  +DPA GF+  W Y L++  VL   L    + I YW   
Sbjct: 135 AGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYWTTA 194

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            N    + + E E      K+L++   +I  +I+ CGGA N   
Sbjct: 195 VNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGY 254

Query: 207 TGFRYWRESGALPYLVGGGTG---KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTI 263
            G +YW + GAL      GT     F G  A +V + F F  +E I +   E ANP++ I
Sbjct: 255 LGGKYWHDPGALY-----GTKPIHHFKGIIATMVTAAFAFGATEFIALTAAEQANPRRAI 309

Query: 264 PKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPN 323
           P ++  + +R+  +++  + +LG  +   + +L+ +  +  +ASP+VIAI+S G+KV+P+
Sbjct: 310 PSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIAIASHGVKVVPH 369

Query: 324 FVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFL 383
           F+NA +L+ ++S  N+  Y  SR L  L++   AP     ++R   P+   +   + G +
Sbjct: 370 FINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCIFGLI 429

Query: 384 AYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
           A++       TVF+++ +   +  +  W  I +++I + +A+  +G S+ ++ ++
Sbjct: 430 AFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELGYK 484

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  198 bits (503), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 111/413 (26%), Positives = 211/413 (51%), Gaps = 7/413 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           +  L + +K R V +++LG+ +GTGL++ +   L  GGP +L I Y+    +   +I + 
Sbjct: 88  DSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYFMIQAA 147

Query: 89  SEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            EMA ++  +   F+ Y + ++  +FGFA  W Y  ++  VL   L    + I +W    
Sbjct: 148 GEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFWNDKI 207

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           +F  VK +GE E +    K+L++    I  ++I CGGA N    
Sbjct: 208 NPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYI 267

Query: 208 GFRYWRESGALPYLVGGGT--GKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPK 265
           G  YW   GA      G T  G+F      +V + F F G E+  +   E +NP+K+ P 
Sbjct: 268 GATYWHNPGAF----AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPV 323

Query: 266 SSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFV 325
           ++    +RI  +Y+  + ++G  +   + +L+ A  +  +ASP+V+A S  G+K++P+ +
Sbjct: 324 AAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKIVPHII 383

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ ++S AN+ +Y   R +  LA+ G APK    V+R   P+   +   + G +A+
Sbjct: 384 NAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAF 443

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
           +        VF+++ +   +  +  W  I+++++ + +A+K +G S+D++ ++
Sbjct: 444 VAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYK 496

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  197 bits (501), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 117/412 (28%), Positives = 213/412 (51%), Gaps = 9/412 (2%)

Query: 31  NLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSLSE 90
            L   +K R +++++LG+ +GTGL++ SG AL  GGP  L I Y+ T ++L  V+ +  E
Sbjct: 67  TLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGYVTTSTMLYCVVQACCE 126

Query: 91  MA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDXXX 149
           +  ++A +   ++ Y    VD  FGFA    Y L++A VL   L    + + YW      
Sbjct: 127 LGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLELVTASMTVKYWTSSVNP 186

Query: 150 XXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTTGF 209
                         +F   + + E E +    K+L++    I  + +T G A      G 
Sbjct: 187 DVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMAISLTAG-ASEQGYIGG 245

Query: 210 RYWRESGALPYLVGGGTG--KFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           +YW + GA     GG     +F G  +  VQ+ F + GSE I +   E ANP++++PK++
Sbjct: 246 QYWHDPGAF----GGDRAIDRFKGICSVWVQAAFAYGGSEFIALTAAEQANPRESVPKAT 301

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHS-TDANASPFVIAISSSGIKVLPNFVN 326
               +R+  +++  V ++G  +   + +L+ A   + + ASPFVIA +  G++V+P+ +N
Sbjct: 302 KRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRASPFVIAAALHGVRVVPHIIN 361

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
             +L  +IS  N+ +Y   R L  LA+ G  PKIF  V+R   P+V  +  SL G +A++
Sbjct: 362 FIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRPLVTLIFVSLFGLIAFV 421

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
                   VF+++++   +  +  W  I ++++ + RA++ +G S+ ++ +R
Sbjct: 422 AASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGRSLGELGYR 473

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  197 bits (502), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 139/496 (28%), Positives = 235/496 (47%), Gaps = 9/496 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
             NL + +KPR V +++LG+ +GTGL++G+GSAL K GP  L   Y   G+ +  +I S 
Sbjct: 107 EDNLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMGTCVYCIIQSA 166

Query: 89  SEMAS-FAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            EMA  ++ ++ GF+ Y    V+P F               LS  +        YW    
Sbjct: 167 GEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCLSFGIGYCFDDYKYWTTRV 226

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           N    + + E E      K+L++   +I  +II  GGA N    
Sbjct: 227 DPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYL 286

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G  YWR  GA  +    G   F G  A +V + F F G+E I +   E +NP+K IP ++
Sbjct: 287 GNIYWRNPGA--FRGDKGIDHFKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKAIPSAA 344

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
             V +RI  +Y+  + ++G  +   + +L+ + S    ASP+VIA++S G++V+P+F+NA
Sbjct: 345 KKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATAASPYVIAVASHGVRVVPHFINA 404

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ ++S  N+  Y  SR L  L+K G APK F  V+R   P    +  +L G +A+  
Sbjct: 405 VILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALFGVIAFCA 464

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFRMWFQPYAAY 447
           T      VF+++ +   +  I  W  I +++I +  A+KA+G S+ ++ F+     + +Y
Sbjct: 465 TSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQTGIWGSY 524

Query: 448 XXXXXXXXXXXXNGYNAF----IIKFHYKTFITSYIGVFANILMVIGYKLYFK--TKFVK 501
                         + A       +   + F  +Y+ +   I    GYK++ K  T ++K
Sbjct: 525 YSIFLMILTLIGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFGYKIWKKDWTLYIK 584

