Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D12584g5.528ON57957926230.0
KAFR0C054005.528ON4815896327e-75
TDEL0A039205.528ON4663205643e-65
Kpol_1023.975.528ON5913914753e-51
NDAI0C010605.528ON6373434342e-45
SAKL0G04950g5.528ON5673854312e-45
KNAG0B036805.528ON4823334183e-44
CAGL0H04631g5.528ON5884164191e-43
KLTH0G03784g5.528ON5693783924e-40
Smik_13.1445.528ON6393433893e-39
Skud_13.1475.528ON6653463771e-37
NCAS0H025605.528ON5873723742e-37
YML007W (YAP1)5.528ON6501923202e-30
Suva_13.1555.528ON6452013132e-29
KLLA0A01760g5.528ON5831713112e-29
Kwal_47.186315.528ON584652766e-25
Kpol_1004.225.528ON4751832702e-24
TPHA0D023405.528ON5062942604e-23
TBLA0G009305.528ON6081752501e-21
NDAI0H016105.528ON5193872091e-16
NCAS0F011005.528ON4753701991e-15
TPHA0K005205.528ON560811973e-15
TBLA0D016405.528ON599611922e-14
Ecym_40645.528ON426711741e-12
CAGL0F03069g5.528ON486801732e-12
ADR195C5.528ON288891471e-09
YDR423C (CAD1)5.528ON409801491e-09
Smik_4.6985.528ON393801383e-08
KNAG0C032105.528ON384801357e-08
KAFR0E032905.528ON265821329e-08
Suva_2.600singletonOFF382491242e-06
Smik_8.332.493ON33177830.15
Suva_8.432.493ON33077810.26
SAKL0E02420g2.493ON32299800.36
Skud_8.362.493ON33272780.52
CAGL0M10087g2.493ON36872780.61
KNAG0C056802.493ON35972780.64
YHL009C (YAP3)2.493ON33062770.70
NDAI0B018002.493ON44664761.2
KLTH0D05918g2.493ON31061741.9
Ecym_24302.493ON30864722.7
YPR199C (ARR1)na 1ON29455722.8
Skud_5.1413.522ON87453724.3
CAGL0K02585g2.493ON36874714.7
Kwal_26.78482.493ON29173705.5
ABR018C2.493ON28258697.6
KAFR0D034202.493ON273100688.3
Kpol_416.95.718ON41097698.3
NOTE: 1 genes in the same pillar as ZYRO0D12584g were not hit in these BLAST results
LIST: Skud_4.697

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D12584g
         (579 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]...  1014   0.0  
KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa] ...   248   7e-75
TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {O...   221   3e-65
Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON} (2250...   187   3e-51
NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.5...   171   2e-45
SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {...   170   2e-45
KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.5...   165   3e-44
CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {...   166   1e-43
KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {...   155   4e-40
Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007...   154   3e-39
Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007...   149   1e-37
NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {O...   148   2e-37
YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic...   127   2e-30
Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007...   125   2e-29
KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON} unipro...   124   2e-29
Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007...   110   6e-25
Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {O...   108   2e-24
TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {O...   104   4e-23
TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.5...   100   1e-21
NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {O...    85   1e-16
NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {O...    81   1e-15
TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5....    80   3e-15
TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.5...    79   2e-14
Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar t...    72   1e-12
CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {...    71   2e-12
ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON} ...    61   1e-09
YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}...    62   1e-09
Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1...    58   3e-08
KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.5...    57   7e-08
KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.52...    55   9e-08
Suva_2.600 Chr2 complement(1070824..1071000,1071004..1071024,107...    52   2e-06
Smik_8.33 Chr8 complement(67646..68641) [996 bp, 331 aa] {ON} YH...    37   0.15 
Suva_8.43 Chr8 complement(86607..87599) [993 bp, 330 aa] {ON} YH...    36   0.26 
SAKL0E02420g Chr5 complement(192871..193839) [969 bp, 322 aa] {O...    35   0.36 
Skud_8.36 Chr8 complement(72120..73118) [999 bp, 332 aa] {ON} YH...    35   0.52 
CAGL0M10087g Chr13 (1005238..1006344) [1107 bp, 368 aa] {ON} som...    35   0.61 
KNAG0C05680 Chr3 complement(1096585..1097664) [1080 bp, 359 aa] ...    35   0.64 
YHL009C Chr8 complement(84068..85060) [993 bp, 330 aa] {ON}  YAP...    34   0.70 
NDAI0B01800 Chr2 (429150..430490) [1341 bp, 446 aa] {ON} Anc_2.4...    34   1.2  
KLTH0D05918g Chr4 (526400..527332) [933 bp, 310 aa] {ON} some si...    33   1.9  
Ecym_2430 Chr2 (837395..838321) [927 bp, 308 aa] {ON} similar to...    32   2.7  
YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}  ...    32   2.8  
Skud_5.141 Chr5 (212966..215590) [2625 bp, 874 aa] {ON} YER032W ...    32   4.3  
CAGL0K02585g Chr11 complement(233972..235078) [1107 bp, 368 aa] ...    32   4.7  
Kwal_26.7848 s26 (539163..540038) [876 bp, 291 aa] {ON} YHL009C ...    32   5.5  
ABR018C Chr2 complement(425339..426187) [849 bp, 282 aa] {ON} Sy...    31   7.6  
KAFR0D03420 Chr4 complement(673634..674455) [822 bp, 273 aa] {ON...    31   8.3  
Kpol_416.9 s416 complement(32320..33552) [1233 bp, 410 aa] {ON} ...    31   8.3  

>ZYRO0D12584g Chr4 complement(1064627..1066366) [1740 bp, 579 aa]
           {ON} weakly similar to uniprot|P19880 YML007W
           Saccharomyces cerevisiae YAP1 bZip transcription factor
           required for oxidative stress tolerance
          Length = 579

 Score = 1014 bits (2623), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/579 (86%), Positives = 502/579 (86%)

Query: 1   MSTTSAKRPLEPTVSLDFAEDEADDSPTSDEXXXXXXXXXXXXLDSEAKSKRTAQNRAAQ 60
           MSTTSAKRPLEPTVSLDFAEDEADDSPTSDE            LDSEAKSKRTAQNRAAQ
Sbjct: 1   MSTTSAKRPLEPTVSLDFAEDEADDSPTSDEPRKKGGKPGRKPLDSEAKSKRTAQNRAAQ 60

Query: 61  RAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVTELKRYRPENPNDSQVL 120
           RAFR             VHALEELNQQSLVETEFLRSQLVTLVTELKRYRPENPNDSQVL
Sbjct: 61  RAFRERKEKKMKELEDKVHALEELNQQSLVETEFLRSQLVTLVTELKRYRPENPNDSQVL 120

Query: 121 QYLAKTXXXXXXXXXXXXXXXXXXXXXXXVRRKMSFTFAFPWKNEFNNDHRNSEDKGNLS 180
           QYLAKT                       VRRKMSFTFAFPWKNEFNNDHRNSEDKGNLS
Sbjct: 121 QYLAKTENSKSDDSSQNKKDSESKEIEESVRRKMSFTFAFPWKNEFNNDHRNSEDKGNLS 180

Query: 181 SHGEQQRSKQQHDNNNILMQFXXXXXXXXXXXXXXXXXXXXNGLSTPSNGDGIRKGSTGN 240
           SHGEQQRSKQQHDNNNILMQF                    NGLSTPSNGDGIRKGSTGN
Sbjct: 181 SHGEQQRSKQQHDNNNILMQFPSPGSSSKSSSQSSSSLKPKNGLSTPSNGDGIRKGSTGN 240

Query: 241 NSSINQTNGSISSSNGFTPGSTSTGWMDNVFYNDDARQLPQFYQSNNNNENSRLFEDNTT 300
           NSSINQTNGSISSSNGFTPGSTSTGWMDNVFYNDDARQLPQFYQSNNNNENSRLFEDNTT
Sbjct: 241 NSSINQTNGSISSSNGFTPGSTSTGWMDNVFYNDDARQLPQFYQSNNNNENSRLFEDNTT 300

Query: 301 MPGDYDSVTFSNQFNFNDKFDEQVSEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPKSPI 360
           MPGDYDSVTFSNQFNFNDKFDEQVSEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPKSPI
Sbjct: 301 MPGDYDSVTFSNQFNFNDKFDEQVSEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPKSPI 360

Query: 361 VFSNTWDTPSEDPQQQLPTLEENLSDPSIRQTNAYSNTXXXXXXXXXIVVSMNSPEKNSE 420
           VFSNTWDTPSEDPQQQLPTLEENLSDPSIRQTNAYSNT         IVVSMNSPEKNSE
Sbjct: 361 VFSNTWDTPSEDPQQQLPTLEENLSDPSIRQTNAYSNTDGGDGDDEGIVVSMNSPEKNSE 420

Query: 421 LPFIDTSLAFPEEQDLFREQQPDNMFAEFIEHDPQRDTTNGNEGNTSPDQDEFLASGMVQ 480
           LPFIDTSLAFPEEQDLFREQQPDNMFAEFIEHDPQRDTTNGNEGNTSPDQDEFLASGMVQ
Sbjct: 421 LPFIDTSLAFPEEQDLFREQQPDNMFAEFIEHDPQRDTTNGNEGNTSPDQDEFLASGMVQ 480

Query: 481 EEPAVTTGEVKDNTNDNVKDGKIQDEGKEAPNSDVVVPSSDGKLLKCSEVWDRITSHPKY 540
           EEPAVTTGEVKDNTNDNVKDGKIQDEGKEAPNSDVVVPSSDGKLLKCSEVWDRITSHPKY
Sbjct: 481 EEPAVTTGEVKDNTNDNVKDGKIQDEGKEAPNSDVVVPSSDGKLLKCSEVWDRITSHPKY 540

Query: 541 SDMDIDGLCQELMAKAKCSERGVVVQAEDVQYALNNRVE 579
           SDMDIDGLCQELMAKAKCSERGVVVQAEDVQYALNNRVE
Sbjct: 541 SDMDIDGLCQELMAKAKCSERGVVVQAEDVQYALNNRVE 579

>KAFR0C05400 Chr3 complement(1082243..1083688) [1446 bp, 481 aa]
           {ON} Anc_5.528 YDR423C
          Length = 481

 Score =  248 bits (632), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 206/589 (34%), Positives = 288/589 (48%), Gaps = 126/589 (21%)

