Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D14190g6.65ON29529513190.0
NCAS0F003306.65ON2811997176e-94
Smik_15.3526.65ON2882057161e-93
Kpol_1042.116.65ON2922077082e-92
YOR174W (MED4)6.65ON2842057054e-92
Skud_15.3366.65ON2861966942e-90
Suva_8.2276.65ON2872056847e-89
KNAG0M010206.65ON2792526593e-85
TBLA0G005506.65ON3181986539e-84
KAFR0G025006.65ON2892116343e-81
CAGL0L04620g6.65ON2642776183e-79
SAKL0A08426g6.65ON2991786205e-79
NDAI0J013206.65ON3342116062e-76
AGR270W6.65ON2942585971e-75
Kwal_56.232426.65ON2561915731e-72
TPHA0F025906.65ON3062075781e-72
TDEL0G040606.65ON2201645605e-71
KLLA0F20185g6.65ON2851905641e-70
KLTH0G15444g6.65ON2631905621e-70
Ecym_31246.65ON2741805031e-61
Ecym_61794.129ON122664740.95
KLLA0B12133g3.330ON104650731.2
KNAG0E024802.467ON493131721.4
TDEL0C041402.248ON74966712.2
NCAS0A002301.19ON37777693.6
SAKL0C02222g1.66ON1153126684.8
KLLA0D10197g8.879ON85639685.4
TPHA0D037406.311ON231734685.6
ABL093W3.257ON954109668.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D14190g
         (295 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} simil...   512   0.0  
NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65 Y...   280   6e-94
Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W...   280   1e-93
Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON} (21260.....   277   2e-92
YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subuni...   276   4e-92
Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W...   271   2e-90
Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W (...   268   7e-89
KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {O...   258   3e-85
TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65...   256   9e-84
KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON...   248   3e-81
CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} simila...   242   3e-79
SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {O...   243   5e-79
NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {...   238   2e-76
AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic h...   234   1e-75
Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W...   225   1e-72
TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65...   227   1e-72
TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON...   220   5e-71
KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa] ...   221   1e-70
KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa] ...   221   1e-70
Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON} ...   198   1e-61
Ecym_6179 Chr6 complement(330143..333823) [3681 bp, 1226 aa] {ON...    33   0.95 
KLLA0B12133g Chr2 (1058858..1061998) [3141 bp, 1046 aa] {ON} sim...    33   1.2  
KNAG0E02480 Chr5 (492142..493623) [1482 bp, 493 aa] {ON} Anc_2.4...    32   1.4  
TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.2...    32   2.2  
NCAS0A00230 Chr1 complement(32748..33881) [1134 bp, 377 aa] {ON}...    31   3.6  
SAKL0C02222g Chr3 (197312..200773) [3462 bp, 1153 aa] {ON} weakl...    31   4.8  
KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {...    31   5.4  
TPHA0D03740 Chr4 complement(784729..791682) [6954 bp, 2317 aa] {...    31   5.6  
ABL093W Chr2 (223594..226458) [2865 bp, 954 aa] {ON} Syntenic ho...    30   8.8  

>ZYRO0D14190g Chr4 (1200325..1201212) [888 bp, 295 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 295

 Score =  512 bits (1319), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/295 (87%), Positives = 257/295 (87%)

Query: 1   MLSQSEFAPDTPANILSRGHVRSSSTSLISDAMSSGNNNDDELSKVQIYADLTQYEEKLA 60
           MLSQSEFAPDTPANILSRGHVRSSSTSLISDAMSSGNNNDDELSKVQIYADLTQYEEKLA
Sbjct: 1   MLSQSEFAPDTPANILSRGHVRSSSTSLISDAMSSGNNNDDELSKVQIYADLTQYEEKLA 60

Query: 61  ALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEV 120
           ALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEV
Sbjct: 61  ALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEV 120

Query: 121 LETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGT 180
           LETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGT
Sbjct: 121 LETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGT 180

Query: 181 IGPNNFVWPAEDALRRGMLAIASLHSKEMTRIPGXXXXXXADATEKQGSGDKNXXXXXXX 240
           IGPNNFVWPAEDALRRGMLAIASLHSKEMTRIPG      ADATEKQGSGDKN       
Sbjct: 181 IGPNNFVWPAEDALRRGMLAIASLHSKEMTRIPGEPEEEEADATEKQGSGDKNGKEGEET 240

Query: 241 XXXXRPASPGAHGNERRQSFVFTENPTXXXXXXXXXXXXXXXXXXXXXLFKPDEF 295
               RPASPGAHGNERRQSFVFTENPT                     LFKPDEF
Sbjct: 241 KTGERPASPGAHGNERRQSFVFTENPTETANADNNDEPDDEALDLDLDLFKPDEF 295

>NCAS0F00330 Chr6 (53650..54495) [846 bp, 281 aa] {ON} Anc_6.65
           YOR174W
          Length = 281

 Score =  280 bits (717), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 132/199 (66%), Positives = 170/199 (85%), Gaps = 1/199 (0%)

Query: 17  SRGHVRSSSTSLISDAM-SSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNFKPDVKI 75
           S GH+RSSS SL+++   +S +N++D++SKVQIY+DL  YE+KLA LV SVD FKPD+  
Sbjct: 14  SMGHIRSSSVSLLAEVNPNSISNDEDDISKVQIYSDLCSYEQKLANLVNSVDKFKPDMNA 73

