Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D15840g7.196ON40740720510.0
TDEL0H025107.196ON41841816460.0
Skud_9.1477.196ON43140716180.0
YIL022W (TIM44)7.196ON43140916140.0
Suva_9.1777.196ON43539916100.0
Smik_9.1687.196ON43139816070.0
Kpol_1063.97.196ON41740415970.0
SAKL0F07502g7.196ON41239515800.0
KLLA0D16214g7.196ON41840815710.0
NDAI0B017807.196ON43439915580.0
Kwal_55.203687.196ON41239615530.0
NCAS0A125207.196ON43240015490.0
KLTH0E04554g7.196ON47940715510.0
CAGL0J02442g7.196ON41240615420.0
TPHA0C045307.196ON41641615350.0
Ecym_43807.196ON41840515130.0
KNAG0H026907.196ON41938414890.0
ADL118C7.196ON41838414460.0
KAFR0A026407.196ON42139914090.0
TBLA0J015007.196ON42139012621e-172
TPHA0J006304.184ON37495741.1
YLR247C (IRC20)1.389ON1556111704.4
Ecym_20023.0ON34959694.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D15840g
         (407 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]...   794   0.0  
TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.1...   638   0.0  
Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W ...   627   0.0  
YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}  TIM44Essen...   626   0.0  
Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W ...   624   0.0  
Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W ...   623   0.0  
Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON} (26537.....   619   0.0  
SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {...   613   0.0  
KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]...   609   0.0  
NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {O...   604   0.0  
Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022...   602   0.0  
NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa] ...   601   0.0  
KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} simila...   602   0.0  
CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa] ...   598   0.0  
TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {O...   595   0.0  
Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar t...   587   0.0  
KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.1...   578   0.0  
ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON} S...   561   0.0  
KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.1...   547   0.0  
TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7....   490   e-172
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    33   1.1  
YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}...    32   4.4  
Ecym_2002 Chr2 complement(512..1561) [1050 bp, 349 aa] {ON} simi...    31   4.6  

>ZYRO0D15840g Chr4 complement(1321497..1322720) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 407

 Score =  794 bits (2051), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/407 (96%), Positives = 393/407 (96%)

Query: 1   MYKGIVTQRSVALFSTSSRSLQGRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGD 60
           MYKGIVTQRSVALFSTSSRSLQGRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGD
Sbjct: 1   MYKGIVTQRSVALFSTSSRSLQGRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGD 60

Query: 61  SEGVKRAREAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXLD 120
           SEGVKRAREAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEI              LD
Sbjct: 61  SEGVKRAREAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIAKSTRSAASATAKKLD 120

Query: 121 KSFEPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAG 180
           KSFEPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAG
Sbjct: 121 KSFEPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAG 180

Query: 181 TALVATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGF 240
           TALVATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGF
Sbjct: 181 TALVATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGF 240

Query: 241 FAETETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNV 300
           FAETETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNV
Sbjct: 241 FAETETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNV 300

Query: 301 YAAQQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGE 360
           YAAQQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGE
Sbjct: 301 YAAQQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGE 360

Query: 361 VAAGHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           VAAGHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT
Sbjct: 361 VAAGHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407

>TDEL0H02510 Chr8 (423430..424686) [1257 bp, 418 aa] {ON} Anc_7.196
           YIL022W
          Length = 418

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/418 (73%), Positives = 358/418 (85%), Gaps = 11/418 (2%)

Query: 1   MYKGIVTQRSV----------ALFSTSSRSLQG-RSPLQIFRDTFKKEWEKSQELQENIK 49
           M +G V  RS           ALFSTSS SLQ  RSP+QIFRDTFKKEW+KSQELQ+NIK
Sbjct: 1   MIRGTVVSRSSVIAEGRLAGRALFSTSSGSLQNPRSPVQIFRDTFKKEWKKSQELQDNIK 60

Query: 50  TLQDASGRLGDSEGVKRAREAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIXXXXX 109
           TLQDASGRLG+SE  KRAREAY+RAQKGSTIVGKTL+KTGETVE IASKAW+SEI     
Sbjct: 61  TLQDASGRLGESEAYKRAREAYVRAQKGSTIVGKTLKKTGETVENIASKAWDSEIARNTR 120

Query: 110 XXXXXXXXXLDKSFEPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKR 169
                    +D+ FEPVR TKIYKDVSEVM+D ++SRYGGF+TKEQR++KRE+++ SGKR
Sbjct: 121 EAASKTAKKIDEGFEPVRQTKIYKDVSEVMDDGNSSRYGGFITKEQRRLKREQDMLSGKR 180

Query: 170 ARAIRSNEEAGTALVATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVI 229
           A+A++ NE+AGTALVAT+IEAK+S GKKVEDF+EKT +GR + +LK  LW+E+ NPLIV 
Sbjct: 181 AKAVKGNEDAGTALVATDIEAKQSFGKKVEDFKEKTVLGRTLHRLKNSLWDESVNPLIVF 240

Query: 230 LRKITNKVGGFFAETETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTL 289
           LRKIT K+GGFFAETE A+V+GQFK++DP+FT+E FTR LR+YVIPE+LEAY KGDEK L
Sbjct: 241 LRKITRKIGGFFAETEAARVLGQFKMMDPTFTNESFTRHLREYVIPEILEAYVKGDEKVL 300

Query: 290 KKWFSEAPFNVYAAQQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQE 349
           KKWFSEAP+NVYAAQQK FR+Q+LFAD +ILDIRGV+IVSAK+LPPQDIPVL+VGCRAQE
Sbjct: 301 KKWFSEAPYNVYAAQQKAFREQQLFADGKILDIRGVEIVSAKMLPPQDIPVLVVGCRAQE 360

Query: 350 IQLYRSIKSGEVAAGHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           I LYR  K+GEVAAGHESNI+MSSYAMVFTRDPE ++DEETEGWRI+EFVRGGSRQFT
Sbjct: 361 IHLYRKAKTGEVAAGHESNIMMSSYAMVFTRDPEQIDDEETEGWRILEFVRGGSRQFT 418

>Skud_9.147 Chr9 (280791..282086) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  627 bits (1618), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/407 (72%), Positives = 356/407 (87%), Gaps = 5/407 (1%)

Query: 4   GIVTQRSVALFSTSSRSLQG---RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGD 60
           G++  R   LFSTS+   QG   RSPLQIFRDTFKKEWEKSQELQENIKTLQDASG+LG+
Sbjct: 27  GLLVAR--VLFSTSATRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGE 84

Query: 61  SEGVKRAREAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXLD 120
           SE  K+AREAYLRAQ+GSTIVGKTL+KTGET+E IA+KAWESE+              LD
Sbjct: 85  SEAYKKAREAYLRAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKRLD 144

Query: 121 KSFEPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAG 180
           +SFEPVR TKIYK+VSEV++D ++SRYGGF+TKEQR++KRE+++ASGKR RA++SN+EAG
Sbjct: 145 ESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAG 204