Query: 502 PSEISFRTRNEHEGEE 517
             +I   +  +   EE
Sbjct: 585 AEDIDLISHRQIFDEE 600

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  196 bits (498), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 111/411 (27%), Positives = 210/411 (51%), Gaps = 3/411 (0%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N  L + +K R V +++LG+ +GTGL++ +   L   GP SL I Y+    +   ++ + 
Sbjct: 83  NNRLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAA 142

Query: 89  SEMASFAPMDKG-FSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            EM    P   G F+ Y + ++  +FGFA  W + +++  VL   L    + I YW    
Sbjct: 143 GEMGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDKI 202

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           +F  VK +GE E + +  K+L++    I  ++I CGGA      
Sbjct: 203 NSDVFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYI 262

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G +YWR+ G+  +  G G  +F G    +V + F F G E+  +   E +NP+K+ P ++
Sbjct: 263 GGKYWRDPGS--FAEGNGATRFKGICFILVTAYFSFGGIELFVLSINEQSNPRKSTPVAA 320

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVNA 327
               +RI  +Y+  + ++G  +   N +L+ + S   +ASP+V+A S   ++V+P+ +NA
Sbjct: 321 KRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVVPHIINA 380

Query: 328 ALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMN 387
            +L+ +IS AN+ +Y   R +  LA+ G APK    ++R   P+       L+G + ++ 
Sbjct: 381 VILISVISVANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVA 440

Query: 388 TKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
                   F+++ +   +  +  W  I++++I + +A+K +G S+D++ ++
Sbjct: 441 CSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYK 491

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  195 bits (496), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 113/412 (27%), Positives = 206/412 (50%), Gaps = 3/412 (0%)

Query: 28  KNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFS 87
            + ++ + +K R V ++TLG+ +GTGL++ +G  LA  GP  L + Y     +   +I +
Sbjct: 74  DDDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQA 133

Query: 88  LSEMA-SFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPD 146
             EMA ++  M   F+ Y + +V   FGFA  W + +++  VL   L    + I YW   
Sbjct: 134 AGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDT 193

Query: 147 XXXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTT 206
                            +F  VK +GE E +    K+L++    I  ++I CGGA     
Sbjct: 194 INPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGY 253

Query: 207 TGFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKS 266
            G +YW   GA  +       +F G    +V   F + G+E+  +   E  NP+K+ P +
Sbjct: 254 IGNKYWINPGA--FASESPAARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKSTPAA 311

Query: 267 SMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAISSSGIKVLPNFVN 326
           +    +RI  +Y+  + ++G  +   + +L+ A  +  +ASP+V+A S  G+KV+P+F+N
Sbjct: 312 AKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHASPYVLAASLHGVKVVPHFIN 371

Query: 327 AALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYM 386
           A +L+ ++S AN+ +Y   R +  LA+ G APK F  V+R   P+       L G + ++
Sbjct: 372 AVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLFGVIGFV 431

Query: 387 NTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
                    F+++ +   +  +  W  I I++I +  A+K +G S++++ +R
Sbjct: 432 ACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYR 483

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  195 bits (496), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 121/413 (29%), Positives = 211/413 (51%), Gaps = 6/413 (1%)

Query: 29  NGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLFTGSLLCVVIFSL 88
           N    + +K R V +++LG+ +GTGL++ +G +L  GGP  L I Y     +  +++ + 
Sbjct: 79  NSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAYIMMQAA 138

Query: 89  SEMASFAPMDKG-FSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAFGLVIGYWRPDX 147
            EMA   P   G F+ Y + ++  +FGFA  W Y L++  VL   L    L I YW    
Sbjct: 139 GEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITASLTIKYWNSSI 198

Query: 148 XXXXXXXXXXXXXXXXNFLAVKYFGEIEALLTVFKLLVLVIVYITCLIITCGGAPNHTTT 207
                           +F     +GE E + +  K+ ++    I  ++I CGGA      
Sbjct: 199 NPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVINCGGAGTGGYI 258

Query: 208 GFRYWRESGALPYLVGGGTGKFLGWWACVVQSIFGFMGSEMIGIVYGETANPKKTIPKSS 267
           G  YWR  GA  +  G   G F G    +V + F + G E+  +   E ANP+K +P ++
Sbjct: 259 GGEYWRNPGA--FAGGSPIGHFKGIAYVLVTAYFSYGGMELFALTVNEQANPRKAVPSAT 316

Query: 268 MNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHS--TDANASPFVIAISSSGIKVLPNFV 325
               +RI  +Y+  + ++G  + P NS  +   S  +  +ASP+VIA++S G+KV+P+ +
Sbjct: 317 KKCIYRILIIYMLTMILIGFLV-PYNSDELMGSSGKSATHASPYVIAVASHGVKVVPHII 375

Query: 326 NAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVGCVTGSLLGFLAY 385
           NA +L+ ++S  N+ +Y   R L  LA+ G APKIF  V+R   P+V  V  S+ G L++
Sbjct: 376 NAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVALVGCSIFGLLSF 435

Query: 386 MNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISIDDIPFR 438
           +        VF+++ +   +  +  W  I ++++ +  A+K +G S+ ++ ++
Sbjct: 436 VAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSELGYK 488

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.142    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 47,100,097
Number of extensions: 1891040
Number of successful extensions: 7127
Number of sequences better than 10.0: 400
Number of HSP's gapped: 5829
Number of HSP's successfully gapped: 420
Length of query: 518
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 404
Effective length of database: 40,409,475
Effective search space: 16325427900
Effective search space used: 16325427900
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 68 (30.8 bits)