Query: 76  VHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLP 135
             ELIEVD+ L+++LDSF EYD+ID+ L +L+ ES ELD +TKE+L  L+EC++ LN LP
Sbjct: 74  ARELIEVDRHLFQTLDSFEEYDKIDNSLKKLNAESIELDARTKEILGILNECHDELNALP 133

Query: 136 MLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALR 195
           ML+QVEFE ++IL+QRSK+NSSVLL+YATKLSKFTKIPPTFDKG+IGPNNF+WPAEDALR
Sbjct: 134 MLKQVEFEMETILQQRSKINSSVLLDYATKLSKFTKIPPTFDKGSIGPNNFIWPAEDALR 193

Query: 196 RGMLAIASLHSKEMTRIPG 214
           RGMLA+ASLH+ E+T+ PG
Sbjct: 194 RGMLALASLHADELTKAPG 212

>Smik_15.352 Chr15 (614812..615678) [867 bp, 288 aa] {ON} YOR174W
           (REAL)
          Length = 288

 Score =  280 bits (716), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 170/205 (82%), Gaps = 1/205 (0%)

Query: 10  DTPANILSRGHVRSSSTSLISDAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNF 69
           DT A   S GH++SSS SL+ +A +S  N++D+LSKVQ+Y DL +YE+ L  LVESVD F
Sbjct: 5   DTKAVDFSMGHMKSSSVSLVVEA-TSNMNSEDKLSKVQLYEDLCRYEDTLKKLVESVDRF 63

Query: 70  KPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYE 129
           KPD+ +  +LI++D+SL+ ++D  +EYD ID  L ++DK+S ELD KTK +LE ++EC++
Sbjct: 64  KPDIDVARDLIKIDESLFNNVDLLSEYDNIDRNLRKIDKDSEELDSKTKRILEIMNECHD 123

Query: 130 MLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWP 189
            L  LPMLEQVEFEK +IL+QRSK+NS+ LL+YATKLSKFT+IPPTFDKG+IGPNNF+WP
Sbjct: 124 ELGALPMLEQVEFEKNTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGSIGPNNFIWP 183

Query: 190 AEDALRRGMLAIASLHSKEMTRIPG 214
           AEDALRRGMLA+ASLHSKE+TR+PG
Sbjct: 184 AEDALRRGMLAMASLHSKELTRVPG 208

>Kpol_1042.11 s1042 (21260..22138) [879 bp, 292 aa] {ON}
           (21260..22138) [879 nt, 293 aa]
          Length = 292

 Score =  277 bits (708), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 136/207 (65%), Positives = 168/207 (81%), Gaps = 11/207 (5%)

Query: 19  GHVRS-SSTSLISDAMSS----------GNNNDDELSKVQIYADLTQYEEKLAALVESVD 67
           GHV+S SS SL++D  +S           NN  ++LSKVQIY D+++YE  L  LVESVD
Sbjct: 7   GHVKSISSVSLMTDNTNSISTNSLNMIDYNNESNDLSKVQIYNDISEYENTLFKLVESVD 66

Query: 68  NFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSEC 127
            FKPDVK+ H+LI+VD+ L+KSLDSF EYD+I ++L   DKE+ ELD KTKE+L TL+EC
Sbjct: 67  KFKPDVKLAHQLIDVDERLFKSLDSFVEYDKISTKLEECDKEAAELDTKTKEILGTLNEC 126

Query: 128 YEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFV 187
           + +LN LPMLEQVEFEK  ILKQRSK+NS +LL+YATKLSKFTKIPPTF+KG+IGPNNF+
Sbjct: 127 HGLLNSLPMLEQVEFEKDIILKQRSKINSKLLLDYATKLSKFTKIPPTFNKGSIGPNNFI 186

Query: 188 WPAEDALRRGMLAIASLHSKEMTRIPG 214
           WPAEDALRRGMLA+ASLHSKE+T++P 
Sbjct: 187 WPAEDALRRGMLAMASLHSKELTKLPN 213

>YOR174W Chr15 (658747..659601) [855 bp, 284 aa] {ON}  MED4Subunit
           of the RNA polymerase II mediator complex; associates
           with core polymerase subunits to form the RNA polymerase
           II holoenzyme; essential for transcriptional regulation
          Length = 284

 Score =  276 bits (705), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 169/205 (82%), Gaps = 1/205 (0%)

Query: 10  DTPANILSRGHVRSSSTSLISDAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNF 69
           DT A   S GH+RSSS SL+++A +S  N++D+LSKVQ+Y DL +YE+ L+ LVESVD F
Sbjct: 5   DTKAVEFSMGHIRSSSVSLVAEA-TSNTNSEDKLSKVQLYEDLCRYEDTLSKLVESVDRF 63

Query: 70  KPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYE 129
           KP++ I  +LI  D++L++++   AEYD I   L ++DK+S ELD KT+++LE L+EC++
Sbjct: 64  KPNLDIAKDLIRTDEALFENVKLLAEYDNIYRNLQKIDKDSEELDSKTRKILEILNECHD 123

Query: 130 MLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWP 189
            L  LPMLEQVEFEK +IL+QRSK+NS+ LL+YATKLSKFTKIPPTFDKG +GPNNF+WP
Sbjct: 124 ELKALPMLEQVEFEKNTILQQRSKINSTELLDYATKLSKFTKIPPTFDKGAVGPNNFIWP 183