Query: 181 TALVATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGF 240
           TA+VATNIE+KES GKKVEDFREKT +GR+IQ LK RLW+E+ENPLIVI+RK+TNKVGGF
Sbjct: 205 TAVVATNIESKESFGKKVEDFREKTAMGRSIQSLKNRLWDESENPLIVIMRKVTNKVGGF 264

Query: 241 FAETETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNV 300
           FAETE+++V  QFKL+DP+F++E FTR LRDY++PE+LEAY K D K LKKWFSEAP+NV
Sbjct: 265 FAETESSRVHSQFKLMDPTFSNESFTRHLRDYIVPEILEAYVKADVKVLKKWFSEAPYNV 324

Query: 301 YAAQQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGE 360
           YAAQQK FR+Q ++AD RILDIRGV+IVSAKLL PQDIPVL+VGCRAQEI LYR  K+GE
Sbjct: 325 YAAQQKIFREQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRKTGE 384

Query: 361 VAAGHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           +AAG+E+NILMSSYAMVFTRDPE ++D+ETEGW+I+EFVRGGSRQFT
Sbjct: 385 IAAGNEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>YIL022W Chr9 (311165..312460) [1296 bp, 431 aa] {ON}
           TIM44Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); tethers the
           import motor and regulatory factors (PAM complex) to the
           translocation channel (Tim23p-Tim17p core complex)
          Length = 431

 Score =  626 bits (1614), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/409 (72%), Positives = 357/409 (87%), Gaps = 5/409 (1%)

Query: 2   YKGIVTQRSVALFSTSSRSLQG---RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRL 58
           Y G++  R   LFSTS+   QG   RSPLQIFRDTFKKEWEKSQELQENIKTLQDASG+L
Sbjct: 25  YTGLLVAR--VLFSTSTTRAQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKL 82

Query: 59  GDSEGVKRAREAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXX 118
           G+SE  K+AREAYL+AQ+GSTIVGKTL+KTGET+E IA+KAWESE+              
Sbjct: 83  GESEAYKKAREAYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAAAATAKK 142

Query: 119 LDKSFEPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEE 178
           LD+SFEPVR TKIYK+VSEV++D ++SRYGGF+TKEQR++KRER++ASGKR RA++SNE+
Sbjct: 143 LDESFEPVRQTKIYKEVSEVIDDGESSRYGGFITKEQRRLKRERDLASGKRHRAVKSNED 202

Query: 179 AGTALVATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVG 238
           AGTA+VATNIE+KES GKKVEDF+EKT +GR+IQ LK +LW+E+ENPLIV++RKITNKVG
Sbjct: 203 AGTAVVATNIESKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVG 262

Query: 239 GFFAETETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPF 298
           GFFAETE+++V  QFKL+DP+F++E FTR LR+Y++PE+LEAY KGD K LKKWFSEAPF
Sbjct: 263 GFFAETESSRVYSQFKLMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPF 322

Query: 299 NVYAAQQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKS 358
           NVYAAQQK F++Q ++AD RILDIRGV+IVSAKLL PQDIPVL+VGCRAQEI LYR  K+
Sbjct: 323 NVYAAQQKIFKEQDVYADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKKKT 382

Query: 359 GEVAAGHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           GE+AAG E+NILMSSYAMVFTRDPE ++D+ETEGW+I+EFVRGGSRQFT
Sbjct: 383 GEIAAGDEANILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>Suva_9.177 Chr9 (298403..299710) [1308 bp, 435 aa] {ON} YIL022W
           (REAL)
          Length = 435

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/399 (73%), Positives = 353/399 (88%), Gaps = 3/399 (0%)

Query: 12  ALFSTSSRSLQG---RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEGVKRAR 68
           ALFSTS+   QG   RSPLQIFRDTFKKEW+KSQELQENIKTLQDASG+LG+SE  K+AR
Sbjct: 37  ALFSTSATRAQGGNPRSPLQIFRDTFKKEWDKSQELQENIKTLQDASGKLGESEAYKKAR 96

Query: 69  EAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXLDKSFEPVRN 128
           EAYLRAQ+GSTIVGKTL+KTGETVE IA++AW+SE+              LD+SFEPVR 
Sbjct: 97  EAYLRAQRGSTIVGKTLKKTGETVEHIATRAWDSELGKNTRKAASATAKKLDESFEPVRQ 156

Query: 129 TKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTALVATNI 188
           TKIYK+VSEV++D ++SRYGGF+TKEQR++KRE+++ASGKR RA++SN+EAGTA+VATNI
Sbjct: 157 TKIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNI 216

Query: 189 EAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETAK 248
           E+KES GKKVEDF+EKT +GR+IQ LK RLW+E+ENPLIVI+RK+TNKVGGFFAETE+++
Sbjct: 217 ESKESFGKKVEDFKEKTAVGRSIQSLKNRLWDESENPLIVIMRKVTNKVGGFFAETESSR 276

Query: 249 VIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAAQQKFF 308
           V  QFK++DP+F++E FTR LR+Y++PE+LEAY KGD K LKKWFSEAPFNVYAAQQK F
Sbjct: 277 VYSQFKMMDPTFSNENFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIF 336

Query: 309 RDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVAAGHESN 368
           ++Q +FAD RILDIRGV+IVSAKLL PQDIPVL+VGCRAQEI LYR  K+GE+AAG E+N
Sbjct: 337 KEQDVFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKRKTGEIAAGDEAN 396

Query: 369 ILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           ILMSSYAMVFTRDPE ++D+ETEGW+I+EFVRGGSRQFT
Sbjct: 397 ILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 435

>Smik_9.168 Chr9 (285754..287049) [1296 bp, 431 aa] {ON} YIL022W
           (REAL)
          Length = 431

 Score =  623 bits (1607), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/398 (72%), Positives = 352/398 (88%), Gaps = 3/398 (0%)

Query: 13  LFSTSSRSLQG---RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEGVKRARE 69
           LFSTS+   QG   RSPLQIFRDTFKKEWEKSQELQENIKTLQDASG+LG+SE  K+ARE
Sbjct: 34  LFSTSATRTQGGNPRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGKLGESEAYKKARE 93

Query: 70  AYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXLDKSFEPVRNT 129
           AYL+AQ+GSTIVGKTL+KTGET+E IA+KAWESE+              LD+SFEPVR T
Sbjct: 94  AYLKAQRGSTIVGKTLKKTGETMEHIATKAWESELGKNTRKAASATAKKLDESFEPVRQT 153

Query: 130 KIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTALVATNIE 189
           KIYK+VSEV++D ++SRYGGF+TKEQR++KRE+++ASGKR RA++SN+EAGTA+VATNIE
Sbjct: 154 KIYKEVSEVIDDGESSRYGGFITKEQRRLKREKDLASGKRHRAVKSNDEAGTAVVATNIE 213