Query: 3   TTSAKRPLEPTVSLDFAEDEADDSPTSDEXXXXXXXXXXXXLDSEAKSKRTAQNRAAQRA 62
           T S KRPLE T S D   D+ +  P  +             LD EAK KRTAQNRAAQRA
Sbjct: 5   TASTKRPLESTTSTDNDTDDKNAIPKKN----NASKSSRTELDQEAKLKRTAQNRAAQRA 60

Query: 63  FRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVTELKRYRPENPNDSQVLQY 122
           FR             V  L  + +Q+ +E+EFLRSQL+TLV ELK+YRPE  NDSQVL Y
Sbjct: 61  FRERKERKMKELEAKVDHLSNIQKQNEIESEFLRSQLITLVKELKKYRPETANDSQVLNY 120

Query: 123 LAKTXXXXXXXXXXXXXXXXXXXXXXXVRRKMSFTFAFPWKNEFNNDHRNSEDKGNLSSH 182
           LAK                        + +K +F+FAFPW     +D+  + DK + + +
Sbjct: 121 LAK---------------HENGNFNENLSKKSNFSFAFPW-----DDNNATTDKSD-NLN 159

Query: 183 GEQQRSKQQHDNNNILMQFXXXXXXXXXXXXXXXXXXXXNGLSTPSNGDGIRKGSTGNNS 242
                +    DN+ +                        +  + PS+   I   +  NN+
Sbjct: 160 TTTNNNIPSPDNSPV--------------------TASNDKKNYPSSVSSIEPLNQNNNN 199

Query: 243 SINQTNGSISSSNGFTPGSTSTGWMDNVFYNDDA--RQLPQFYQSNNNNENSRLFEDNTT 300
           +I+  + S+  ++G +P   S  W+DN+ + +D    QL  F    +N   SR   + + 
Sbjct: 200 NISSLSPSLDDNDGISP---SINWLDNMLHTEDLFNEQLSSF----SNTPISRNDSNESK 252

Query: 301 MPGDYDSVTFSNQFNFNDKFDEQVSEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPKSPI 360
            P   DS   SN+FNF D+FDE+V++FC K+ QVCGT+  PIP+K  S+   P+   +P+
Sbjct: 253 NPM-TDSQLISNEFNFEDQFDEKVTDFCIKMNQVCGTRSNPIPKKSTSNL--PSTESTPL 309

Query: 361 VFSNTWDTPSEDPQQQLPTLEENLSDPSIRQTNAYSNTXXXXXXXXXIVVSMNSPEKNSE 420
            F+NT+D+PS   Q  +  +E   SD +   T                     +P+ N  
Sbjct: 310 -FTNTFDSPSFG-QLNIQNIESTNSDNTNNDT---------------------TPDDNGI 346

Query: 421 LPFIDTSLAFPEEQDLFREQQPDNMFAEFIEHDPQ-----------RDTTNGNEGNTSPD 469
             F++ SLAFP          P+N  ++   ++             RDT+          
Sbjct: 347 FSFLNPSLAFPSST------SPENSLSDGSINNNIDNNNNSSLNNFRDTSIF-------- 392

Query: 470 QDEFLASGMVQEEPAVTTGEVKDNTNDNVKDGKIQDEGKEAPNSDVVVPSSDGKLLKCSE 529
            D+FL     + EP+V     +D  N+ + D  I D          VVPS D  LL+CSE
Sbjct: 393 -DDFLKH---EAEPSV-----EDLINEEIDD--IND----------VVPSKDKNLLRCSE 431

Query: 530 VWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQYALNNRV 578
           VWDRIT+HPKYSD+DIDGLC ELMAKAKCSE+GVVV AEDVQ AL+  +
Sbjct: 432 VWDRITAHPKYSDIDIDGLCGELMAKAKCSEKGVVVNAEDVQSALSKHL 480

>TDEL0A03920 Chr1 complement(703498..704898) [1401 bp, 466 aa] {ON}
           Anc_5.528 YDR423C
          Length = 466

 Score =  221 bits (564), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 131/320 (40%), Positives = 175/320 (54%), Gaps = 75/320 (23%)

Query: 265 GWMDNVFYNDDARQLPQFYQSNNNNENSRLFEDNTTMPGDYDSVTFSNQFNFNDKFDEQV 324
           GWMDNVFY+DDA++LPQF              D+T  P       FSN+FNF+D+FDEQV
Sbjct: 216 GWMDNVFYSDDAQKLPQFAIKG----------DSTADP------LFSNEFNFDDQFDEQV 259

Query: 325 SEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPKSPIVFSNTWDTPSEDPQQQLPTLEENL 384
           S+FCTK+ + CGT++CPIP       +SP V  SP + +N+WDT +       P   +  
Sbjct: 260 SQFCTKMNKACGTRECPIP-GFTPQMASPQV-ASPQILTNSWDTVAS------PAFGQQS 311

Query: 385 SDPSIRQTNAYSNTXXXXXXXXXIVVSMNSPEKNSELPFIDTSLAFPEEQD---LFREQQ 441
             PS +Q                      +P    ELPFID ++AFP + D    FR  +
Sbjct: 312 LAPSKKQLT-------------------KTPPSQPELPFIDPTMAFPTDDDEGLFFRTHR 352

Query: 442 PDN-MFAEFIEHDPQRDTTNGNEGNTSPDQDEFLASGMVQEEPAVTTGEVKDNTNDNVKD 500
            +N +FAE ++                P  + F+   ++ EEP+ TT             
Sbjct: 353 DENSLFAELLDE-------------VEPTDNNFVNENLINEEPSTTTA------------ 387

Query: 501 GKIQDEGKEAPNSDV-VVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCS 559
             + +E +  P ++  VVPS DGKLLKCSEVWDRIT+HPKYS +DIDGLC ELM KAKCS
Sbjct: 388 --VAEETRPKPKTETDVVPSRDGKLLKCSEVWDRITTHPKYSAIDIDGLCGELMTKAKCS 445

Query: 560 ERGVVVQAEDVQYALNNRVE 579
           E+GVVVQAEDVQ  L+  ++
Sbjct: 446 EKGVVVQAEDVQRVLDKHMD 465

 Score =  112 bits (279), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/121 (49%), Positives = 72/121 (59%), Gaps = 10/121 (8%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           LD E K+KRTAQNRAAQRAFR             V +LE+ N+ ++VE+EFLRSQL+TLV
Sbjct: 54  LDEETKNKRTAQNRAAQRAFRERKEKKMKELEDKVQSLEQANRDTVVESEFLRSQLLTLV 113

Query: 104 TELKRYRPENPNDSQVLQYLAKTXXXXXXXXXXXXXXXXXXXXXXXVRRKMSFTFAFPWK 163
            ELK+YRP   ND QVL YLAK                        V++KM FTFAFPWK
Sbjct: 114 NELKKYRPAKANDLQVLDYLAK----------HERTEPTDKEIEQSVQKKMDFTFAFPWK 163

Query: 164 N 164
           +
Sbjct: 164 D 164

>Kpol_1023.97 s1023 (225050..226825) [1776 bp, 591 aa] {ON}
           (225050..226825) [1776 nt, 592 aa]
          Length = 591

 Score =  187 bits (475), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 141/391 (36%), Positives = 182/391 (46%), Gaps = 103/391 (26%)

Query: 265 GWMDNVFYNDDARQLPQFYQSN------------NNNENSRLFEDN------TTMPGDYD 306
           GWMDNVFY DDA+ LP F  S+            NN+ NS   EDN      + +   YD
Sbjct: 226 GWMDNVFYKDDAQNLPHFDTSSTSTNTAFRDSPVNNSINSIKLEDNLKNNNNSALTVGYD 285

Query: 307 SVTFSNQFNFNDKFDEQVSEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPKSPIVFSNTW 366
           S  FSN FNF+D FD+QVS FC K+ Q CGTK  P+P+    S  S   P S    S T 
Sbjct: 286 SDLFSNDFNFDDHFDQQVSSFCVKMNQACGTKQNPVPKTMAESNKSQKTPPSEGNPSTTP 345

Query: 367 DTPSEDPQQQLPTLEE--------------NLSDPSIRQTNAYSN--------------- 397
           +  S D    +   ++               L  PS+  +NA SN               
Sbjct: 346 NESSNDSSLSIAKFDDPNFLFDSPSNDFTNTLDIPSVDSSNANSNFGQLGFHGLSNDITF 405

Query: 398 -----------------------TXXXXXXXXXIVVSM----NSPEKNSELPFIDTSLAF 430
                                  T         I +S     NSP K   LPFIDTS+AF
Sbjct: 406 NSNDSNWNDFISLKTDSMTSVPTTSSVATNDHPINISKPSEENSPRK-EVLPFIDTSIAF 464

Query: 431 PEEQDLFREQQPDNMFAEFIEHDPQ---RDTTNGNEGNTSPDQDEFLASGMVQEEPAVTT 487
           PE +            A+F   D Q   RD       N S   D+ + +    E+     
Sbjct: 465 PETK------------ADFDAFDNQMFFRDDGFNESLNIS---DDIVGAESDDEQDNNND 509

Query: 488 GEVKDNTNDNVKDGKIQDEGKEAPNSDVVVPSSDGKLLKCSEVWDRITSHPKYSDMDIDG 547
            ++       +    + +E KE    D+V+P+SDGKLLKCSEVWDRIT+HP+YSD+DIDG
Sbjct: 510 NDL-------ISKNLVCEEVKE---HDMVIPTSDGKLLKCSEVWDRITAHPRYSDIDIDG 559

Query: 548 LCQELMAKAKCSERGVVVQAEDVQYALNNRV 578
           LCQELM  AKCS++GVVV ++DVQ AL+N +
Sbjct: 560 LCQELMHNAKCSDKGVVVDSKDVQKALSNHM 590

 Score = 95.1 bits (235), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 50/117 (42%), Positives = 66/117 (56%), Gaps = 11/117 (9%)

Query: 45  DSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVT 104
           D E K+KRTAQNRAAQRAFR             VH LE++ QQ+ VE+EFLR+QL  ++ 
Sbjct: 53  DHEVKNKRTAQNRAAQRAFRERKERKMKELEDKVHELEKVKQQNDVESEFLRNQLTLMID 112

Query: 105 ELKRYRPENPNDSQVLQYLAKTXXXXXXXXXXXXXXXXXXXXXXXVRRKMSFTFAFP 161
           ELK+YRPE  +D +VL+YLAK                        ++RK  F+F +P
Sbjct: 113 ELKKYRPEKSSDIKVLEYLAK-----------HEENGSTEKIKKNIQRKEDFSFEYP 158