Query: 190 AEDALRRGMLAIASLHSKEMTRIPG 214
           AEDALRRGMLA+ASLHSKE+TRIPG
Sbjct: 184 AEDALRRGMLAMASLHSKELTRIPG 208

>Skud_15.336 Chr15 (607340..608200) [861 bp, 286 aa] {ON} YOR174W
           (REAL)
          Length = 286

 Score =  271 bits (694), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 125/196 (63%), Positives = 166/196 (84%), Gaps = 1/196 (0%)

Query: 19  GHVRSSSTSLISDAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNFKPDVKIVHE 78
           GH++SSS SL+++A +S  N++D+LSKVQ+Y DL +YE  L+ LVESVD FKPD+ +  +
Sbjct: 14  GHIKSSSVSLVAEA-ASNMNSEDKLSKVQLYEDLCRYEGVLSKLVESVDRFKPDLDVARD 72

Query: 79  LIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLE 138
           LI  D+SL+ ++   A+YD ID  L ++DK+S ELD K++++LE L+EC++ L+GLP LE
Sbjct: 73  LISADESLFNNVKLLADYDNIDRNLQKIDKDSEELDSKSRKILEILNECHDELSGLPTLE 132

Query: 139 QVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGM 198
           QVEFEK +IL+QRSK+NS+ LL+YATKLSKFTKIPPTFDKGT+GPNNF+WPAEDALRRGM
Sbjct: 133 QVEFEKNTILQQRSKINSTALLDYATKLSKFTKIPPTFDKGTVGPNNFIWPAEDALRRGM 192

Query: 199 LAIASLHSKEMTRIPG 214
           LA+ASLHSKE+TR+PG
Sbjct: 193 LAMASLHSKELTRVPG 208

>Suva_8.227 Chr8 (408722..409585) [864 bp, 287 aa] {ON} YOR174W
           (REAL)
          Length = 287

 Score =  268 bits (684), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 127/205 (61%), Positives = 169/205 (82%), Gaps = 1/205 (0%)

Query: 10  DTPANILSRGHVRSSSTSLISDAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNF 69
           DT A       +RSSS SL+++A SS N+ + + SKVQ+Y DL +YE+ L  LVESVD F
Sbjct: 5   DTKAVEFPMNQIRSSSVSLVAEATSSMNS-EHKSSKVQLYEDLCRYEDILGKLVESVDRF 63

Query: 70  KPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYE 129
           KP+++I  +LI+ D+SL+ ++   A+YD+ID  L ++DK+S ELD KT+++LE L+EC++
Sbjct: 64  KPNLEIAKDLIKTDESLFNNVKLLADYDKIDLNLRKIDKDSEELDSKTRKILEILNECHD 123

Query: 130 MLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWP 189
            L+ LPMLEQVEFEK++IL+QRSK+NS+ LL+YATKLSKFT+IPPTFDKGT+GPNNF+WP
Sbjct: 124 ELSALPMLEQVEFEKKTILQQRSKINSTALLDYATKLSKFTRIPPTFDKGTVGPNNFIWP 183

Query: 190 AEDALRRGMLAIASLHSKEMTRIPG 214
           AEDALRRGMLA+ASLHSKE+TRIPG
Sbjct: 184 AEDALRRGMLAMASLHSKELTRIPG 208

>KNAG0M01020 Chr13 complement(180570..181409) [840 bp, 279 aa] {ON}
           Anc_6.65 YOR174W
          Length = 279

 Score =  258 bits (659), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 131/252 (51%), Positives = 173/252 (68%), Gaps = 17/252 (6%)

Query: 16  LSRGHVRSSSTSLISDAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNFKPDVKI 75
           +S GH R+SS SL+ +   +    +D L KV+IY+ + +YE+ LAALVESVD++KPD+ +
Sbjct: 14  VSAGHKRASSVSLLQEGTDAAALAED-LKKVRIYSGIVEYEDTLAALVESVDSYKPDMAV 72

Query: 76  VHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLP 135
              L++ DK L+ SLD F EYD I + L  L  +S  LD KT+++LE L+EC++ LN LP
Sbjct: 73  AQRLVDADKELFASLDKFKEYDEISTRLGELKGKSTALDTKTRDILEKLNECHDELNKLP 132

Query: 136 MLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALR 195
            LEQV+FE  +IL+QR K+NSS LL+YATKLSKFT+IPPTFDKG+IGPNNF+WPAEDALR
Sbjct: 133 YLEQVQFEMDTILEQREKINSSELLDYATKLSKFTRIPPTFDKGSIGPNNFIWPAEDALR 192

Query: 196 RGMLAIASLHSKEMTRIPGXXXXXXADATEKQGSGDKNXXXXXXXXXXXRPASPGAHGNE 255
           +GMLAIA+LHS+E+TRIPG       DA +K+   +K                P     E
Sbjct: 193 KGMLAIAALHSRELTRIPGQD-----DAEDKKKQTEKPDV-----------PEPAPVTEE 236

Query: 256 RRQSFVFTENPT 267
           RR SFVF +  T
Sbjct: 237 RRSSFVFGDTST 248

>TBLA0G00550 Chr7 (115655..116611) [957 bp, 318 aa] {ON} Anc_6.65
           YOR174W
          Length = 318

 Score =  256 bits (653), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 116/198 (58%), Positives = 159/198 (80%), Gaps = 1/198 (0%)