Query: 190 AKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETAKV 249
           +KES GKKVEDF+EKT +GR+IQ LK +LW+E+ENPLIV++RKITNKVGGFFAETE+++V
Sbjct: 214 SKESFGKKVEDFKEKTVVGRSIQSLKNKLWDESENPLIVVMRKITNKVGGFFAETESSRV 273

Query: 250 IGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAAQQKFFR 309
             QFK++DP+F++E FTR LR+Y++PE+LEAY KGD K LKKWFSEAPFNVYAAQQK F+
Sbjct: 274 YSQFKMMDPTFSNESFTRHLREYIVPEILEAYVKGDVKVLKKWFSEAPFNVYAAQQKIFK 333

Query: 310 DQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVAAGHESNI 369
           +Q ++AD RILDIRGV++VSAKLL PQDIPVL+VGCRAQEI LYR  K+GE+AAG E+NI
Sbjct: 334 EQDVYADGRILDIRGVEVVSAKLLAPQDIPVLVVGCRAQEINLYRKKKTGEIAAGDEANI 393

Query: 370 LMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           LMSSYAMVFTRDPE ++D+ETEGW+I+EFVRGGSRQFT
Sbjct: 394 LMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 431

>Kpol_1063.9 s1063 (26537..27790) [1254 bp, 417 aa] {ON}
           (26537..27790) [1254 nt, 418 aa]
          Length = 417

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/404 (71%), Positives = 351/404 (86%), Gaps = 1/404 (0%)

Query: 5   IVTQRSVALFSTSSRSLQG-RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEG 63
           ++   S+ LFSTSSR LQG R+P+QIFRDTFKKEWEKS++LQ+NIK LQDASGRLG+SE 
Sbjct: 14  LLCSGSIHLFSTSSRVLQGPRTPIQIFRDTFKKEWEKSKDLQDNIKALQDASGRLGESEA 73

Query: 64  VKRAREAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXLDKSF 123
            K+AREAYL+AQKGSTIVGKTLQKTGETVE IASKAW+SEI              +D+SF
Sbjct: 74  YKKAREAYLKAQKGSTIVGKTLQKTGETVEDIASKAWDSEIGKSTRKAASATARKIDESF 133

Query: 124 EPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTAL 183
           EPVR T++YKDVS+V++D D+SRYGGF+ KEQR++KRE ++ SGKR RA++SN+EAGT++
Sbjct: 134 EPVRKTQVYKDVSDVIDDGDSSRYGGFIGKEQRRLKRESDLVSGKRVRAVKSNDEAGTSI 193

Query: 184 VATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAE 243
           VATNIEAKESLGKK+EDF+E T  GR I  +KV+LW+ENENPLIV LRK++ K+GGFFAE
Sbjct: 194 VATNIEAKESLGKKMEDFKENTTAGRTIHGVKVKLWDENENPLIVFLRKVSGKIGGFFAE 253

Query: 244 TETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAA 303
           TE+++V+ QFKL+DP+F+++ FT+ LR+Y+IPEVLEAY KGDE  LKKWFSEAP+NVYAA
Sbjct: 254 TESSRVLSQFKLMDPTFSNDSFTKHLREYIIPEVLEAYVKGDEAVLKKWFSEAPYNVYAA 313

Query: 304 QQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVAA 363
           QQK FR Q+LF D RILDIRGV+IVSAKLL PQDIPVL+VGCRAQEI LYR +K+GE+AA
Sbjct: 314 QQKEFRKQQLFPDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKVKTGEIAA 373

Query: 364 GHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           G ESNILMSSYAMVFTRDPE ++D+ETEGW+I+EFVRGGSRQFT
Sbjct: 374 GDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 417

>SAKL0F07502g Chr6 complement(571758..572996) [1239 bp, 412 aa] {ON}
           highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 412

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 289/395 (73%), Positives = 347/395 (87%), Gaps = 1/395 (0%)

Query: 14  FSTSSRSLQG-RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEGVKRAREAYL 72
            S++ R  QG RSPLQIFR+TFK+EWEKS+ELQ+NIKTLQDASG+LG+S+  K+AREAYL
Sbjct: 18  ISSTVRLPQGQRSPLQIFRETFKQEWEKSKELQDNIKTLQDASGKLGESDAYKKAREAYL 77

Query: 73  RAQKGSTIVGKTLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXLDKSFEPVRNTKIY 132
           RAQKGSTIVGKTL+KTGETVE IA KAWESE+              +D+SFEPVR TK+Y
Sbjct: 78  RAQKGSTIVGKTLKKTGETVEDIAVKAWESELGKTTRKAMNATAQKIDESFEPVRQTKVY 137

Query: 133 KDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTALVATNIEAKE 192
           KDVSEV++D ++SRYGGF+TKEQR++K+E+++ASGKR +A++SN+EAGTALVATNIEAKE
Sbjct: 138 KDVSEVIDDGESSRYGGFITKEQRRLKKEQDLASGKRPKAVKSNDEAGTALVATNIEAKE 197

Query: 193 SLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETAKVIGQ 252
           S  KK+EDF+EKT  GR I ++KVRLW+E+ENPLIV+LR I NKVGG FAETE+A+V+GQ
Sbjct: 198 SFSKKIEDFKEKTPTGRKIHEMKVRLWDESENPLIVLLRTIGNKVGGIFAETESARVMGQ 257

Query: 253 FKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAAQQKFFRDQK 312
           FK+LDP+F +E FT+ LR+Y+IPE+LEAY KGDE  LK+WFSEAP+NVYAAQQK FRDQ+
Sbjct: 258 FKMLDPNFNTESFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYNVYAAQQKAFRDQE 317

Query: 313 LFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVAAGHESNILMS 372
           LFAD RILDIRGV+IVSAKLL PQDIPVL+VGCRAQEI LYR  K+GE+AAG ESNIL+S
Sbjct: 318 LFADGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEIHLYRKAKTGEIAAGTESNILLS 377

Query: 373 SYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           SYAMVFTRDPENV+D+ETEGWRI+EFVRGGSRQFT
Sbjct: 378 SYAMVFTRDPENVDDKETEGWRILEFVRGGSRQFT 412

>KLLA0D16214g Chr4 complement(1364989..1366245) [1257 bp, 418 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022W TIM44 48.8 kDa protein involved in
           mitochondrial protein import
          Length = 418

 Score =  609 bits (1571), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/408 (68%), Positives = 351/408 (86%), Gaps = 1/408 (0%)

Query: 1   MYKGIVTQRSVALFSTSSRSLQG-RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLG 59
           M+K +    +V  F+ S++++   RSPLQIFR+TFK+EWEKS+ELQ+NIK LQDASG+LG
Sbjct: 11  MHKAVARASTVRTFTVSAKAMSNPRSPLQIFRETFKQEWEKSKELQDNIKALQDASGKLG 70

Query: 60  DSEGVKRAREAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXL 119
           +SE  K+AREAY++AQKGSTIVGKTL+KTGETVE IASKAW+SEI              L
Sbjct: 71  ESEAYKKAREAYVKAQKGSTIVGKTLKKTGETVETIASKAWDSEIAKSTRKVVNKTADKL 130