>NDAI0C01060 Chr3 (206067..207980) [1914 bp, 637 aa] {ON} Anc_5.528
           YDR423C
          Length = 637

 Score =  171 bits (434), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 121/343 (35%), Positives = 164/343 (47%), Gaps = 80/343 (23%)

Query: 302 PGDYDSVTFSNQFNFNDKFDEQVSEFCTKLGQVCGTKDCPIPQKQKSSYSSP-------- 353
           P   DS   SN F+FNDKFDEQVS+FC K+   CGT+  PIP K KS+ S+P        
Sbjct: 300 PPIEDSNLISNSFDFNDKFDEQVSDFCGKMSMACGTRSNPIP-KSKSNVSTPQSIMNSNN 358

Query: 354 AVPKSP-----------IVFSNTWDTPSEDPQQ---------QLPTLEENLSDPSIRQTN 393
             P SP           I  SN +D  S  PQ           +P+   N +D S     
Sbjct: 359 KSPISPLNDSTLAKSNVITTSNIFDHQSNTPQAINSNLTNTWGIPSASPNSNDSSPNNIV 418

Query: 394 AYSNTXXXXXXXXXIVVSMNSPE--------------------KNSELPFIDTSLAFPEE 433
              +          +   M+SP+                    K   LPFI+ +LAFP +
Sbjct: 419 PTQDNSNVNMNFGQLGFMMDSPQFQNIDLSLPIENDKFSASNFKKPSLPFINPTLAFPND 478

Query: 434 QDLFRE--------------QQPDNMFAEFIEHDPQRDTTNGNEGNTSPD--------QD 471
            DLF +                  ++ ++F+ +D     +  N  N+  D        + 
Sbjct: 479 -DLFNKNNSNNDNNNNTTTTHDESDLLSQFLANDYSNTISTNNLMNSDDDEDEDDDDYEK 537

Query: 472 EFLASGMVQEEPAVTTGEVKDNTNDNVKDGKIQDEGKEAPNSDVVVPSSDGKLLKCSEVW 531
           + +A+ ++ EEP+ T      N N+N+     + E  +    D +VPS DG LL+CSE+W
Sbjct: 538 KLVANNLINEEPSST------NKNNNLTSTSKEQENNDF--DDFIVPSRDGGLLRCSEIW 589

Query: 532 DRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQYAL 574
           DRIT+HPKYS++DIDGLC ELM KAKCSERGVVV AEDVQ AL
Sbjct: 590 DRITAHPKYSELDIDGLCSELMTKAKCSERGVVVNAEDVQMAL 632

 Score = 89.7 bits (221), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 56/80 (70%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           LD EA++KRTAQNRAAQRAFR             V  L ++ +Q+ +E+EFLRSQL+TLV
Sbjct: 72  LDPEARNKRTAQNRAAQRAFRERKERKMKELEEKVANLTKIQKQNEIESEFLRSQLITLV 131

Query: 104 TELKRYRPENPNDSQVLQYL 123
            ELK+Y+P N N S+VL Y+
Sbjct: 132 NELKKYKPNNENASKVLNYI 151

>SAKL0G04950g Chr7 complement(409365..411068) [1704 bp, 567 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 567

 Score =  170 bits (431), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 133/385 (34%), Positives = 181/385 (47%), Gaps = 73/385 (18%)

Query: 234 RKGSTGNNSSINQTNGSISSSNGFTPGSTSTGWMDNVFYNDDARQLPQFYQSNNNNENSR 293
            K S  +N+  N TN         TP STS+  +D +FY DDA  LP+F  S+    N  
Sbjct: 207 HKPSFSSNAPFNATNN--------TP-STSSASLD-MFYQDDA--LPKFTSSSLERGN-- 252

Query: 294 LFEDNTTMPGDYDSVTFSNQFNFNDKFDEQVSEFCTKLGQVCGTKDCPIPQ--------- 344
               N+    D    + +N F+F   FDEQVSEFCT++ Q CGT+D P+PQ         
Sbjct: 253 ----NSGTIADA-GFSITNDFDFESHFDEQVSEFCTRMNQACGTRDSPVPQTLSNQSSST 307

Query: 345 ------------------------KQKSSYSSPAVPKSPIVFSNTWDTPSED-----PQQ 375
                                     +   ++ + P++ +  +NTW+TPS          
Sbjct: 308 TTPITMTTTTRHDTATAPAPAPALAPEEPNAASSSPQAGLNLTNTWETPSFGNLGFGGDG 367

Query: 376 QLPTLEENLSDPSIRQTNAYSNTXXXXXXXXXIVVSMNSPEKNSE-LPFIDTSLAFPEEQ 434
                 +     +   +N +  T            + N+P  +++ LPFIDTS+AFP EQ
Sbjct: 368 DSHGNGDGHGHGNGDDSNKWLFTSDLGPSPG--AAAANTPSNSADILPFIDTSIAFPTEQ 425

Query: 435 D--LFREQQPDN---MFAEFIEHDPQRDTTNGNEGNTSPDQDEFLASGMVQEEPAVTTGE 489
           +  +FR+   +N   +F EF+E DP        E       +++ A       P    G 
Sbjct: 426 NELVFRDTAANNSSTVFDEFLEEDPVVHQLTTEESVYDVFSNDYGAKKGKPFSPEENKG- 484

Query: 490 VKDNTNDNVKDGKIQDEGKEAPNSDVVVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLC 549
                  N     +  E      SD VVPS DGKLLKC E+WDRITSHPKYSD+DIDGLC
Sbjct: 485 -------NYTTLPLSQESSNPLVSDDVVPSRDGKLLKCGEIWDRITSHPKYSDLDIDGLC 537

Query: 550 QELMAKAKCSERGVVVQAEDVQYAL 574
            EL  KAKCSE+GVVV A+DVQ AL
Sbjct: 538 MELRTKAKCSEKGVVVNADDVQKAL 562

 Score =  105 bits (262), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/135 (42%), Positives = 73/135 (54%), Gaps = 14/135 (10%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           L +EAK+KRTAQNRAAQRAFR             V  LE + +Q+ VETEFLRSQL+TL+
Sbjct: 54  LGTEAKNKRTAQNRAAQRAFRERKERKMKELEDKVTHLETVREQNEVETEFLRSQLMTLI 113

Query: 104 TELKRYRPENPNDSQVLQYLAKT--------------XXXXXXXXXXXXXXXXXXXXXXX 149
           +ELK+YRPE   D+QVL+YLAK                                      
Sbjct: 114 SELKKYRPEQSMDTQVLEYLAKREEEKKDNSQDRSGGSANTSEEGADVSHSSSESHIRDN 173

Query: 150 VRRKMSFTFAFPWKN 164
           +++KM FTF FPWK+
Sbjct: 174 IQKKMDFTFEFPWKD 188

>KNAG0B03680 Chr2 (707204..708652) [1449 bp, 482 aa] {ON} Anc_5.528
           YDR423C
          Length = 482

 Score =  165 bits (418), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 123/333 (36%), Positives = 161/333 (48%), Gaps = 58/333 (17%)

Query: 264 TGWMDNVFYNDDARQLPQFYQSNNNNENSRLFEDNTTMPGDYDSVTFSNQFNFNDKFDEQ 323
           T W+D V  + +     Q  Q   N   S        + G  DS+T SN+  F+ +FDEQ
Sbjct: 189 TDWLDEVLSSTELYAKQQQQQLQGNRSESPF------LAGYDDSLTVSNEITFDTQFDEQ 242

Query: 324 VSEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPKSPIVF---SNTWDTPSEDPQQQLPTL 380
           VS+FC ++ + CG+K  P+P+ +K S  S +V   P +    SNTW T            
Sbjct: 243 VSDFCVRMNEACGSKTNPVPKSKKGSVFSNSVLSPPSLLNSLSNTWGT------------ 290

Query: 381 EENLSDPSIRQTNAYSNTXXXXXXXXXIVVSMNSPEKNS-------ELPFIDTSLAFPEE 433
                     +T+A S T            S      N        E+PFI+TSLAFP +
Sbjct: 291 ---------DRTDAGSATSETTSPRLTESSSSTVTTNNDLKLDADFEIPFINTSLAFPTD 341

Query: 434 QDLFREQQPDNMFAEFIEHDPQRDTTNGNEGNTSPDQDEFLASGMVQEEPAVTTGEVKDN 493
                +   DN+F    +H+ QR              D+FL    + +       E K N
Sbjct: 342 DGAVPQTVDDNIFFRDTQHE-QRSAL-----------DDFLEEEELTDNQQQQQHEEKIN 389

Query: 494 TNDNVKDGKIQDEGKEAP-----NSD---VVVPSSDGKLLKCSEVWDRITSHPKYSDMDI 545
              N     I+ + KE P     N D    VVPS DGKLLKCSE+WDRIT+HPKYSD+DI
Sbjct: 390 LLINEVPFSIEAD-KEVPFSIEPNEDGDPQVVPSKDGKLLKCSEIWDRITAHPKYSDLDI 448

Query: 546 DGLCQELMAKAKCSERGVVVQAEDVQYALNNRV 578
           DGLC ELM KAKCSERGVVV A+DV+ ALN  +
Sbjct: 449 DGLCGELMTKAKCSERGVVVNADDVKDALNRHI 481

 Score =  100 bits (249), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 82/175 (46%), Gaps = 19/175 (10%)

Query: 1   MSTTSAKRPLEPTVSLDFAED---EADDSPTSDEXXXXXXXXXXXXLDSEAKSKRTAQNR 57
           M+ T A   + P V  D   D   E  DS    E            LD EA+ KRT QNR
Sbjct: 1   MAATVASAMVTPEVHADRGRDRDLEVVDS--GAEPLKKRTHTASKPLDKEARMKRTEQNR 58

Query: 58  AAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVTELKRYRPENPNDS 117
           AAQRAFR             V  L  + +Q+ VE+EFLR QLVTLV ELK+YRPE  NDS
Sbjct: 59  AAQRAFRERKERKMKELEAKVDKLTRIQKQNEVESEFLRGQLVTLVHELKKYRPETSNDS 118

Query: 118 QVLQYLAKTXXXXXXXXXXXXXXXXXXXXXXXVRRKMSFTFAFPWKN----EFNN 168
           +VL+YLAK                         R +  F+F FPWK     EF+N
Sbjct: 119 KVLEYLAK----------HDNVPPNQQGQAPAARDRGDFSFEFPWKGRTAPEFDN 163