Query: 18  RGHVRSSSTSLI-SDAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNFKPDVKIV 76
            GH ++ STS+   D +   N+ +DELSK+Q Y DL QYEE L+ L  SVD +KPD++  
Sbjct: 11  HGHHKTLSTSISEGDVLQDNNDKNDELSKIQTYNDLIQYEETLSKLSSSVDKYKPDLQYA 70

Query: 77  HELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLPM 136
           ++LI++D+ LY +LDSF +YD I ++L +L+ ++  LD KTK VL++L++C+E+LN LPM
Sbjct: 71  YDLIDIDRKLYSTLDSFVKYDEISTKLKKLEIDTKALDEKTKSVLDSLNDCHELLNTLPM 130

Query: 137 LEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRR 196
           LEQVEFEK ++LKQR K+NS VLL+YATKL+KFTKIPPTF+K T+GPNNF+WPAEDALRR
Sbjct: 131 LEQVEFEKNTMLKQREKINSKVLLDYATKLAKFTKIPPTFNKNTLGPNNFIWPAEDALRR 190

Query: 197 GMLAIASLHSKEMTRIPG 214
           GMLA+AS H++E+T +PG
Sbjct: 191 GMLAVASAHTEELTALPG 208

>KAFR0G02500 Chr7 complement(519629..520498) [870 bp, 289 aa] {ON}
           Anc_6.65 YOR174W
          Length = 289

 Score =  248 bits (634), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 122/211 (57%), Positives = 160/211 (75%), Gaps = 10/211 (4%)

Query: 14  NILSRGHVRSSSTSLI----SDAMSSGNNNDDE------LSKVQIYADLTQYEEKLAALV 63
           N L+ GH +SSS SL+    S ++++ NN D        ++KV IY+DL+QYEE L+ L+
Sbjct: 2   NDLTLGHRKSSSLSLLGEPPSTSITNSNNIDSASGASPAITKVGIYSDLSQYEETLSRLI 61

Query: 64  ESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLET 123
           +S+D +KPD KI  ELI++D  L+ SLDSF +YDRI S L   +K+  E   KTKE+LET
Sbjct: 62  QSIDTYKPDKKIAQELIDIDSKLFNSLDSFVQYDRISSRLKDFEKQEKESTLKTKEILET 121

Query: 124 LSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGP 183
           L+EC+  LN LP ++QV FE  ++L+QR K+NSSVLL+YATKLSKFTKIPPTFDKG+IGP
Sbjct: 122 LNECHNALNLLPTVDQVHFEMNTMLEQRKKINSSVLLDYATKLSKFTKIPPTFDKGSIGP 181

Query: 184 NNFVWPAEDALRRGMLAIASLHSKEMTRIPG 214
           NNFVWPAEDALRRGMLA+A+ H+ E+T+I G
Sbjct: 182 NNFVWPAEDALRRGMLALAASHTDELTKIAG 212

>CAGL0L04620g Chr12 (533791..534585) [795 bp, 264 aa] {ON} similar
           to uniprot|Q12343 Saccharomyces cerevisiae YOR174w MED4
          Length = 264

 Score =  242 bits (618), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 133/277 (48%), Positives = 175/277 (63%), Gaps = 22/277 (7%)

Query: 27  SLISDAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSL 86
           SL++++ +SG  ++ EL KVQ+Y+DL  YEE L  LV+SVDNFKP ++I  +LIE DK L
Sbjct: 2   SLVAES-NSGTISEQELDKVQLYSDLCLYEEALTKLVDSVDNFKPQLEIGKQLIEADKKL 60

Query: 87  YKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQS 146
           Y +LD   +YD + + L  LD E +++D++TK +L  L+EC++ LN LP+LE+VEFEK+ 
Sbjct: 61  YSTLDLLPQYDSVFTRLRTLDDEISKVDQQTKNILSILNECHDDLNALPLLEEVEFEKKM 120

Query: 147 ILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIASLHS 206
           ILKQR K+ S+VLL YATKL+KFTKIPPTFDKGTIGPNNF+WPAEDALR+GMLA+ASLH 
Sbjct: 121 ILKQREKIKSNVLLEYATKLAKFTKIPPTFDKGTIGPNNFIWPAEDALRKGMLAMASLHG 180

Query: 207 KEMTRIPGXXXXXXADATEKQGSGDKNXXXXXXXXXXXRPASPGAHGNERR------QSF 260
           KE+T++PG        +T  +   DKN              + GA G  R+       SF
Sbjct: 181 KELTKLPGQEDGEEDGSTANE---DKNIVKD----------AEGAEGEIRQDDKKEDDSF 227

Query: 261 VFTENPTXXXXXXXXXXXXXXXXXXXX--XLFKPDEF 295
           VF  N                         LF PDEF
Sbjct: 228 VFGANANDAEGDEDKNAGEDEDEAMDSDLDLFNPDEF 264

>SAKL0A08426g Chr1 complement(746101..747000) [900 bp, 299 aa] {ON}
           similar to gnl|GLV|KLLA0F20185g Kluyveromyces lactis
           KLLA0F20185g and weakly similar to YOR174W
           uniprot|Q12343 Saccharomyces cerevisiae YOR174W MED4
           Member of RNA Polymerase II transcriptional regulation
           mediator Stoichiometric member of mediator complex
          Length = 299

 Score =  243 bits (620), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 108/178 (60%), Positives = 143/178 (80%)