Query: 120 DKSFEPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEA 179
           D+SFEPVR TK+YKDVSEV++D D+SRYGGF+TKEQR++ +E  IASGKR+RA++SN+ A
Sbjct: 131 DESFEPVRKTKVYKDVSEVIDDGDSSRYGGFITKEQRRLMKEEAIASGKRSRAVKSNDAA 190

Query: 180 GTALVATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGG 239
           GTALVATNIE+KES GKK+EDF+EKT +GR + + K++LW+E+ENPL+V+LR ++ K+GG
Sbjct: 191 GTALVATNIESKESFGKKIEDFKEKTPVGRKLHEYKIKLWDESENPLVVMLRTVSGKIGG 250

Query: 240 FFAETETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFN 299
            FAETE+A+V GQFK++DP+F +E FT+ LR+Y+IPE+LEAY KGDE  LK+WFSEAP+N
Sbjct: 251 LFAETESARVYGQFKMMDPTFNTEDFTKHLREYIIPEILEAYVKGDEAVLKQWFSEAPYN 310

Query: 300 VYAAQQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSG 359
           VYAAQQK FR+Q+LFAD +ILDIRGV+IVSAKLLPPQDIPVL+VGCRAQEI LYR  K+G
Sbjct: 311 VYAAQQKQFREQELFADGKILDIRGVEIVSAKLLPPQDIPVLVVGCRAQEIHLYRKAKTG 370

Query: 360 EVAAGHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           E+AAG ES+ILMSSYAMVFTRDPE V+D+ETEGW+I+EFVRGGSRQFT
Sbjct: 371 EIAAGAESSILMSSYAMVFTRDPETVDDKETEGWKILEFVRGGSRQFT 418

>NDAI0B01780 Chr2 complement(423642..424946) [1305 bp, 434 aa] {ON}
           Anc_7.196 YIL022W
          Length = 434

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/399 (71%), Positives = 342/399 (85%), Gaps = 5/399 (1%)

Query: 13  LFSTSSRSLQ-----GRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEGVKRA 67
           LFST+  +L      GR+P+QIFRDTFKKEWEKSQELQ+NIK L DASG+L +SE  K A
Sbjct: 35  LFSTTRTTLNNNGGGGRTPIQIFRDTFKKEWEKSQELQDNIKALHDASGKLSESETFKMA 94

Query: 68  REAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXLDKSFEPVR 127
           ++AYL+A KGSTIV KTL+KTGETVE +ASKAW+SEI              +DKSFEPVR
Sbjct: 95  KDAYLKAHKGSTIVSKTLKKTGETVETMASKAWDSEIGKNTRIAAKKTAETIDKSFEPVR 154

Query: 128 NTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTALVATN 187
            T+IYKDVSEV++D D+SRYGGF+TKE+RK+KRER++ASGKR RA++SN+EAGTALVATN
Sbjct: 155 KTQIYKDVSEVIDDGDSSRYGGFITKEERKLKRERDLASGKRQRAVKSNDEAGTALVATN 214

Query: 188 IEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETA 247
           IEAKES GKKVEDF+EKT +G+ ++ +K++LW+E+ENPLIV LRKI+NK+ GFF ETE+A
Sbjct: 215 IEAKESFGKKVEDFKEKTVVGKTMKTVKMKLWDESENPLIVTLRKISNKISGFFDETESA 274

Query: 248 KVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAAQQKF 307
           KV  QFKL+D +FT++GFTR LRDY++PE+LEAY KGDEK LKKWFSEAPFNVYAAQQK 
Sbjct: 275 KVYTQFKLMDTTFTNDGFTRHLRDYIVPEILEAYIKGDEKVLKKWFSEAPFNVYAAQQKV 334

Query: 308 FRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVAAGHES 367
           FR+Q LF+D RILDIRGV+IVSAKLL PQDIPVL+VGCRAQEI LY+  KSGE+AAG ES
Sbjct: 335 FREQGLFSDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYKKAKSGEIAAGDES 394

Query: 368 NILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQF 406
           NI+MSSYAMVFTRDPE ++D+ETEGW+I+EFVRGGSR F
Sbjct: 395 NIVMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRPF 433

>Kwal_55.20368 s55 (376673..377911) [1239 bp, 412 aa] {ON} YIL022W
           (TIM44) - 48.8 kDa protein involved in mitochondrial
           protein import [contig 149] FULL
          Length = 412

 Score =  602 bits (1553), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/396 (71%), Positives = 344/396 (86%), Gaps = 2/396 (0%)

Query: 14  FSTSSRSLQG--RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEGVKRAREAY 71
            S + R+ QG  RSPLQIFR+TFK+EW+KSQELQ+NIK LQDASG+LG+S+  K+AREAY
Sbjct: 17  LSQTIRACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKLGESDAYKKAREAY 76

Query: 72  LRAQKGSTIVGKTLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXLDKSFEPVRNTKI 131
           L+AQKGSTIVGKT++KTG++VE IA+KAWESEI              LD+SFEPVR+T++
Sbjct: 77  LKAQKGSTIVGKTMKKTGDSVERIAAKAWESEISKSTRKAVNKTAAKLDESFEPVRHTRV 136

Query: 132 YKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTALVATNIEAK 191
           YKDVSEVME  ++SRYGGF+TKEQR++K E++IASGKR +A+RSN+EAGTALVATNIEAK
Sbjct: 137 YKDVSEVMESGNSSRYGGFITKEQRRLKLEQDIASGKRPKAVRSNDEAGTALVATNIEAK 196

Query: 192 ESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETAKVIG 251
           ES GKKV+DF+EKT +GR +   KV+LW+E+ENPLIV+LR I NK+GG FAETE+A+V+G
Sbjct: 197 ESFGKKVDDFKEKTVVGRKLHDFKVKLWDESENPLIVLLRTIGNKIGGLFAETESARVMG 256

Query: 252 QFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAAQQKFFRDQ 311
           QFK++D +F SE F   LR+Y+IPEVLEAY KGDEK LK+WFSEAP+NVYAAQQK FR+Q
Sbjct: 257 QFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGDEKVLKQWFSEAPYNVYAAQQKVFREQ 316

Query: 312 KLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVAAGHESNILM 371
            LFAD RILDIRGVDIVSAKLL PQD+PVL+VGCRAQEI LYR +K+GEVAAG +SNILM
Sbjct: 317 GLFADGRILDIRGVDIVSAKLLAPQDLPVLVVGCRAQEIHLYRDVKTGEVAAGTQSNILM 376

Query: 372 SSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           SSYAMVFTRDPE+++++ETEGW+I+EFVRGGSRQFT
Sbjct: 377 SSYAMVFTRDPEDIDNKETEGWKILEFVRGGSRQFT 412

>NCAS0A12520 Chr1 complement(2470598..2471896) [1299 bp, 432 aa]
           {ON} Anc_7.196 YIL022W
          Length = 432

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/400 (70%), Positives = 343/400 (85%), Gaps = 4/400 (1%)