>CAGL0H04631g Chr8 complement(442448..444214) [1767 bp, 588 aa] {ON}
           similar to uniprot|P19880 Saccharomyces cerevisiae
           YML007w YAP1
          Length = 588

 Score =  166 bits (419), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 139/416 (33%), Positives = 189/416 (45%), Gaps = 97/416 (23%)

Query: 259 PGSTSTGWMDNVFYNDDARQLPQFYQSNNNNENSRLFEDNTTMPGDY-DSVTFSNQ---- 313
           PG+TS+    N    +  +Q      S+++NE+   +  + T   D+ D V  S++    
Sbjct: 173 PGNTSSSTTANSVAANAKKQSIPHSDSSDSNESKNTWNTDPTSSEDWLDDVMTSHKQISR 232

Query: 314 ------FNFNDKFDEQVSEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPKS--------- 358
                  +FN+ FDEQVSEFCTKL Q CGTK CPIPQ  KS+ ++P    S         
Sbjct: 233 GQSGSGIDFNNFFDEQVSEFCTKLNQACGTKACPIPQ-SKSAATTPLPGTSSNGNSNSPM 291

Query: 359 ----------------------------PIVFSNTWDTPSEDPQQ----------QLPTL 380
                                       P   SNTWD  S    Q          QL   
Sbjct: 292 IINDTMGDVSLNMQGNEHGNATNNLVTDPAFLSNTWDDMSPASNQHSTGGAPGFGQLGFG 351

Query: 381 EENLSDPSIRQTN--AYSNTXXXXXXXXXI--------VVSMNSPEKNSELPFIDTSLAF 430
           +  L +  +   N  AYS +         +        VV   +  K+   PFI++SLAF
Sbjct: 352 DNLLGNDILFSPNSPAYSPSVLGSGRTQEVYRSPAVQKVVEKENESKSVNFPFINSSLAF 411

Query: 431 PEEQD--LFRE--QQPDNMFAEFIEHDPQRDTTNGNEGNTSPDQD----EFLASGMVQEE 482
           P + D   FRE      +   +        D  N       PD D      +A+G+V+EE
Sbjct: 412 PGDYDNNFFRETTDLNFDDNDQDDNFTNSNDLVNDYFTTNIPDTDNSDSALIANGLVKEE 471

Query: 483 PAVTTGEV--KDNTNDNVKDGKI------QDEGKEAPNSD------------VVVPSSDG 522
           P++ T +     NTND +   ++      Q+ G++    D             VVPS D 
Sbjct: 472 PSMQTEDTFKVQNTNDMLNSSRMKETIDNQNIGEKTTKDDNEDDDEDDENDNTVVPSRDD 531

Query: 523 KLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQYALNNRV 578
            LL+CSE+WDRIT+HPKYSD+DIDGLC ELMAKAKCSERGVV+ A+DVQ ALN  +
Sbjct: 532 GLLRCSEIWDRITAHPKYSDIDIDGLCSELMAKAKCSERGVVINADDVQVALNKHM 587

 Score = 79.3 bits (194), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 49/82 (59%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           LD E + KR AQNRAAQ+AFR             V  LE L + + VET FLR QL  LV
Sbjct: 23  LDPETRMKRVAQNRAAQKAFRERKERKMKELERKVVDLENLTKLNEVETNFLRDQLSILV 82

Query: 104 TELKRYRPENPNDSQVLQYLAK 125
            EL++YRPE   D +VL+YL K
Sbjct: 83  KELRKYRPETKQDHKVLKYLEK 104

>KLTH0G03784g Chr7 complement(300734..302443) [1710 bp, 569 aa] {ON}
           weakly similar to uniprot|P19880 YML007W Saccharomyces
           cerevisiae YAP1 bZip transcription factor required for
           oxidative stress tolerance
          Length = 569

 Score =  155 bits (392), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 122/378 (32%), Positives = 166/378 (43%), Gaps = 116/378 (30%)

Query: 262 TSTGWMDNVFYNDDA---RQLPQFYQSNNNNENSRLFEDNTTMPGDYDSVTFSNQFNFND 318
           TS+G +D  F  D A   + LP+F  S + N             GD+D         FN 
Sbjct: 238 TSSGSLD--FLGDSASNTQSLPKFPTSESGN-------------GDFD---------FNT 273

Query: 319 KFDEQVSEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPK--SPI---------------- 360
            FDEQVS FCT++ +VCGT++CP+PQ    S ++   P+  SPI                
Sbjct: 274 HFDEQVSVFCTQMNEVCGTRECPLPQALPPSTAASVTPRPISPIQEEQPELSKPAQAKIP 333

Query: 361 ---VF---------SNTWDTP----------SEDPQQQ--LPTLEENLSDPSIRQTNAYS 396
               F          N WD+P          +EDP  +   P         ++R  +A  
Sbjct: 334 AADAFLKQAQQQQPPNAWDSPQFGHSGFGMGTEDPTNRWLFPDFSSGNMSSTVRAPSA-- 391

Query: 397 NTXXXXXXXXXIVVSMNSPEKNSELPFIDTSLAFPEEQ-DLFREQQPDNMFAEFIEHDPQ 455
                               K   +PFIDTS+AFP +Q D    Q  D++  +F E DP 
Sbjct: 392 --------------------KIDSVPFIDTSMAFPTDQPDALLPQNSDDVLNQFFEEDPI 431

Query: 456 RDTTNGNEGNTSPDQDEFLASGMVQEEPAVTTGEVKDNTNDN------------------ 497
                  E N  P + +   S     +   +   V   +ND+                  
Sbjct: 432 VSQLTTEESNYDPFKPDLQPSA----DSETSKHSVSSCSNDSDPSRAESNASTALTEPNY 487

Query: 498 -VKDGKIQDEGKEAPNSDVVVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKA 556
            +    +      A ++DVV P+ DG LLKCSE+WDRIT+HPKYSD+DIDGLC EL  KA
Sbjct: 488 TIDKTSVPSAVLAAEDADVV-PARDGLLLKCSEIWDRITAHPKYSDIDIDGLCMELRTKA 546

Query: 557 KCSERGVVVQAEDVQYAL 574
           KCSE+GVVV ++DVQ AL
Sbjct: 547 KCSEKGVVVNSDDVQSAL 564

 Score = 92.4 bits (228), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 60/83 (72%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           LD+EAK+KRTAQNRAAQRAFR             V  LE++ +QS +E+EFLRSQL  L+
Sbjct: 30  LDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLEKVREQSEMESEFLRSQLQMLI 89

Query: 104 TELKRYRPENPNDSQVLQYLAKT 126
            E+++YRP+  +DSQVL+YLA+ 
Sbjct: 90  AEIQKYRPQQSSDSQVLKYLAEA 112

>Smik_13.144 Chr13 (242566..244485) [1920 bp, 639 aa] {ON} YML007W
           (REAL)
          Length = 639

 Score =  154 bits (389), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 116/343 (33%), Positives = 161/343 (46%), Gaps = 71/343 (20%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           LD E K KRTAQNRAAQRAFR             V +LE + QQ+ VE  FLR QLVTLV
Sbjct: 62  LDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLVTLV 121

Query: 104 TELKRYRPENPNDSQVLQYLAK------TXXXXXXXXXXXXXXXXXXXXXXXVRRKMSFT 157
            ELK+YRPE  NDS+VL+YLAK      +                       V++KM+FT
Sbjct: 122 NELKKYRPETRNDSKVLEYLAKRDPNLHSSSIKANHNNSRPIITPNDEIQENVKQKMNFT 181

Query: 158 FAFPWKNEFNNDHRNSEDKGNLSSHGEQQRSKQQHDNNNILMQFXXXXXXXXXXXXXXXX 217
           F +P     +ND   +++K       E+Q       N+++ +                  
Sbjct: 182 FQYP----LDNDSDENKNK-------ERQLPSPNDPNHSVSIPIAQK------------- 217

Query: 218 XXXXNGLSTPSNGDGIRKGSTGNNSSINQTNGSISSSNGF---TPGSTST-GWMDNVFYN 273
                           +K S+    S + T  S+S+SN     TP S+S+  W+DNV Y 
Sbjct: 218 ----------------QKKSSNTTDSSSATLDSLSNSNDVLNNTPNSSSSMDWLDNVIYT 261

Query: 274 DDARQLPQFYQSNNNNENSRLFEDNTTMPGDYDSVTFSNQFNFNDKFDEQVSEFCTKLGQ 333
           +      +F   ++  +             + DS  FSN FNF ++FDEQVSEFC+K+ Q
Sbjct: 262 N------KFVSGDDGCKRE---------TKNVDSNLFSNDFNFENQFDEQVSEFCSKMNQ 306

Query: 334 VCGTKDCPIPQKQKSSYSSPAVPKSPIV------FSNTWDTPS 370
           VCGT+ CPIP+K  S+        S I+       +NTW++ S
Sbjct: 307 VCGTRQCPIPKKPVSTLDKEVFASSSILSANSPSLTNTWESHS 349

 Score =  128 bits (322), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 76/186 (40%), Positives = 103/186 (55%), Gaps = 29/186 (15%)

Query: 420 ELPFIDTSLAFPEEQDL------FREQQPDNMF-AEFIEHDPQRDTTN------------ 460
           ++PFI+ +LAFP+E           E Q  N F  +    D  ++  N            
Sbjct: 455 DIPFINANLAFPDENSTNIQLQPISESQSQNKFDYDMFFRDSSKEGNNLFEEFLEEDDDD 514

Query: 461 ---GNEG--NTSPDQDEFLASGMVQEEPAVTTGEVKDNTNDNVKDGKIQD---EGKEAPN 512
              GN+   NTS D+   + + ++ EEP  T     ++     KD  +Q+         N
Sbjct: 515 DDDGNKKAYNTSDDESSLIKNQLINEEPQSTLKNESESAQR--KDSYVQEAIDNNNGNGN 572

Query: 513 SDVVVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQY 572
            + VVPS +G LL+CSE+WDRIT+HPKYSD+D+DGLC ELMAKAKCSERGVV+ AEDVQ 
Sbjct: 573 DNDVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVINAEDVQL 632

Query: 573 ALNNRV 578
           ALN  +
Sbjct: 633 ALNKHM 638

>Skud_13.147 Chr13 (240056..242053) [1998 bp, 665 aa] {ON} YML007W
           (REAL)
          Length = 665