Query: 37  NNNDDELSKVQIYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEY 96
           + + D LS+V++YAD+ +YEE L  LV SVD FKPD+K+  ELIE DK L+K+L+ F +Y
Sbjct: 38  DQDQDLLSRVEVYADICEYEETLGKLVSSVDKFKPDLKVAQELIETDKKLFKALEEFPKY 97

Query: 97  DRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNS 156
           D+ID  LN L+K+S E+D+KT ++LE L+ C+  LN LP LEQV  E+ ++LKQR K+ S
Sbjct: 98  DKIDGRLNDLEKQSQEVDKKTSKILEVLNGCHAQLNSLPALEQVLLERDTMLKQREKIYS 157

Query: 157 SVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIASLHSKEMTRIPG 214
            VLL+YA KL+KFT++PPTFDKG +GPNNF+WPAEDA+RRGMLA+ASL SKE+TRIPG
Sbjct: 158 GVLLDYAMKLAKFTRVPPTFDKGMVGPNNFIWPAEDAMRRGMLAMASLKSKELTRIPG 215

>NDAI0J01320 Chr10 complement(308327..309331) [1005 bp, 334 aa] {ON}
           Anc_6.65 YOR174W
          Length = 334

 Score =  238 bits (606), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 113/211 (53%), Positives = 161/211 (76%), Gaps = 13/211 (6%)

Query: 17  SRGHVRSSSTSLISDAMSSGN----------NND---DELSKVQIYADLTQYEEKLAALV 63
           S  H+R+SS SL+++A+++G           +ND   D LS+V+IY D+  YE+ L+ L+
Sbjct: 37  SANHLRASSVSLLAEAVTNGTPSSSEFNRSYDNDSSKDVLSEVRIYDDIITYEKALSRLI 96

Query: 64  ESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLET 123
           +SVD FKP++ I  ELI+ DKSL+ +L+SF +YD ID  L  L+ +++++D  T+  L+T
Sbjct: 97  DSVDKFKPNLNIAQELIQADKSLFDTLNSFIQYDEIDLHLKALETKASKIDELTQSTLQT 156

Query: 124 LSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGP 183
           L+EC++ LN LP L Q+EFE  +IL QR+K+NS++LL+YATKLSKFTKIPPTFDKG+IGP
Sbjct: 157 LNECHDDLNKLPTLPQIEFELNTILNQRTKINSTILLDYATKLSKFTKIPPTFDKGSIGP 216

Query: 184 NNFVWPAEDALRRGMLAIASLHSKEMTRIPG 214
           NNF+WPAED+LRRGMLA+ASL + ++T IPG
Sbjct: 217 NNFIWPAEDSLRRGMLAMASLKADQLTYIPG 247

>AGR270W Chr7 (1244264..1245148) [885 bp, 294 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR174W (MED4)
          Length = 294

 Score =  234 bits (597), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 124/258 (48%), Positives = 158/258 (61%), Gaps = 11/258 (4%)

Query: 41  DELSKVQIYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDRID 100
           ++L  V IY DL QYEE L  LV SVD F+PD++   ELIE+D  LY +L    +YD ID
Sbjct: 45  NKLHSVAIYEDLCQYEESLQRLVTSVDKFQPDLEAAQELIEIDSKLYSNLAQLPKYDLID 104

Query: 101 SELNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLL 160
           S+L +L++ES ++D +T ++L  L ECY  LN LPM+EQVEFE  ++ KQ+ KVNSSVLL
Sbjct: 105 SQLKKLEEESKDIDERTAKILGILGECYNDLNSLPMVEQVEFEMATMKKQKDKVNSSVLL 164

Query: 161 NYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIASLHSKEMTRIPGXXXXXX 220
            YA KLSKFT++PPTF+K  IGPNNF+WPAEDA+RRGMLA+ASL SKE+T +PG      
Sbjct: 165 EYAMKLSKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSKELTSLPG-----Q 219

Query: 221 ADATEKQGSGDKNXXXXXXXXXXXRPASPGAHGNERRQSFVFT---ENPTXXXXXXXXXX 277
           +D   +Q S  K             PA+    G+ RR SF FT   + P           
Sbjct: 220 SDQEAEQASAGKEADTAGPGVSTLEPAN---GGHNRRGSFEFTGIRKPPPASDADSSVVD 276

Query: 278 XXXXXXXXXXXLFKPDEF 295
                      LF PDEF
Sbjct: 277 DGDASMDLDLNLFNPDEF 294

>Kwal_56.23242 s56 (459387..460157) [771 bp, 256 aa] {ON} YOR174W
           (MED4) - Stoichiometric member of mediator complex
           [contig 183] FULL
          Length = 256

 Score =  225 bits (573), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 135/191 (70%)

Query: 37  NNNDDELSKVQIYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEY 96
            N +  LSK QIY+D+ ++EE L  LV SVD F PD+KI   LIEVDK L K+L+S   Y
Sbjct: 16  TNAESRLSKAQIYSDICEFEETLGKLVASVDKFNPDLKIAESLIEVDKRLSKTLESLPRY 75

Query: 97  DRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNS 156
           D ID     LD++  E D +   +LETL+EC   LN LPMLEQVEFE+Q++LKQR KV +
Sbjct: 76  DEIDLRAKELDQKHLETDERMVRILETLTECSTDLNALPMLEQVEFERQTMLKQREKVFT 135

Query: 157 SVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIASLHSKEMTRIPGXX 216
           +VLL+YA KL+KFT +PPTFDKG +GPNNFVWPAEDA+RRGMLAIASL + E  + P   
Sbjct: 136 NVLLDYAMKLAKFTHVPPTFDKGAVGPNNFVWPAEDAMRRGMLAIASLQASEDAKKPETG 195