Query: 12  ALFSTS---SRSLQGRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEGVKRAR 68
            LFST+   S    GR+P+QIFRDTFKKEW+KSQELQENIK L DASG+L +SE  K A+
Sbjct: 33  GLFSTTTARSNGGGGRTPIQIFRDTFKKEWDKSQELQENIKALHDASGKLSESETFKMAK 92

Query: 69  EAYLRAQKGS-TIVGKTLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXLDKSFEPVR 127
           +AYL+A KGS TI+ KT+QKTGETVE +ASKAW+SEI              LDKSFEPVR
Sbjct: 93  DAYLKAHKGSSTILSKTMQKTGETVENMASKAWDSEIAKSTREAAKKTADTLDKSFEPVR 152

Query: 128 NTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTALVATN 187
            T++YKD+SEV++D D+SRYGGF+TKE+R++KRE ++ASGKR RAI+SNEEAGTALVAT+
Sbjct: 153 KTQVYKDISEVIDDGDSSRYGGFITKEERRLKRESDLASGKRQRAIKSNEEAGTALVATD 212

Query: 188 IEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETA 247
           IEAK+S GKKVEDF+EKT +G+ +  +KV+LW+E+ENPLIV LRKITNK+GGFF ETE+A
Sbjct: 213 IEAKQSFGKKVEDFKEKTVVGKTMSSVKVKLWDESENPLIVFLRKITNKIGGFFDETESA 272

Query: 248 KVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAAQQKF 307
           +V  QFK++D +FT+EGFTR LR+Y++PE+LEAY KGDEK LKKWFSEAPFNVY+AQQK 
Sbjct: 273 RVYTQFKMMDATFTNEGFTRHLREYIVPELLEAYIKGDEKVLKKWFSEAPFNVYSAQQKV 332

Query: 308 FRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVAAGHES 367
           FR+Q LF+D RILDIRGV+IVSAKLL PQDIPVL+VGCRAQEI LYR +K+GE+AAG +S
Sbjct: 333 FREQGLFSDGRILDIRGVEIVSAKLLAPQDIPVLVVGCRAQEINLYRKVKTGEIAAGDQS 392

Query: 368 NILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           NILMSSYAMVFTRDPE ++D+ETEGW+I+EFVRGGSRQFT
Sbjct: 393 NILMSSYAMVFTRDPEQIDDDETEGWKILEFVRGGSRQFT 432

>KLTH0E04554g Chr5 (412896..414335) [1440 bp, 479 aa] {ON} similar
           to uniprot|Q01852 Saccharomyces cerevisiae YIL022W TIM44
           48.8 kDa protein involved in mitochondrial protein
           import
          Length = 479

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/407 (69%), Positives = 352/407 (86%), Gaps = 5/407 (1%)

Query: 3   KGIVTQRSVALFSTSSRSLQG--RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGD 60
           K +V +R++A    + ++ QG  RSPLQIFR+TFK+EW+KSQELQ+NIK LQDASG++G+
Sbjct: 76  KSVVIRRNLA---QTFKACQGNPRSPLQIFRETFKQEWKKSQELQDNIKALQDASGKIGE 132

Query: 61  SEGVKRAREAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXLD 120
           SE  K+AREAYL AQKGSTIVGKTL+KTG++VE IA+KAWESEI              LD
Sbjct: 133 SEAYKKAREAYLSAQKGSTIVGKTLKKTGDSVEKIAAKAWESEIGKSTRQAVNKTAAKLD 192

Query: 121 KSFEPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAG 180
           +SFEPVR+T++YKDVSEVM+ +++SRYGGF++KEQR++K E++IASGKR +A++SNEEAG
Sbjct: 193 ESFEPVRHTRVYKDVSEVMDSSNSSRYGGFISKEQRRLKLEQDIASGKRPKAVKSNEEAG 252

Query: 181 TALVATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGF 240
           TALVAT IEAKES GKKV+DF+EKT +GR +Q +K +LW+E+ENPLIV++R I NKVGG 
Sbjct: 253 TALVATEIEAKESFGKKVDDFKEKTVVGRKLQDVKQKLWDESENPLIVLMRTIGNKVGGL 312

Query: 241 FAETETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNV 300
           FAETE+A+V+GQFK++D +F SE F   LR+Y+IPEVLEAY KG+E+ LK+WFSEAP+NV
Sbjct: 313 FAETESARVMGQFKMMDGNFNSESFLSHLREYIIPEVLEAYVKGEEQVLKQWFSEAPYNV 372

Query: 301 YAAQQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGE 360
           YAAQQK FR+Q LFAD RILDIRGVDIVSAKLLPPQD+PVL+VGCRAQEI LYR +K+GE
Sbjct: 373 YAAQQKVFREQGLFADGRILDIRGVDIVSAKLLPPQDLPVLVVGCRAQEIHLYRDVKTGE 432

Query: 361 VAAGHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           VAAG +SNILMSSYAMVFTRDPEN++D+ETEGW+I+EFVRGGSRQFT
Sbjct: 433 VAAGTQSNILMSSYAMVFTRDPENIDDKETEGWKILEFVRGGSRQFT 479

>CAGL0J02442g Chr10 complement(236641..237879) [1239 bp, 412 aa]
           {ON} highly similar to uniprot|Q01852 Saccharomyces
           cerevisiae YIL022w TIM44
          Length = 412

 Score =  598 bits (1542), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/406 (70%), Positives = 345/406 (84%), Gaps = 4/406 (0%)

Query: 4   GIVTQRSVALFSTSSRSLQG-RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSE 62
           G++  R    F T S  L   RSPLQIFR+TFKKEWEKSQELQ+NIKTLQDASGRLG+SE
Sbjct: 9   GVLVARRC--FGTRSVLLSNPRSPLQIFRETFKKEWEKSQELQDNIKTLQDASGRLGESE 66

Query: 63  GVKRAREAYLRAQKGS-TIVGKTLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXLDK 121
             K+AREAYL+A KGS TIVGKTLQKTGETVE +A+KAW+S+I              LD+
Sbjct: 67  AYKKAREAYLKASKGSQTIVGKTLQKTGETVEELATKAWDSDIAKTTRVVASKTAKKLDE 126

Query: 122 SFEPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGT 181
           SFEPVR TKIYKDVSEV++D D+S YGGF+TKEQR++KRE+++ASGKR RA++SN+EAG+
Sbjct: 127 SFEPVRQTKIYKDVSEVIDDGDSSSYGGFITKEQRRLKREKDLASGKRVRAVKSNDEAGS 186

Query: 182 ALVATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFF 241
           ALVAT+IEAKESLGKK+EDF+EKT +GR ++ +KV LW+E+ENPLIV LRKIT K+GGFF
Sbjct: 187 ALVATDIEAKESLGKKIEDFKEKTPVGRTLKSVKVSLWDESENPLIVFLRKITGKIGGFF 246