 Score =  149 bits (377), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 121/346 (34%), Positives = 155/346 (44%), Gaps = 80/346 (23%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           LD E K KRTAQNRAAQRAFR             V  LE + QQ+ VE  FLR QLVTLV
Sbjct: 62  LDPETKQKRTAQNRAAQRAFRERKERKMMELEKKVQGLENIQQQNEVEATFLRDQLVTLV 121

Query: 104 TELKRYRPENPNDSQVLQYLAK------TXXXXXXXXXXXXXXXXXXXXXXXVRRKMSFT 157
            ELK+YRPE  NDS+VL+YLA       T                       VR+KM+FT
Sbjct: 122 NELKKYRPETRNDSKVLEYLASRDPNLPTSNNSTNSSSNRPIITPSEEIQENVRQKMNFT 181

Query: 158 FAFPWKNEFNNDHRNSEDK---GNLSSHGEQQRSKQQHDNNNILMQFXXXXXXXXXXXXX 214
           F +      +ND +N E +    N  SH                                
Sbjct: 182 FQY----ALDNDSKNLEKQLPSPNDPSH-------------------------------- 205

Query: 215 XXXXXXXNGLSTPSNGDGIRKGSTGNNSSINQTNGSISSSNGF---TPGSTST-GWMDNV 270
                     S P      +K S+    S   T  S+S+S+     TP S+S+  W+DNV
Sbjct: 206 ----------SAPIPTTQAQKKSSDATDSSTATLDSLSNSHDVLNNTPNSSSSMDWLDNV 255

Query: 271 FYNDDARQLPQFYQSNNNNENSRLFEDNTTMPGDYDSVTFSNQFNFNDKFDEQVSEFCTK 330
            Y +      +F       + S+L   N       DS  FSN FNF ++FDEQVSEFC+K
Sbjct: 256 IYTN------RFVAG---GDGSKLEVKNV------DSNMFSNNFNFENQFDEQVSEFCSK 300

Query: 331 LGQVCGTKDCPIPQKQKSSYSSPAVPKSPIV------FSNTWDTPS 370
           + QVCGT+ CPIP+K  S+        S I+       +NTW++ S
Sbjct: 301 MNQVCGTRQCPIPKKPVSTLDQEVFASSSILSANSPALTNTWESHS 346

 Score =  102 bits (254), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 78/153 (50%), Gaps = 41/153 (26%)

Query: 432 EEQDLFREQ------QPDNMFAEFIEHDPQRDTTNGNEGNTSPDQDEFLASGMVQEEPAV 485
           +E  L R Q      QP N  +          ++  NE  TSP  +    SG  Q     
Sbjct: 547 DESSLIRNQLINEEPQPLNQNSL---------SSLNNEKETSPKTN----SGGTQNANDS 593

Query: 486 TTGEVKDNTNDNVKDGKIQDEGKEAPNSDVVVPSSDGKLLKCSEVWDRITSHPKYSDMDI 545
              +                        + VVPS +G LL+CSE+WDRIT+HPKYSD+D+
Sbjct: 594 DGNDN----------------------DNDVVPSKEGSLLRCSEIWDRITTHPKYSDIDV 631

Query: 546 DGLCQELMAKAKCSERGVVVQAEDVQYALNNRV 578
           DGLC ELMAKAKCSERGVV+ AEDVQ ALN  +
Sbjct: 632 DGLCSELMAKAKCSERGVVINAEDVQLALNKHM 664

>NCAS0H02560 Chr8 complement(509179..510942) [1764 bp, 587 aa] {ON}
           Anc_5.528 YDR423C
          Length = 587

 Score =  148 bits (374), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 122/372 (32%), Positives = 180/372 (48%), Gaps = 66/372 (17%)

Query: 256 GFTPGSTSTGWMDNVFYNDDA--RQLPQFYQSNNNNENSRLFEDNTTMPGDYDSVTFSNQ 313
           G T   TS  W DN+F NDD   +QL     + N N+N+     NT++    D    +N 
Sbjct: 224 GTTNNKTSLEWFDNMFNNDDLFNQQLLSLSNTANANKNTTTTATNTSLLQLDDPNLITNN 283

Query: 314 FNFNDKFDEQVSEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPKSP-------------- 359
           F+  DKFDEQVS+FC K+   CGT+  P+P K KS+ S+P    S               
Sbjct: 284 FDVTDKFDEQVSDFCGKMNMACGTRYDPVP-KSKSNTSTPQNNNSSLLSPPSNSKQIANQ 342

Query: 360 -----------IVFSNTWD--TPSEDPQQQLPTLEENLSDPSIRQ-TNAYSNTXXXXXXX 405
                      +  +NT+D  +P + PQQQ     + L  P+  Q  +A+          
Sbjct: 343 SNLFNLNTPPNLNITNTFDFNSPLDSPQQQNQAFGQ-LGMPNSPQFLSAFELPTENSIQK 401

Query: 406 XXIVVSMNSPEKNSELPFIDTSLAFPEEQDLFREQ----------------QPDNMFAEF 449
                   + +K+  LPFI++SLAFP + D+F                   +  ++ ++F
Sbjct: 402 QPQQQQPMASKKSPTLPFINSSLAFPTD-DIFNNTISNNNNNSNTNGPLFNESSSLLSDF 460

Query: 450 IEHDPQRDTTNGNEGNTSPDQDEFLASGMVQEE-------PAVTTGEVKDNTNDNVKDGK 502
           I ++   + ++ +    S   ++ +   ++ +E       PA T+           +D  
Sbjct: 461 IRNE-DGNVSDSDNDADSDFDNDLINKNLINQEISNPVLAPAPTSVPASTAATAAPEDED 519

Query: 503 IQDEGKEAPNSDVVVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERG 562
                    + + +VPS DG LL+CSE+WDRI++HPKYSD+DIDGLC ELM KAKCSERG
Sbjct: 520 ---------DDEFIVPSRDGGLLRCSEIWDRISAHPKYSDLDIDGLCSELMTKAKCSERG 570

Query: 563 VVVQAEDVQYAL 574
           VVV AEDVQ AL
Sbjct: 571 VVVNAEDVQLAL 582

 Score = 99.8 bits (247), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 80/144 (55%), Gaps = 19/144 (13%)

Query: 1   MSTTSAKRPLE--PTVSLDFAED-----EADDSPTSD------------EXXXXXXXXXX 41
           MSTT+AKRPLE  P   L FA+      E +   T D                       
Sbjct: 1   MSTTTAKRPLELDPNSRLQFAQSKEQQQELERYSTEDAGSRKKQEVSGTSNAAATTNMTK 60

Query: 42  XXLDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVT 101
             LD EAK+KRTAQNRAAQRAFR             V+ L ++ +Q+ +E+EFLR QL+T
Sbjct: 61  KQLDIEAKNKRTAQNRAAQRAFRERKERKMKELEEKVNNLTKIQKQNEIESEFLRGQLIT 120

Query: 102 LVTELKRYRPENPNDSQVLQYLAK 125
           LV ELK+YR  NPN+S+VL+YL++
Sbjct: 121 LVNELKKYRDPNPNESKVLEYLSQ 144

>YML007W Chr13 (253848..255800) [1953 bp, 650 aa] {ON}  YAP1Basic
           leucine zipper (bZIP) transcription factor required for
           oxidative stress tolerance; activated by H2O2 through
           the multistep formation of disulfide bonds and transit
           from the cytoplasm to the nucleus; mediates resistance
           to cadmium
          Length = 650

 Score =  127 bits (320), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 72/192 (37%), Positives = 105/192 (54%), Gaps = 37/192 (19%)

Query: 420 ELPFIDTSLAFPEEQDLFREQQP-----------------------DNMFAEFIEHDPQR 456
           ++PFI+ +LAFP++     + QP                       +N+F EF+E     
Sbjct: 462 DIPFINANLAFPDDNSTNIQLQPFSESQSQNKFDYDMFFRDSSKEGNNLFGEFLE----D 517

Query: 457 DTTNGNEGNTSPDQDEFLASGMVQEEPAV----------TTGEVKDNTNDNVKDGKIQDE 506
           D  +    N S D+   + + ++ EEP +             E+      ++++    + 
Sbjct: 518 DDDDKKAANMSDDESSLIKNQLINEEPELPKQYLQSVPGNESEISQKNGSSLQNADKINN 577

Query: 507 GKEAPNSDVVVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQ 566
           G +  N + VVPS +G LL+CSE+WDRIT+HPKYSD+D+DGLC ELMAKAKCSERGVV+ 
Sbjct: 578 GNDNDNDNDVVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAKCSERGVVIN 637

Query: 567 AEDVQYALNNRV 578
           AEDVQ ALN  +
Sbjct: 638 AEDVQLALNKHM 649

 Score = 99.4 bits (246), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 67/125 (53%), Gaps = 6/125 (4%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           LD E K KRTAQNRAAQRAFR             V +LE + QQ+ VE  FLR QL+TLV
Sbjct: 62  LDPETKQKRTAQNRAAQRAFRERKERKMKELEKKVQSLESIQQQNEVEATFLRDQLITLV 121

Query: 104 TELKRYRPENPNDSQVLQYLAKT------XXXXXXXXXXXXXXXXXXXXXXXVRRKMSFT 157
            ELK+YRPE  NDS+VL+YLA+                              V++KM+FT
Sbjct: 122 NELKKYRPETRNDSKVLEYLARRDPNLHFSKNNVNHSNSEPIDTPNDDIQENVKQKMNFT 181

Query: 158 FAFPW 162
           F +P 
Sbjct: 182 FQYPL 186

 Score = 77.8 bits (190), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/131 (39%), Positives = 71/131 (54%), Gaps = 25/131 (19%)

Query: 250 SISSSNGF---TP-GSTSTGWMDNVFYNDDARQLPQFYQSNNNNENSRLFEDNTTMPGDY 305
           S+S+SN     TP  STS  W+DNV Y +        + S ++  NS+          + 
Sbjct: 236 SLSNSNDVLNNTPNSSTSMDWLDNVIYTNR-------FVSGDDGSNSKT--------KNL 280

Query: 306 DSVTFSNQFNFNDKFDEQVSEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPKSPI----- 360
           DS  FSN FNF ++FDEQVSEFC+K+ QVCGT+ CPIP+K  S+        S I     
Sbjct: 281 DSNMFSNDFNFENQFDEQVSEFCSKMNQVCGTRQCPIPKKPISALDKEVFASSSILSSNS 340

Query: 361 -VFSNTWDTPS 370
              +NTW++ S
Sbjct: 341 PALTNTWESHS 351

>Suva_13.155 Chr13 (244425..246362) [1938 bp, 645 aa] {ON} YML007W
           (REAL)
          Length = 645