Query: 217 XXXXADATEKQ 227
               A+ T KQ
Sbjct: 196 AAQTAEETTKQ 206

>TPHA0F02590 Chr6 (565725..566645) [921 bp, 306 aa] {ON} Anc_6.65
           YOR174W
          Length = 306

 Score =  227 bits (578), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 151/207 (72%), Gaps = 11/207 (5%)

Query: 8   APDTPANILSRGHVRSSSTSLISDAMSSGNNNDDELSKVQIYADLTQYEEKLAALVESVD 67
            P + AN +S+G   + +T+ +           D L+ V IY D+  YE+ L  LV S+D
Sbjct: 33  VPQSTANNISQGTASNMNTAAV-----------DSLANVAIYNDIKNYEDTLIKLVSSID 81

Query: 68  NFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSEC 127
           NF+PDV++   LIEVDK LYK+L SF EYD ID++++++  +S +LD +TK +L+ L++ 
Sbjct: 82  NFRPDVEVAKTLIEVDKRLYKNLGSFKEYDEIDTKISKIKDDSEKLDLQTKHILDILNDS 141

Query: 128 YEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFV 187
             MLN LPMLE++ FE+  + +++ K+NS +LL+YATK+SKFTKIPPTF+KG+IGPNNF+
Sbjct: 142 RNMLNSLPMLEEIYFERDVMHEKQKKINSKILLDYATKISKFTKIPPTFNKGSIGPNNFI 201

Query: 188 WPAEDALRRGMLAIASLHSKEMTRIPG 214
           WPAEDALRRGMLA+AS+H  E+T++P 
Sbjct: 202 WPAEDALRRGMLAVASIHRSELTKLPN 228

>TDEL0G04060 Chr7 complement(741796..742458) [663 bp, 220 aa] {ON}
           Anc_6.65 YOR174W
          Length = 220

 Score =  220 bits (560), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 125/164 (76%), Gaps = 3/164 (1%)

Query: 47  QIYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRL 106
           Q+Y DLT+YEE L  LVESVD F+PD+    EL+E D++L KSLD F  YD +D EL RL
Sbjct: 3   QVYGDLTRYEEALGRLVESVDQFRPDLSCARELVEADRALGKSLDKFGLYDEVDKELQRL 62

Query: 107 DKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKL 166
           D+ES  L+R T   LETL ECY  L+ LPMLEQV+FE++ +L+QR +VNS+VLL YATKL
Sbjct: 63  DRESERLNRHTARTLETLDECYRALSALPMLEQVKFEQRKVLEQRGRVNSAVLLEYATKL 122

Query: 167 SKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIASLHSKEMT 210
           SKFTK P       +GPNNFVWPAEDALRRG LA+A+LHS+E+T
Sbjct: 123 SKFTKAPAGV---AVGPNNFVWPAEDALRRGQLAVAALHSEEIT 163

>KLLA0F20185g Chr6 complement(1882094..1882951) [858 bp, 285 aa]
           {ON} similar to uniprot|Q12343 Saccharomyces cerevisiae
           YOR174W MED4 Member of RNA Polymerase II transcriptional
           regulation mediator Stoichiometric member of mediator
           complex
          Length = 285

 Score =  221 bits (564), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 106/190 (55%), Positives = 143/190 (75%), Gaps = 4/190 (2%)

Query: 24  SSTSLISDAMSSGNNNDD----ELSKVQIYADLTQYEEKLAALVESVDNFKPDVKIVHEL 79
           SSTS+ +   S+ +   +    EL  V IY DL +YEE +  L +SVD FKPD+ ++ ++
Sbjct: 9   SSTSVATLPFSAQDKTQEQVSEELQSVGIYQDLERYEETIQQLSKSVDTFKPDLSLIDKV 68

Query: 80  IEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQ 139
           IE DK LY++L+ F EY +I+ EL+RLDKE   +D KT+E+LETL+ CY  LN LPMLEQ
Sbjct: 69  IECDKKLYETLEEFDEYYKIEEELSRLDKEQKNIDNKTREILETLNTCYNSLNELPMLEQ 128

Query: 140 VEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGML 199
           VEFE++ +LKQR K++S V+L+YA KL+KFT+ PPTFDK  IGPNNF+WPAED+LR+GML
Sbjct: 129 VEFEQKVMLKQREKIHSKVVLDYAMKLAKFTRFPPTFDKSMIGPNNFIWPAEDSLRKGML 188

Query: 200 AIASLHSKEM 209
           A+ASL  KE+
Sbjct: 189 AMASLKKKEL 198

>KLTH0G15444g Chr7 complement(1353833..1354624) [792 bp, 263 aa]
           {ON} some similarities with uniprot|Q12343 Saccharomyces
           cerevisiae YOR174W MED4 Member of RNA Polymerase II
           transcriptional regulation mediator Stoichiometric
           member of mediator complex
          Length = 263

 Score =  221 bits (562), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 106/190 (55%), Positives = 137/190 (72%), Gaps = 11/190 (5%)

Query: 43  LSKVQIYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSE 102
           LSK+Q+Y D+ ++E+ L  LV SVD F PD+++   LIE DK LYKSL+   +YD ID+ 
Sbjct: 22  LSKLQVYNDICEFEDTLGKLVASVDRFNPDLELARALIEADKQLYKSLECLPKYDEIDTR 81