Query: 242 AETETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVY 301
           AETE+A+V  QFK++DP+FT+ GFT+ LRDY++PEVLEAY KGDEK LKKWFSEAPFNVY
Sbjct: 247 AETESARVYKQFKMVDPTFTNIGFTKHLRDYIVPEVLEAYVKGDEKVLKKWFSEAPFNVY 306

Query: 302 AAQQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEV 361
            AQQK F+ Q+LF+D +ILDIRGV++VSAKLL PQDIPVL+VGCRAQEI LYR  K+GE+
Sbjct: 307 NAQQKIFKKQELFSDGKILDIRGVEVVSAKLLQPQDIPVLVVGCRAQEIHLYRKAKTGEI 366

Query: 362 AAGHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           AAG ESNILMSSYAMVFTRDPE ++D+ETEGW+I+EF+RG SR F 
Sbjct: 367 AAGDESNILMSSYAMVFTRDPEQIDDDETEGWKILEFIRGSSRPFN 412

>TPHA0C04530 Chr3 complement(975677..976927) [1251 bp, 416 aa] {ON}
           Anc_7.196 YIL022W
          Length = 416

 Score =  595 bits (1535), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/416 (66%), Positives = 349/416 (83%), Gaps = 9/416 (2%)

Query: 1   MYKGIVTQRS-------VALFSTSS--RSLQGRSPLQIFRDTFKKEWEKSQELQENIKTL 51
           M + I+T+R+       VA FSTS+  R+  G++P+QIFR+TFKKEWEKSQELQ+NIKTL
Sbjct: 1   MSRSILTKRTNLLLGHNVAYFSTSTVLRNGGGKTPIQIFRETFKKEWEKSQELQDNIKTL 60

Query: 52  QDASGRLGDSEGVKRAREAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIXXXXXXX 111
           QDASGRLG SE  K+A+EAY++AQ+ STIV KTL+KTGETVE +A K W+SEI       
Sbjct: 61  QDASGRLGQSEAYKKAKEAYVKAQQSSTIVSKTLKKTGETVEDLAKKTWDSEIGKSTRKV 120

Query: 112 XXXXXXXLDKSFEPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRAR 171
                  +D+SFEPVR T++YK+VSEV++D ++SRYGGF++KEQR+ KRE ++ASGKR R
Sbjct: 121 VSQGAKKIDESFEPVRQTQVYKEVSEVIDDGESSRYGGFISKEQRRKKREADLASGKRVR 180

Query: 172 AIRSNEEAGTALVATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILR 231
           A +SNEEAGTA+VATN+E+KES GKK++DF+EKT +G+ ++  KVR+W+ENENPLIV+LR
Sbjct: 181 ATKSNEEAGTAIVATNVESKESFGKKIDDFKEKTVVGKTMKSFKVRVWDENENPLIVVLR 240

Query: 232 KITNKVGGFFAETETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKK 291
            I+NK+ GFFAETE+++V  QFKL+DP+F++  FT+ LRDY+IPEVLEAY KGDE  LKK
Sbjct: 241 TISNKISGFFAETESSRVYSQFKLMDPTFSNAAFTKHLRDYIIPEVLEAYVKGDEVVLKK 300

Query: 292 WFSEAPFNVYAAQQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQ 351
           WFSEAPFNVYAAQQK  R Q+LF D RILDIRGVDIVSAKLL PQDIPVL+VGCRAQE+ 
Sbjct: 301 WFSEAPFNVYAAQQKELRKQQLFTDGRILDIRGVDIVSAKLLAPQDIPVLVVGCRAQELH 360

Query: 352 LYRSIKSGEVAAGHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           LYR +K+GE+ AG ESNI+MSSYAMVFTRDP+N++D+ETEGW+I+EFVRGGSRQFT
Sbjct: 361 LYRKVKTGELGAGDESNIMMSSYAMVFTRDPDNIDDDETEGWKILEFVRGGSRQFT 416

>Ecym_4380 Chr4 (801356..802612) [1257 bp, 418 aa] {ON} similar to
           Ashbya gossypii ADL118C
          Length = 418

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/405 (66%), Positives = 336/405 (82%), Gaps = 1/405 (0%)

Query: 4   GIVTQRSVALFSTSSRSLQG-RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSE 62
           GI        FST+  S  G +SPLQIFR+TFK EW+KSQELQ+NIK LQDASGRLG+S+
Sbjct: 14  GIAKAVPARQFSTTGLSWNGQKSPLQIFRETFKDEWKKSQELQDNIKALQDASGRLGESD 73

Query: 63  GVKRAREAYLRAQKGSTIVGKTLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXLDKS 122
             K+AREAYL+AQ+GST+VGKTL+KTGET+E +  KAW+S+I              LD+S
Sbjct: 74  AYKKAREAYLKAQRGSTVVGKTLKKTGETIENLTVKAWDSDIGKNTREVVSKTAQKLDES 133

Query: 123 FEPVRNTKIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTA 182
           FEPVR+T++YKD+SE+++D ++SRYGGF+ KE R+ KRE ++ASG+R  A+RSN+EAGTA
Sbjct: 134 FEPVRHTRVYKDMSELIDDGESSRYGGFIAKETRRQKREHDLASGRRTHAVRSNDEAGTA 193

Query: 183 LVATNIEAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFA 242
           +VATN E KES GKK++DF+EKTFIGR + + KV+LW+ENENPLI +LR I+NK+GG FA
Sbjct: 194 MVATNKEGKESFGKKIQDFKEKTFIGRKLHESKVKLWDENENPLISMLRTISNKIGGLFA 253

Query: 243 ETETAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYA 302
           ETE+A+V  QFKLLDP+F SE FT+ LR+Y+IPEVLEAY KGDE  LK+W SEAP+NVYA
Sbjct: 254 ETESARVFAQFKLLDPTFNSEEFTKHLREYIIPEVLEAYVKGDEVVLKQWLSEAPYNVYA 313

Query: 303 AQQKFFRDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVA 362
           AQQK FR+Q+LF D R+LDIRGV+IVSAKLLPPQD+P L+VGCR QEI LYR  K+GE+A
Sbjct: 314 AQQKQFREQELFPDGRVLDIRGVEIVSAKLLPPQDVPALVVGCRVQEIHLYRKAKTGEIA 373

Query: 363 AGHESNILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           AGHESNI+MSSYAMV TRDPENV D+ETEGW+++EF+RGGSRQFT
Sbjct: 374 AGHESNIMMSSYAMVLTRDPENVTDKETEGWKVLEFIRGGSRQFT 418

>KNAG0H02690 Chr8 (497172..498431) [1260 bp, 419 aa] {ON} Anc_7.196
           YIL022W
          Length = 419

 Score =  578 bits (1489), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/384 (70%), Positives = 333/384 (86%)

Query: 24  RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEGVKRAREAYLRAQKGSTIVGK 83
           RSPL IFRDTFKKEWEKSQELQENI+TLQDASG++G++E  ++AREA+LRAQKGSTIVGK
Sbjct: 36  RSPLSIFRDTFKKEWEKSQELQENIRTLQDASGKIGETEAYRKAREAFLRAQKGSTIVGK 95