 Score =  125 bits (313), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 112/201 (55%), Gaps = 50/201 (24%)

Query: 420 ELPFIDTSLAFPEEQ--------------------DLF---REQQPDNMFAEFIEHDPQR 456
           ++PFI+TSLAFP++                     D+F     ++ +N+F EF+E D   
Sbjct: 452 DIPFINTSLAFPDDNPTNIQLQPLSQSQHQNKFDYDMFFRDSSKEGNNLFEEFLEEDDDD 511

Query: 457 DTTNGNEG--------NTSPDQDEFLASGMVQEEPAVTT----------GEVKDNTND-N 497
           D  +GN+G        N S D+   + + ++ EEP   +           EV  N N  N
Sbjct: 512 DDDDGNDGNDNDGEAVNASDDESNLIKNKLINEEPQQQSQCHLSTPKNGSEVLQNKNSSN 571

Query: 498 VKDGKIQDEGKEAPNSDVVVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAK 557
            +D  + D   E      VVPS +G LL+CSE+WDRIT+HPKYSD+D+DGLC ELMAKAK
Sbjct: 572 SED--VNDNDNE------VVPSKEGSLLRCSEIWDRITTHPKYSDIDVDGLCSELMAKAK 623

Query: 558 CSERGVVVQAEDVQYALNNRV 578
           CSERGVV+ AEDVQ ALN  +
Sbjct: 624 CSERGVVINAEDVQLALNKHM 644

 Score =  106 bits (264), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/136 (44%), Positives = 77/136 (56%), Gaps = 6/136 (4%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           LD E K KRTAQNRAAQRAFR             VH+LE + Q++ VE  FLR QLVTLV
Sbjct: 62  LDPETKLKRTAQNRAAQRAFRERKERKMKELEKKVHSLESIQQENEVEATFLRDQLVTLV 121

Query: 104 TELKRYRPENPNDSQVLQYLAKTXXXXXXXXXXXXXXXX-----XXXXXXXVRRKMSFTF 158
           +ELK+YRPE  NDS+VL+YLA+                             V++KM+FTF
Sbjct: 122 SELKKYRPETRNDSKVLEYLARRDPNLHPPNSNTNNNSEPIVTPNDDIQKNVKQKMNFTF 181

Query: 159 AFPWKNEFNNDHRNSE 174
            +P  N+ +ND +N E
Sbjct: 182 QYPLDND-DNDGKNME 196

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 72/122 (59%), Gaps = 18/122 (14%)

Query: 257 FTPGSTST-GWMDNVFYNDDARQLPQFYQSNNNNENSRLFEDNTTMPGDYDSVTFSNQFN 315
            TP S+S+  W+DNV Y +  + +    Q N +NE+        + P   DS  FSN FN
Sbjct: 243 ITPNSSSSMDWLDNVMYTN--KFVAGGDQKNASNESK-------SKPKGVDSNMFSNDFN 293

Query: 316 FNDKFDEQVSEFCTKLGQVCGTKDCPIPQKQ-----KSSYSSPAV--PKSPIVFSNTWDT 368
           F ++FDEQVSEFC+K+ Q CGTK CPIP+K      K  ++S +V    SP V +NTWD+
Sbjct: 294 FENQFDEQVSEFCSKMNQACGTKQCPIPKKSVHQLDKEVFASSSVLSANSP-VLTNTWDS 352

Query: 369 PS 370
            S
Sbjct: 353 HS 354

>KLLA0A01760g Chr1 (154859..156610) [1752 bp, 583 aa] {ON}
           uniprot|P56095 Kluyveromyces lactis KLLA0A01760g YAP1
           AP- 1-like transcription factor
          Length = 583

 Score =  124 bits (311), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 71/171 (41%), Positives = 96/171 (56%), Gaps = 45/171 (26%)

Query: 417 KNSELPFIDTSLAFPEEQD----LFREQQPDNMFAEFIEHDPQRDTTNGNEGNTSPDQDE 472
           +N E+PFIDT LAFP+  D    + +E+Q +                   EG++ P Q  
Sbjct: 440 QNPEIPFIDTGLAFPDYDDPLLDILKEEQENEQV----------------EGDSDPIQ-- 481

Query: 473 FLASGMVQEEPAV---------TTGEVKDNTNDNVKDGKIQDEGKEAPNSDVVVPSSDGK 523
                ++ EEP++             V +    + ++  +QD          ++PS+DGK
Sbjct: 482 ----ALINEEPSMPLCHDPAANAGASVSETDKLSNQEEIVQD----------IIPSNDGK 527

Query: 524 LLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQYAL 574
           LLKCSEVWDRIT+HP+YSD+DIDGLC EL  KAKCSE+GVVV AEDVQ AL
Sbjct: 528 LLKCSEVWDRITAHPRYSDLDIDGLCLELRTKAKCSEKGVVVNAEDVQKAL 578

 Score = 90.9 bits (224), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 84/174 (48%), Gaps = 12/174 (6%)

Query: 1   MSTTSAKRPLE------PTVSLDFAEDEADDSPTSDEXXXXXXXXXXXXLDSEAKSKRTA 54
           MST++AKRP +      P    D ++   ++S +S              L++EAK KRTA
Sbjct: 1   MSTSTAKRPFDNKRAGSPDDGTD-SDSGGNNSGSSPASKRRERKPGRKPLETEAKDKRTA 59

Query: 55  QNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVTELKRYRPENP 114
           QNRAAQRAFR             V  LE LN+QS +ET+FLR+Q+  L++ELKRY PE P
Sbjct: 60  QNRAAQRAFRERRERKMKELEDKVSQLESLNKQSELETKFLRNQVTNLLSELKRYNPELP 119

Query: 115 N--DSQVLQYLAKTXXXXXXXXXXXXXXXXXXXXXXXVRRKMS---FTFAFPWK 163
              DS +L YLAK                            +S   F F FPWK
Sbjct: 120 KKRDSILLDYLAKQRKASIDSNPDFSAAANKAANSKDSSTAISSSNFQFEFPWK 173

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 26/35 (74%)

Query: 310 FSNQFNFNDKFDEQVSEFCTKLGQVCGTKDCPIPQ 344
            +++F+F+ +FDE VS FC+KL   CGTK  PIP+
Sbjct: 247 VTSEFDFDSQFDESVSSFCSKLSMACGTKSNPIPK 281

>Kwal_47.18631 s47 (904593..906347) [1755 bp, 584 aa] {ON} YML007W
           (YAP1) - jun-like transcription factor [contig 192] FULL
          Length = 584

 Score =  110 bits (276), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 48/65 (73%), Positives = 53/65 (81%)

Query: 514 DVVVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQYA 573
           D VVP+ DG LLKCSEVWDRITSHPKYSD+DIDGLC EL  KAKCSE+GVVV  +DVQ A
Sbjct: 519 DAVVPARDGTLLKCSEVWDRITSHPKYSDIDIDGLCLELRTKAKCSEKGVVVNIDDVQRA 578

Query: 574 LNNRV 578
           L   +
Sbjct: 579 LTKHM 583

 Score = 89.7 bits (221), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/82 (54%), Positives = 57/82 (69%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           LD+EAK+KRTAQNRAAQRAFR             V  LE + +QS +E+EFLRSQL  L+
Sbjct: 30  LDTEAKNKRTAQNRAAQRAFRERKERKMRELEEQVERLERVREQSELESEFLRSQLQKLL 89

Query: 104 TELKRYRPENPNDSQVLQYLAK 125
            E+++YRP   +DSQVL +LAK
Sbjct: 90  AEIQKYRPRQSSDSQVLNFLAK 111

>Kpol_1004.22 s1004 complement(45952..47379) [1428 bp, 475 aa] {ON}
           complement(45952..47379) [1428 nt, 476 aa]
          Length = 475

 Score =  108 bits (270), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 65/183 (35%), Positives = 99/183 (54%), Gaps = 33/183 (18%)

Query: 412 MNSPEKNSELPFIDTSLAFPEEQD-------------LFREQQPDNMFAEFIEHDPQRDT 458
           M+SP+  +  P ID SLAFP   +             LFR+     M  +F++  P ++ 
Sbjct: 301 MDSPD--NSFPLIDASLAFPNNSNSNRNNNNNNNNNVLFRDISTAEM--QFMDESPLQNV 356

Query: 459 TNGNEGNTSPDQDEFLASGMVQEEPA-VTTGEVKDNTNDNVKDGKIQ------DEGKEAP 511
              +E              ++ EEP+   +  V    N+NV    +        E  +  
Sbjct: 357 EFNSED---------AIKRLISEEPSPHYSNSVPHLHNNNVNSASLHPLTVLVQEPDDEL 407

Query: 512 NSDVVVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQ 571
           + DVVVPS+D +L++CSE+WDRIT++P+Y+D+DIDGLC+ELM  AKCS++GVVV ++DV 
Sbjct: 408 DEDVVVPSTDSQLMRCSEIWDRITTNPRYTDLDIDGLCEELMFSAKCSDKGVVVASKDVH 467

Query: 572 YAL 574
             L
Sbjct: 468 KVL 470

 Score = 87.0 bits (214), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 60/81 (74%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           +D+EA+ +RTAQNRAAQRAFR             V++LE ++Q++ VETEFLRSQ++TLV
Sbjct: 39  IDAEARIRRTAQNRAAQRAFRERKEKKMKELENKVNSLENIHQKNEVETEFLRSQVLTLV 98

Query: 104 TELKRYRPENPNDSQVLQYLA 124
            ELK+YR E  +DS++L+ ++
Sbjct: 99  NELKKYRSETTSDSKILKLVS 119

>TPHA0D02340 Chr4 complement(483713..485233) [1521 bp, 506 aa] {ON}
           Anc_5.528 YDR423C
          Length = 506

 Score =  104 bits (260), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 88/294 (29%), Positives = 140/294 (47%), Gaps = 69/294 (23%)

Query: 306 DSVTFSNQFNFNDKFDEQVSEFCTKLGQVCGTKDCPIPQKQKSSYSSPAVPKSPIVFSNT 365
           DS  FS +F+F ++FDEQVS FC K+ +    +   I Q     + +  V        N+
Sbjct: 260 DSNLFSTEFDFANEFDEQVSTFCAKMNKTFENRKEMIKQ-----FYTEKV-------RNS 307