Query: 103 LNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNY 162
              LD+E  + D KT  +LETL+EC   LN LPMLEQVEFE++++LKQR KV + VLL+Y
Sbjct: 82  AKTLDEEHRDTDEKTIRILETLTECGSDLNALPMLEQVEFERETMLKQREKVFTDVLLDY 141

Query: 163 ATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIASLHSKEMTRIPGXXXXXXAD 222
           A KL+KFT +PPTFDKGT+GPNNFVWPAEDA+RRGMLAIASL + E            A+
Sbjct: 142 AMKLAKFTHVPPTFDKGTVGPNNFVWPAEDAMRRGMLAIASLRASE-----------GAN 190

Query: 223 ATEKQGSGDK 232
           A E+Q S ++
Sbjct: 191 AQEQQASSEQ 200

>Ecym_3124 Chr3 complement(232769..233593) [825 bp, 274 aa] {ON}
           similar to Ashbya gossypii AGR270W
          Length = 274

 Score =  198 bits (503), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 100/180 (55%), Positives = 132/180 (73%), Gaps = 3/180 (1%)

Query: 37  NNNDDELSKVQ---IYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSF 93
           ++N+DEL+ VQ   +Y DL Q+EE L  LV SVD F PD++   +LI  D  LY +L+  
Sbjct: 13  DSNNDELNHVQQVTLYKDLCQFEEDLQKLVVSVDKFSPDLQAAQDLINSDLKLYSTLEQL 72

Query: 94  AEYDRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQSILKQRSK 153
             YD ID +L +LD ES E+D +T ++L  L +CY  LN LPM+EQVEFE + + KQ+ K
Sbjct: 73  PLYDSIDIQLKQLDNESQEIDERTGKILSILDKCYNNLNKLPMVEQVEFEMKMMKKQKEK 132

Query: 154 VNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNFVWPAEDALRRGMLAIASLHSKEMTRIP 213
           + S VLL YA KL+KFT++PPTF+K  IGPNNF+WPAEDA+RRGMLA+ASL S+E+TRIP
Sbjct: 133 IKSGVLLEYAMKLAKFTRVPPTFNKDAIGPNNFIWPAEDAIRRGMLAMASLKSEELTRIP 192

>Ecym_6179 Chr6 complement(330143..333823) [3681 bp, 1226 aa] {ON}
           similar to Ashbya gossypii AFR002C
          Length = 1226

 Score = 33.1 bits (74), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 36/64 (56%), Gaps = 13/64 (20%)

Query: 85  SLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYEMLNGLPMLEQVEFEK 144
           S+YKSL   AEY ++     RL  ES+EL   +K +LE L EC      L +LE   FE+
Sbjct: 816 SVYKSLPLPAEYLKL-----RL--ESDELRDSSKSILEILKEC------LKLLENKPFER 862

Query: 145 QSIL 148
           + +L
Sbjct: 863 ERVL 866

>KLLA0B12133g Chr2 (1058858..1061998) [3141 bp, 1046 aa] {ON}
           similar to uniprot|Q12527 Saccharomyces cerevisiae
           YPR049C ATG11 Peripheral membrane protein required for
           delivery of aminopeptidase I (Lap4p) to the vacuole in
           the cytoplasm- to-vacuole targeting pathway also
           required for peroxisomal degradation (pexophagy)
          Length = 1046

 Score = 32.7 bits (73), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 80  IEVDKSLYKSLDSFAEYDRIDSELNRLDKESNELDRKTKEVLETLSECYE 129
           I+V   L  S  +++E   I+  ++RLD+E   L+ K KE+ +++ ECY+
Sbjct: 195 IKVSNQLLSSFFNYSELTEIEDSIHRLDRE---LNAKLKELKKSIDECYQ 241

>KNAG0E02480 Chr5 (492142..493623) [1482 bp, 493 aa] {ON} Anc_2.467
           YMR094W
          Length = 493

 Score = 32.3 bits (72), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/131 (24%), Positives = 59/131 (45%), Gaps = 16/131 (12%)

Query: 75  IVHEL---IEVDKSLYKSLDS-FAEYDRIDSEL----NRLDKESNELDRKTKEVLETLSE 126
           IVH L   +++  ++Y  LD  F      D +L     +  K + +L    K +L  L  
Sbjct: 3   IVHFLELPVDIRSAVYYHLDGQFTNVKPDDPDLLSNVFKAMKSTGDLSLDKKRLLRKLYP 62

Query: 127 CYEMLNGLPMLEQVEFEKQSILKQRSKVNSSVLLNYATKLSKFTKIPPTFDKGTIGPNNF 186
            Y+     P LE  E++ + I+   + +  S  L Y   +    ++  + D G +GP ++
Sbjct: 63  RYK-----PYLEMFEYDPELIV---TWLQYSSWLRYDAVILDCLRLNHSLDAGIMGPFDW 114

Query: 187 VWPAEDALRRG 197
           ++  ED L+ G
Sbjct: 115 IYMGEDTLKIG 125

>TDEL0C04140 Chr3 (732580..734829) [2250 bp, 749 aa] {ON} Anc_2.248
           YNL059C
          Length = 749

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 5/66 (7%)

Query: 39  NDDELSKVQIYADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDR 98
           NDD+ +   +Y D+TQY E L  L+E  + +K  V++  +L+E D +  +     A+YD 
Sbjct: 527 NDDDWT---VYNDVTQYPEALEELIE--EGYKEIVELEGQLLEHDPNFTEEDTMDAQYDW 581