Query: 84  TLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXLDKSFEPVRNTKIYKDVSEVMEDAD 143
           TL+KTGETVEGIASKAW+SEI              LD+ FEPVR T++YKDVSEV++D D
Sbjct: 96  TLKKTGETVEGIASKAWDSEIAKASRKAAVKTAQKLDEGFEPVRQTQLYKDVSEVIDDGD 155

Query: 144 TSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTALVATNIEAKESLGKKVEDFRE 203
           ++ YGGF T+E+R+ +RE+ +ASG+R RA++SN+EAGTALVAT +E+KESLGKK+EDF+E
Sbjct: 156 STSYGGFFTREERQRRREKALASGERVRAVKSNDEAGTALVATGVESKESLGKKMEDFKE 215

Query: 204 KTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETAKVIGQFKLLDPSFTSE 263
           KT +GR++  LK RLW+E+ENPLIV +RK++ KVG FFAETE+ +V  QFKL+DP+F S 
Sbjct: 216 KTAVGRSLHGLKHRLWDESENPLIVFMRKVSGKVGKFFAETESGRVYTQFKLMDPNFNSV 275

Query: 264 GFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAAQQKFFRDQKLFADSRILDIR 323
            FT+ LR+YV+PE+LEAY +GDEK LKKWFSEAP+NVYAAQQK F+++ LFAD RILDIR
Sbjct: 276 TFTKHLREYVVPEILEAYVRGDEKVLKKWFSEAPYNVYAAQQKMFKEKALFADGRILDIR 335

Query: 324 GVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVAAGHESNILMSSYAMVFTRDPE 383
           GV+IVSAKLL PQD+PVL+VGCRAQEI LY+ +K+GE+AAG ESNILMSSYAMVFTRDPE
Sbjct: 336 GVEIVSAKLLQPQDLPVLVVGCRAQEINLYKKVKTGEIAAGSESNILMSSYAMVFTRDPE 395

Query: 384 NVEDEETEGWRIIEFVRGGSRQFT 407
            V DEETEGW+I+EFVRGGSRQFT
Sbjct: 396 QVTDEETEGWKILEFVRGGSRQFT 419

>ADL118C Chr4 complement(478675..479931) [1257 bp, 418 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL022W
           (TIM44)
          Length = 418

 Score =  561 bits (1446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 263/384 (68%), Positives = 330/384 (85%)

Query: 24  RSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEGVKRAREAYLRAQKGSTIVGK 83
           +SPLQ+FR+TFK+EW+KSQELQ+NIK LQDA GRLG+S+  K+AREAYL+AQKGSTIVGK
Sbjct: 35  KSPLQVFRETFKEEWKKSQELQDNIKALQDAGGRLGESDAYKKAREAYLKAQKGSTIVGK 94

Query: 84  TLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXLDKSFEPVRNTKIYKDVSEVMEDAD 143
           TL++TGET+E I  +AWESEI              LD+SFEPVR TK+YKD+SE+++D +
Sbjct: 95  TLKRTGETLEHITVQAWESEIGKTTRKTVSKTAQKLDESFEPVRQTKVYKDMSEIIDDGE 154

Query: 144 TSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTALVATNIEAKESLGKKVEDFRE 203
           +SRYGGF+ KE+R+ KRER++A+GKRA  +RSNEEAG+ALVAT+ EA ESLGKK++DF+E
Sbjct: 155 SSRYGGFMEKERRREKRERDLATGKRATPVRSNEEAGSALVATDKEASESLGKKIQDFKE 214

Query: 204 KTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETAKVIGQFKLLDPSFTSE 263
           KT +GR + ++KVRLW+ENENPLI +LR I+NKVGG FAETE+A+V  QFKLLDP+F +E
Sbjct: 215 KTVVGRKLHEIKVRLWDENENPLIGLLRTISNKVGGLFAETESARVFAQFKLLDPTFNTE 274

Query: 264 GFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAAQQKFFRDQKLFADSRILDIR 323
            FT+ LR+Y+IPEVLEAY KGDE+ LK+WFSEAP+NVY+AQQK  R Q+LFAD RILDIR
Sbjct: 275 EFTKHLREYIIPEVLEAYVKGDEQVLKQWFSEAPYNVYSAQQKQIRQQELFADGRILDIR 334

Query: 324 GVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVAAGHESNILMSSYAMVFTRDPE 383
           GV+I+SAKLLPPQD+P ++VGCRAQEI L+R   +GE+AAGHESNI++SSYAMV TRDPE
Sbjct: 335 GVEIISAKLLPPQDVPAIVVGCRAQEIHLFRKATTGEIAAGHESNIMLSSYAMVLTRDPE 394

Query: 384 NVEDEETEGWRIIEFVRGGSRQFT 407
            V+D+ETEGW+I+EFVRGGSR FT
Sbjct: 395 KVDDKETEGWKILEFVRGGSRSFT 418

>KAFR0A02640 Chr1 (547285..548550) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  547 bits (1409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 256/399 (64%), Positives = 326/399 (81%), Gaps = 2/399 (0%)

Query: 11  VALFSTSSRSLQGRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEGVKRAREA 70
           V+L ++ +   Q R+PLQIFR+TFKKEWEKS ELQ +IK LQDASG++ +SE  K+AR+A
Sbjct: 23  VSLHTSRNLGQQQRTPLQIFRETFKKEWEKSAELQGSIKELQDASGKISESEAYKKARDA 82

Query: 71  YLRAQKGS-TIVGKTLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXLDKSFEPVRNT 129
           YL+A +GS TI+ KTL+KTG+T+E IA+KAWESEI              LD+SFEPVRNT
Sbjct: 83  YLKAHRGSSTILDKTLKKTGDTLEDIATKAWESEISKNTRQMASETAKKLDESFEPVRNT 142

Query: 130 KIYKDVSEVM-EDADTSRYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTALVATNI 188
           KIYKDVSEV+ +D D+ RYGGF+ K++R++KRE  + SGKR RA++SN+EAGTALVATN+
Sbjct: 143 KIYKDVSEVLNDDGDSYRYGGFIQKDERRLKRENALKSGKRVRAVKSNDEAGTALVATNV 202

Query: 189 EAKESLGKKVEDFREKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETAK 248
           ++ ES+G+K E+F+E+T +G+ +   KV  W+E+ENPLIV+LRKIT K+ GFF ETE+++
Sbjct: 203 QSHESIGQKYENFKERTMVGKILHNFKVNYWDESENPLIVLLRKITLKITGFFGETESSR 262

Query: 249 VIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAAQQKFF 308
           V  QFKL+D +F +E FTR LR+Y++PE+LEAY KGDEK LK WFSEAPFNVY+AQQK F
Sbjct: 263 VYSQFKLIDQTFNAESFTRHLREYIVPEILEAYIKGDEKVLKNWFSEAPFNVYSAQQKVF 322

Query: 309 RDQKLFADSRILDIRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSIKSGEVAAGHESN 368
           R Q LF D  ILDIR V+IVSAKLL PQDIPVL+V CRAQEI +YR IK+GEVAAG+ S+
Sbjct: 323 RQQNLFPDGNILDIRNVEIVSAKLLQPQDIPVLVVSCRAQEINIYRKIKTGEVAAGNASD 382

Query: 369 ILMSSYAMVFTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           ILMS+YAMVFTRDPE ++++ETEGWRI+EFVRG SRQFT
Sbjct: 383 ILMSTYAMVFTRDPEEIDNDETEGWRILEFVRGNSRQFT 421

>TBLA0J01500 Chr10 (342554..343819) [1266 bp, 421 aa] {ON} Anc_7.196
           YIL022W
          Length = 421

 Score =  490 bits (1262), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 223/390 (57%), Positives = 306/390 (78%), Gaps = 9/390 (2%)

Query: 23  GRSPLQIFRDTFKKEWEKSQELQENIKTLQDASGRLGDSEGVKRAREAYLRAQKGSTIVG 82
            ++P+QIFR+TFK+EWEKS  LQ+ IKTL DAS R+  S+  K+A++AY      +TI+ 
Sbjct: 36  NKTPIQIFRETFKQEWEKSATLQDQIKTLTDASDRINQSDAFKKAKDAYKNVSNQTTILS 95

Query: 83  KTLQKTGETVEGIASKAWESEIXXXXXXXXXXXXXXLDKSFEPVRNTKIYKDVSEVMEDA 142
           KT+ KTG  +   A KAW+S++              LD SFEPVRNTKIYKDVSEV++D 
Sbjct: 96  KTISKTGTKLNDAALKAWDSDLAQKTKLAAKK----LDDSFEPVRNTKIYKDVSEVIDDK 151

Query: 143 DTS-RYGGFLTKEQRKIKREREIASGKRARAIRSNEEAGTALVATNIEAKESLGKKVEDF 201
           D S +YGGF++KE+R+ KR  ++ +GKR + I+SN+EAGTAL+AT++++KES+ +K+ DF
Sbjct: 152 DNSYKYGGFISKEERRSKRISDLQTGKRMKPIKSNDEAGTALIATDLKSKESINEKLNDF 211

Query: 202 REKTFIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETAKVIGQFKLLDPSFT 261
           +EKT +G+ +  +K ++W+EN+NPLIV +RK+T     FFAETE+++V+ QFKL+DP+F 
Sbjct: 212 KEKTVVGQTMTSIKTKVWDENDNPLIVGMRKVTGVFNRFFAETESSRVLTQFKLIDPNFN 271

Query: 262 SEGFTRQLRDYVIPEVLEAYAKGDEKTLKKWFSEAPFNVYAAQQKFFRDQKLFADSRILD 321
           +E F R LR+Y+IPEVLEAY KGDEK LK WFSEAP+NVY+AQQK  R QK+F+D R+LD
Sbjct: 272 NESFLRSLREYIIPEVLEAYIKGDEKILKNWFSEAPYNVYSAQQKELRKQKIFSDGRVLD 331

Query: 322 IRGVDIVSAKLLPPQDIPVLIVGCRAQEIQLYRSI----KSGEVAAGHESNILMSSYAMV 377
           IRGVDIV+AK+LPPQDIPV++V CRAQEI +Y+      ++ ++ AGH+SNILMS+YAMV
Sbjct: 332 IRGVDIVTAKMLPPQDIPVIVVSCRAQEINIYKKFNVEKQTNDIVAGHDSNILMSTYAMV 391

Query: 378 FTRDPENVEDEETEGWRIIEFVRGGSRQFT 407
           FTRDPE ++++ETEGW+I+EFVRGGSR+FT
Sbjct: 392 FTRDPEQLDNDETEGWKILEFVRGGSRKFT 421

>TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4.184
           YGR040W
          Length = 374

 Score = 33.1 bits (74), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 49/95 (51%), Gaps = 16/95 (16%)

Query: 196 KKVEDFREKTFIGRAIQQLKV-RLWNENENPLIVILRKIT----NKVGGFF-----AETE 245
           KK++ F +K FI R +++LK+ R +N +EN +I +L K+     +K+   +      ET+
Sbjct: 42  KKIQPFSKKLFITRTLRELKLMRYFNNHEN-IISVLDKVKPVSFDKLNAVYIVQELMETD 100

Query: 246 TAKVIGQFKLLDPSFTSEGFTRQLRDYVIPEVLEA 280
             KV+    L + S + +        Y I ++L A
Sbjct: 101 LHKVVTNNNLKNTSLSDDHI-----QYFIYQILRA 130

>YLR247C Chr12 complement(628684..633354) [4671 bp, 1556 aa] {ON}
            IRC20Putative helicase; localizes to the mitochondrion
            and the nucleus; YLR247C is not an essential gene; null
            mutant displays increased levels of spontaneous Rad52p
            foci
          Length = 1556

 Score = 31.6 bits (70), Expect = 4.4,   Method: Composition-based stats.
 Identities = 30/111 (27%), Positives = 47/111 (42%), Gaps = 26/111 (23%)

Query: 159  KREREIASGKRARAIRSNEEAGTALVATNIEAKESL-GKKVEDFREKT------------ 205
            KRE+EI   +R  A  S + +    + +N+   E L G K E F +              
Sbjct: 1296 KREKEIQEPRREGADSSQDNSNENSIISNMSEVEKLFGNKYEQFHQINEVHQIHIKESFG 1355

Query: 206  ----FIGRAIQQLKVRLWNENENPLIVILRKITNKVGGFFAETETAKVIGQ 252
                F+ + I  L+++   EN +P  VIL         +  +TE  KVIG+
Sbjct: 1356 AKIDFVIKLISYLRLKSEQENADPPQVIL---------YSQKTEYLKVIGK 1397

>Ecym_2002 Chr2 complement(512..1561) [1050 bp, 349 aa] {ON} similar
           to Ashbya gossypii AGR403W
          Length = 349

 Score = 31.2 bits (69), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 18/59 (30%), Positives = 30/59 (50%), Gaps = 3/59 (5%)

Query: 130 KIYKDVSEVMEDADTSRYGGFLTKEQRKIKREREIASGKRA---RAIRSNEEAGTALVA 185
           K+Y DV ++M+D D +     L  +      E+ +A+GK     + I +N E   A+VA
Sbjct: 57  KVYDDVEKLMQDPDVTFIDALLPVQFNLTAVEKAVAAGKPILLEKPIAANLEQARAIVA 115

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.132    0.366 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 38,044,435
Number of extensions: 1535779
Number of successful extensions: 5427
Number of sequences better than 10.0: 37
Number of HSP's gapped: 5575
Number of HSP's successfully gapped: 37
Length of query: 407
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 295
Effective length of database: 40,638,807
Effective search space: 11988448065
Effective search space used: 11988448065
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 67 (30.4 bits)