Query: 366 WDTPSEDPQQQLP--TLEENLSDPSIRQTNAYSNTXXXXXXXXXIVVSMNSPEKNSEL-- 421
            + P     +Q P  TL+ N+                              P  ++++  
Sbjct: 308 NNKPRTVSIKQEPTTTLQANI-----------------------------QPSDSNDVTE 338

Query: 422 PFIDTSLAFPEEQDL--------FREQQPDNM-FAEF---IEHDPQRDTTN---GNEGNT 466
             +  S+AFPE+ ++        F +Q  +N+ + +    I   P    TN    NE N 
Sbjct: 339 SLVAASIAFPEQYNMVKSDSLYNFLKQNNNNIGYGDVRGNISTQPNSIMTNNLSNNEQNY 398

Query: 467 SPDQD-EFLASGMVQEEPAVTTGEVKD-NTNDNVKDGKIQDEGKEAPNSDVVVPSSDGKL 524
           +  +D +F+ S         T  E  +    D+  DG  +  G+  P +D       G+L
Sbjct: 399 NFSKDAQFIVSQQNTVRNIQTANEYPNIYETDDSSDGGDEVVGQIVPLTD-------GRL 451

Query: 525 LKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQYALNNRV 578
           L+C E+WDRIT++P+YSD+DIDGLC+ELMA AKCS++GV+V ++DVQ  L+ R+
Sbjct: 452 LECGEIWDRITTYPRYSDIDIDGLCEELMASAKCSDKGVLVSSDDVQKVLSRRL 505

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 47/72 (65%)

Query: 45  DSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVT 104
           +++ + KR AQNRAAQ+AFR             V  LE +N+++ +ET FLR+QL++LV 
Sbjct: 15  NADYRMKRIAQNRAAQKAFRERKEKKMKELQEKVRKLENINEKNEIETVFLRTQLLSLVN 74

Query: 105 ELKRYRPENPND 116
           ELK+YR +  +D
Sbjct: 75  ELKKYRIDKNDD 86

>TBLA0G00930 Chr7 (226547..228373) [1827 bp, 608 aa] {ON} Anc_5.528
           YDR423C
          Length = 608

 Score =  100 bits (250), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 66/175 (37%), Positives = 93/175 (53%), Gaps = 23/175 (13%)

Query: 421 LPFIDTSLAFPE-----------EQDLFR--EQQPDNMFAEFIEHDPQRDTTNGNEGNTS 467
           +PFIDTSLAF +              LF+   +  D+ F +F+  +        N    +
Sbjct: 431 IPFIDTSLAFNDIPTNLSNDNEFNMQLFKTNRKSSDDDFFKFLMDEDNDILNGNNNSTEN 490

Query: 468 PDQDEFLASGMVQEEPAVTTGEVKDNTNDNVKDGKIQDEGKEAPNSD-------VVVPSS 520
            + +  + + ++ E PAV + ++         D        + PN D       ++    
Sbjct: 491 NEDNNSILNNLINETPAVESTQLAQTPR--ASDSAHTSPIVQTPNKDPSISVMSIIREED 548

Query: 521 DGK-LLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQYAL 574
            GK  ++CSEVWDRITSHPKYSD+DIDGLC ELM KAKCSE+GVVV+A+DVQ AL
Sbjct: 549 KGKNYMQCSEVWDRITSHPKYSDLDIDGLCTELMHKAKCSEKGVVVKADDVQKAL 603

 Score = 89.4 bits (220), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 43/80 (53%), Positives = 57/80 (71%)

Query: 45  DSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVT 104
           D EAKSKRTAQNRAAQRAFR             V +LEE++++S +E++FLR QL  L+ 
Sbjct: 46  DQEAKSKRTAQNRAAQRAFRERRERKMQELEDKVKSLEEVHKKSEIESQFLRDQLKVLLG 105

Query: 105 ELKRYRPENPNDSQVLQYLA 124
           EL+RYRPE  ND++V +YL+
Sbjct: 106 ELQRYRPERQNDAKVKEYLS 125

 Score = 31.2 bits (69), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 11/21 (52%), Positives = 15/21 (71%)

Query: 266 WMDNVFYNDDARQLPQFYQSN 286
           W++NV Y +D  +LPQF  SN
Sbjct: 207 WVENVLYKEDNEELPQFKMSN 227

>NDAI0H01610 Chr8 complement(390369..391928) [1560 bp, 519 aa] {ON}
           Anc_5.528 YDR423C
          Length = 519

 Score = 85.1 bits (209), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 105/387 (27%), Positives = 166/387 (42%), Gaps = 90/387 (23%)

Query: 237 STGNNSS------INQTN--------GSISSSNGFTPGSTSTGWMDNVFYNDDARQLPQF 282
           +T NNSS      INQ N        G  + S+       +  WMDNVF N+ A  LP F
Sbjct: 170 TTNNNSSFSNKYDINQVNDSNNVPIDGGGTDSHAVGTNIPNKNWMDNVFENNIAEGLPPF 229

Query: 283 YQSNN-----NNENSRLFEDNTTMPGDY--DSVTFSNQFNFNDKFDEQVSEFC----TKL 331
             +++     N  N     +N    G+   +S+ FSN FNFN++FDE V+       ++ 
Sbjct: 230 LNNDDPEKIANMNNHTDTNNNLLTTGNLLDNSLMFSNDFNFNNQFDEHVTNLLADSLSRF 289

Query: 332 GQVCGTKDCPIPQKQKSSYSSPAVPKSPIVFSNTWDTPSEDPQQQLPTLEENLSDPSIRQ 391
                  D  I  K  SS +SPA     ++ +NTWDT +       P+L+   +D     
Sbjct: 290 PSDGNHHDSNIISKSNSSLTSPA---QSLMLTNTWDTNNS------PSLDGIDTD----- 335

Query: 392 TNAYSNTXXXXXXXXXIVVSMNSPEKNSELPFIDTSLAFPE---EQDLFREQ------QP 442
            N Y N          + V           P ID++LAFP    E DLF ++        
Sbjct: 336 NNIYVNDDSNKDTASIMNVR----------PIIDSTLAFPSTMTENDLFAQRYGTMQSSS 385

Query: 443 DNMFAEFIEHDPQRDTTNGNEGNTSPDQDE--FLASGMVQEEPAVTTGEVKDNTNDNVKD 500
            ++    ++    +  T  ++ N+  ++ E   L+  ++ +E   +              
Sbjct: 386 SSLSESAMQLGDDKKCTCNDQCNSDDEEIECELLSRNLLNDESMKS-------------- 431

Query: 501 GKIQDEGKEAPNSDVVVPSSDG----KLLKCSEVWDRIT--------SHPKYSDMDIDGL 548
             I  E +  P S+V     +G    +  KCS++W+RI         S P++ D DID L
Sbjct: 432 --IIKEKQTRP-SNVAPSCCNGGYGNRFAKCSKIWERINNKMNIETNSGPRFKDSDIDDL 488

Query: 549 CQELMAKAKCSERG-VVVQAEDVQYAL 574
           C ELM KA+CS  G +V++  D++ +L
Sbjct: 489 CNELMTKARCSTNGSIVIKTGDIKQSL 515

 Score = 50.4 bits (119), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 35/47 (74%)

Query: 78  VHALEELNQQSLVETEFLRSQLVTLVTELKRYRPENPNDSQVLQYLA 124
           + +LE++  ++ +ET FLRS +  L+ E+ ++RP+N  DS++L+YL+
Sbjct: 8   ISSLEKIKDENSIETSFLRSYMTDLINEVNKFRPKNTTDSKILKYLS 54

>NCAS0F01100 Chr6 complement(218116..219543) [1428 bp, 475 aa] {ON}
           Anc_5.528 YDR423C
          Length = 475

 Score = 81.3 bits (199), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 98/370 (26%), Positives = 152/370 (41%), Gaps = 111/370 (30%)

Query: 231 DGIRKGSTGNNSSINQTNGSISSSNGFTPGSTSTGWMDNVFYNDDARQLPQFYQSN---- 286
           +G+R  S  N   IN  +G          G TS+ W+DN+F  D A  LP F  S     
Sbjct: 187 EGLRLPSFSNKYDINSHDGG---------GITSSNWIDNIFDGDTAEGLPSFPASISSSS 237

Query: 287 -----NNNENSRLFEDNTTMPGDYDSVTFSNQFNFNDKFDEQVSEFCTKLGQVCGTKDCP 341
                N N+N     D T    D++ + F+N+F+F+++FD                 D P
Sbjct: 238 ETPPVNANDNDHSHVDFTNNLLDHNMI-FTNEFSFHNQFD-----------------DHP 279

Query: 342 IPQKQKSSYSSPAVPKSPIVFSNTWDTPSEDPQQQLPTLEENLSDPSIRQTNAYSNTXXX 401
           I         +    +   V SNTWD+                        N+  N+   
Sbjct: 280 IIDLTTQQKPTQQQQQQAFVISNTWDS------------------------NSNGNSTDN 315

Query: 402 XXXXXXIVVSMNSPEKNSELPFIDTSLAFP---EEQDLFREQQPDNMFAEFI------EH 452
                    S+     N+  P ID++LAFP    E ++F +Q     + E++      E 
Sbjct: 316 DTQ------SLIGNNINNNNPLIDSNLAFPTDINENEVFVKQ-----YQEYVSQQQPAEQ 364

Query: 453 D----PQRDTTNGNEGNTSPDQDEFLASGMVQEE--PAVTTGEVKDNTNDNVKDGKIQDE 506
           D    P +    G + +    + EF++  ++  E  P++    ++D T+          +
Sbjct: 365 DTITCPCQHADTGADDDDEEIECEFISRNLLNNESIPSI----LRDKTSI---------D 411

Query: 507 GKEAPNSDVVVPSSDGKLLKCSEVWDRI-TSHPKYSDMDIDGLCQELMAKAKCSERG-VV 564
           G  A N          K  KCS +W R  T  PK+SD DID LCQEL+ KAKCS+ G +V
Sbjct: 412 GGMACN----------KYSKCSAIWKRFKTQKPKFSDDDIDSLCQELITKAKCSDEGTIV 461

Query: 565 VQAEDVQYAL 574
           +++ DV+  L
Sbjct: 462 IRSRDVKNTL 471

 Score = 76.6 bits (187), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 52/81 (64%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           LD+ AK++RTAQNRAAQRAFR             +  LE +   + VE+ FLR  ++ L+
Sbjct: 29  LDTAAKNRRTAQNRAAQRAFRERKERKMKELEDKISDLERIKDNNEVESTFLRDYMMDLI 88