Query: 99  IDSELN 104
            +S L+
Sbjct: 582 RNSTLH 587

>NCAS0A00230 Chr1 complement(32748..33881) [1134 bp, 377 aa] {ON}
           Anc_1.19 YDR532C
          Length = 377

 Score = 31.2 bits (69), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 20/77 (25%), Positives = 42/77 (54%), Gaps = 6/77 (7%)

Query: 73  VKIVHELIEVDKSLYKSLDSFAEYDRIDSELNRLDKE----SNELDRKTKEVLETLSECY 128
           VK+  E+  ++K   +  +   E DRI S++N+L+ +    +N+L++   +    + +C+
Sbjct: 127 VKLQKEVTSLEKGQIQ--NHLDEIDRIKSDINKLNGKISTSTNQLNQLHLDTTNDIDDCF 184

Query: 129 EMLNGLPMLEQVEFEKQ 145
            +L  L  LE V+  +Q
Sbjct: 185 TLLKNLDNLENVQLNQQ 201

>SAKL0C02222g Chr3 (197312..200773) [3462 bp, 1153 aa] {ON} weakly
           similar to Saccharomyces cerevisiae YLR187W SKG3 Protein
           of unknown function; green fluorescent protein
           (GFP)-fusion protein localizes to the cell periphery,
           cytoplasm, bud, and bud neck; potential Cdc28p substrate
           And to YNL278W uniprot|P53836 Saccharomyces cerevisiae
           YNL278W CAF120 Part of the evolutionarily- conserved
           CCR4-NOT transcriptional regulatory complex involved in
           controlling mRNA initiation, elongation, and degradation
          Length = 1153

 Score = 30.8 bits (68), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 59/126 (46%), Gaps = 10/126 (7%)

Query: 40  DDELSKVQIYADLTQYEE-KLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEY-- 96
           +D ++     AD   +++ + +A  E  + F PD    ++++E  +S Y + ++  +Y  
Sbjct: 775 NDAIAPASSLADDFNFDDSRGSAPAEPQNVFDPDFMEENQMLE-SESRYTAEENKFQYAN 833

Query: 97  DRIDSELNRLDKESN-----ELDRKTKEVLETLSECYEMLNGLPMLEQVEFEKQSILKQR 151
           DR+    N L +  N     + D+ T  +   L       N LP    + +  QS+ KQR
Sbjct: 834 DRLAGSANHLGERENTQPFYKTDQSTSSLYSPLDGAGGSSNSLPKTGGLGYAPQSMPKQR 893

Query: 152 SKVNSS 157
           + VNSS
Sbjct: 894 A-VNSS 898

>KLLA0D10197g Chr4 complement(861726..864296) [2571 bp, 856 aa] {ON}
           similar to uniprot|P05085 Saccharomyces cerevisiae
           YML099C ARG81 Zinc-finger transcription factor of the
           Zn(2)-Cys(6) binuclear cluster domain type involved in
           the regulation of arginine-responsive genes acts with
           Arg80p and Arg82p
          Length = 856

 Score = 30.8 bits (68), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 22/39 (56%)

Query: 8   APDTPANILSRGHVRSSSTSLISDAMSSGNNNDDELSKV 46
            P TP  + + G    S     +D  +SGN+N+DEL++V
Sbjct: 252 TPQTPLTVDNMGKKNGSVNGNCNDGRTSGNDNEDELARV 290

>TPHA0D03740 Chr4 complement(784729..791682) [6954 bp, 2317 aa] {ON}
            Anc_6.311 YMR207C
          Length = 2317

 Score = 30.8 bits (68), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 13/34 (38%), Positives = 24/34 (70%)

Query: 60   AALVESVDNFKPDVKIVHELIEVDKSLYKSLDSF 93
            +  + ++D+ +PD+KI+ ELIE D +++ SL  F
Sbjct: 1138 SKFLNNIDHPQPDLKILEELIECDFAIFDSLFPF 1171

>ABL093W Chr2 (223594..226458) [2865 bp, 954 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR027C (LUV1)
          Length = 954

 Score = 30.0 bits (66), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 53/109 (48%), Gaps = 18/109 (16%)

Query: 49  YADLTQYEEKLAALVESVDNFKPDVKIVHELIEVDKSLYKSLDSFAEYDRIDSE----LN 104
           Y DL   +E+L   +++++N          ++++ KS +K LD+  +   I  E    L 
Sbjct: 288 YKDL---QERLNFYLDTIENIL--------IVDISKSSHKFLDALEDVGTIKDEAQSVLT 336

Query: 105 RLDKESNELDRKTKEVLET---LSECYEMLNGLPMLEQVEFEKQSILKQ 150
           +LD+   EL+ + +E L+    LS+    +  +  LEQ   +   +LKQ
Sbjct: 337 KLDQLKTELETEDRERLQKRLRLSQKLTRIRNIERLEQGLLQLHVVLKQ 385

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.353 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 26,887,705
Number of extensions: 1087293
Number of successful extensions: 5443
Number of sequences better than 10.0: 259
Number of HSP's gapped: 5682
Number of HSP's successfully gapped: 264
Length of query: 295
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 186
Effective length of database: 40,982,805
Effective search space: 7622801730
Effective search space used: 7622801730
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 65 (29.6 bits)