Query: 104 TELKRYRPENPNDSQVLQYLA 124
            ++++YRP N  DS+VL+YL+
Sbjct: 89  CDMQKYRPNNSTDSKVLKYLS 109

>TPHA0K00520 Chr11 (102027..103709) [1683 bp, 560 aa] {ON} Anc_5.528
           YDR423C
          Length = 560

 Score = 80.5 bits (197), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 53/81 (65%)

Query: 45  DSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVT 104
           DS+ KSKRT QNR AQRAFR             V ALE++N+   +ET FLRS+L ++  
Sbjct: 37  DSDVKSKRTFQNRNAQRAFRERKERKLKELEDKVLALEQVNEAKELETNFLRSRLKSMAD 96

Query: 105 ELKRYRPENPNDSQVLQYLAK 125
           ELK+YRP   +D +VL+YLAK
Sbjct: 97  ELKKYRPAQSSDLEVLEYLAK 117

 Score = 60.1 bits (144), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 50/94 (53%), Gaps = 20/94 (21%)

Query: 258 TPGST--STGWMDNVFYNDDARQLPQFYQ--------------SNNNNENSRLFEDNT-- 299
           TP S+  S+ W+  VFY D+A+QLPQF Q              S+ N   S +   +   
Sbjct: 224 TPDSSVSSSTWIHPVFYEDNAKQLPQFEQPKAVPTNMDVSPANSDINQSTSDIVPGSAKS 283

Query: 300 --TMPGDYDSVTFSNQFNFNDKFDEQVSEFCTKL 331
              +P  YDS  FSN FNF+DKF +QVS FC K+
Sbjct: 284 FDAIPFGYDSSLFSNDFNFDDKFSDQVSSFCDKV 317

>TBLA0D01640 Chr4 (402610..404409) [1800 bp, 599 aa] {ON} Anc_5.528
           YDR423C
          Length = 599

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 47/61 (77%), Gaps = 1/61 (1%)

Query: 516 VVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQYALN 575
           +VP+ D ++L C+++WDRIT+ PKY+  DI+ LC ELM+KAKCS++GVVV + DV   L 
Sbjct: 529 MVPA-DPEMLPCTKIWDRITALPKYTSADIENLCNELMSKAKCSDKGVVVSSLDVDKVLL 587

Query: 576 N 576
           N
Sbjct: 588 N 588

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 39/64 (60%)

Query: 45  DSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVT 104
           ++E KSKRTAQNRAAQRAFR             V  LE++ +    ET FLRSQL+   T
Sbjct: 29  NAELKSKRTAQNRAAQRAFRERKEKKMKSLEEKVVELEKVCRAHESETSFLRSQLILFGT 88

Query: 105 ELKR 108
           EL++
Sbjct: 89  ELRK 92

>Ecym_4064 Chr4 (141770..143050) [1281 bp, 426 aa] {ON} similar to
           Ashbya gossypii ADR195C
          Length = 426

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 47/71 (66%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           LD+EAK++RTAQNRAAQRAFR             V  LEE   QS  E + LR+Q+V+L+
Sbjct: 50  LDTEAKNRRTAQNRAAQRAFRERKERKMKDLEDKVRKLEEQRLQSEREVQSLRNQVVSLL 109

Query: 104 TELKRYRPENP 114
            ELK+YRP +P
Sbjct: 110 RELKKYRPGSP 120

>CAGL0F03069g Chr6 complement(301650..303110) [1461 bp, 486 aa] {ON}
           some similarities with uniprot|P24813 Saccharomyces
           cerevisiae YDR423c CAD1 transcriptional activator
          Length = 486

 Score = 71.2 bits (173), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 49/80 (61%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           +D+EAK+KRTAQNRAAQRAFR             +  L+ +N +   ETE+L+  L  L+
Sbjct: 17  IDTEAKNKRTAQNRAAQRAFRERKEAKLRALEETIVVLKGMNSKKNSETEYLKECLSELL 76

Query: 104 TELKRYRPENPNDSQVLQYL 123
           TE+ +YRP N  D  +L+ L
Sbjct: 77  TEVTKYRPANEKDQGILKRL 96

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 11/71 (15%)

Query: 519 SSDGK-LLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSE----------RGVVVQA 567
           SS+GK +L+C ++   +     Y  +D + LC ELM KAK S+          R VV++A
Sbjct: 414 SSEGKPVLRCEDICGTVGPSIGYDSLDFENLCAELMNKAKISDDGDGTDIVPKRHVVIKA 473

Query: 568 EDVQYALNNRV 578
            D+Q  L   +
Sbjct: 474 GDLQRTLAKHI 484

>ADR195C Chr4 complement(1041896..1042762) [867 bp, 288 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML007W
           (YAP1) and YDR423C (CAD1)
          Length = 288

 Score = 61.2 bits (147), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 44/89 (49%)

Query: 22  EADDSPTSDEXXXXXXXXXXXXLDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHAL 81
           E  D P   E            LD+EAK++RTAQNRAAQRAFR             V  L
Sbjct: 12  EEQDGPYVGETKRRGNKPGRKPLDTEAKNRRTAQNRAAQRAFRERKERKMRDLEDQVRRL 71

Query: 82  EELNQQSLVETEFLRSQLVTLVTELKRYR 110
           EE    +  E + LR  ++ LV EL+R+R
Sbjct: 72  EEERSSAECEVQSLRGHVIALVRELRRWR 100

>YDR423C Chr4 complement(1318046..1319275) [1230 bp, 409 aa] {ON}
           CAD1AP-1-like basic leucine zipper (bZIP)
           transcriptional activator involved in stress responses,
           iron metabolism, and pleiotropic drug resistance;
           controls a set of genes involved in stabilizing
           proteins; binds consensus sequence TTACTAA
          Length = 409

 Score = 62.0 bits (149), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/80 (43%), Positives = 51/80 (63%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           +DSEAKS+RTAQNRAAQRAFR             V  LE+ + Q+   T+FL   L +L+
Sbjct: 41  IDSEAKSRRTAQNRAAQRAFRDRKEAKMKSLQERVELLEQKDAQNKTTTDFLLCSLKSLL 100

Query: 104 TELKRYRPENPNDSQVLQYL 123
           +E+ +YR +N +D ++L +L
Sbjct: 101 SEITKYRAKNSDDERILAFL 120

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/79 (41%), Positives = 48/79 (60%), Gaps = 6/79 (7%)

Query: 497 NVKDGKIQDEGKEAPNSDVVVPSSDGKLLKCSEVWDRITSHPKYSDMDIDGLCQELMAKA 556
           + K  + Q E  E  +S +    S+GK   C  + + I+S PKYS +DID LC EL+ KA
Sbjct: 331 HTKTIRTQSEAIEHISSAI----SNGKA-SCYHILEEISSLPKYSSLDIDDLCSELIIKA 385

Query: 557 KCSERG-VVVQAEDVQYAL 574
           KC++   +VV+A D+Q AL
Sbjct: 386 KCTDDCKIVVKARDLQSAL 404

>Smik_4.698 Chr4 complement(1238807..1239642,1239673..1240018) [1182
           bp, 393 aa] {ON} YDR423C (REAL)
          Length = 393

 Score = 57.8 bits (138), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/80 (42%), Positives = 52/80 (65%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           +DSEAK++RTAQNRAAQRAFR             +  LE+ + Q+    +FL+S L +L+
Sbjct: 25  VDSEAKNRRTAQNRAAQRAFRDRKEARLKSLLERIELLEQKDAQNKSVIDFLQSSLKSLL 84

Query: 104 TELKRYRPENPNDSQVLQYL 123
           +E+ +YR +N ND ++L +L
Sbjct: 85  SEVTKYRAKNVNDERILAFL 104

 Score = 49.3 bits (116), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/49 (46%), Positives = 32/49 (65%), Gaps = 1/49 (2%)

Query: 527 CSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERG-VVVQAEDVQYAL 574
           C  +   I+S PKYS +DID LC ELM KA+ ++   +VV+A D+Q  L
Sbjct: 340 CCHILKEISSLPKYSSLDIDNLCCELMTKAEFTDDCEIVVRAHDLQTTL 388

>KNAG0C03210 Chr3 (631277..632431) [1155 bp, 384 aa] {ON} Anc_5.528
           YDR423C gene spans a gap in the genome sequence
          Length = 384

 Score = 56.6 bits (135), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 31/80 (38%), Positives = 41/80 (51%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           LD EAK+KRT QNR AQRA+R             + ALE LN  +    E + + L  L+
Sbjct: 23  LDVEAKNKRTQQNRVAQRAYRERKEAKLRTLEHKIAALERLNSYNEDRAELMAAHLRDLL 82

Query: 104 TELKRYRPENPNDSQVLQYL 123
            E  ++R E P D  V + L
Sbjct: 83  GEANKFRGEKPRDKTVRELL 102

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 2/54 (3%)

Query: 527 CSEVWDRITSHPKYSDMDIDGLCQELMAKAK--CSERGVVVQAEDVQYALNNRV 578
           C+ V   +T  P Y + D++ LCQELM K K    +  + V  EDV+ AL   +
Sbjct: 329 CAHVIRTLTQSPHYQENDLEDLCQELMVKCKFDTHDASITVGREDVRSALERHI 382

>KAFR0E03290 Chr5 (653300..654097) [798 bp, 265 aa] {ON} Anc_5.528
           YDR423C
          Length = 265

 Score = 55.5 bits (132), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 44/82 (53%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           LD++AK+KRT QNR AQRAFR             V  L+  N       EFL+  ++TL+
Sbjct: 17  LDADAKNKRTQQNRMAQRAFRERKEAKLKLLENEVDKLQLENLSKAEIIEFLKQNVMTLL 76

Query: 104 TELKRYRPENPNDSQVLQYLAK 125
            E+K YR +   D ++L  + K
Sbjct: 77  GEIKNYRKQTNKDKKLLDTIGK 98

>Suva_2.600 Chr2
           complement(1070824..1071000,1071004..1071024,
           1071028..1071144,1071132..1071362,1071366..1071527,
           1071531..1071734,1071738..1071752,1071756..1071953,
           1071957..1071977) [1146 bp, 382 aa] {OFF} YDR423C
           (PSEUDO)
          Length = 382

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 1/49 (2%)

Query: 527 CSEVWDRITSHPKYSDMDIDGLCQELMAKAKCS-ERGVVVQAEDVQYAL 574
           CS +   I+S PK+S +DID LC ELM KAKCS +  ++VQA  +Q  L
Sbjct: 329 CSHILRHISSIPKHSSLDIDNLCCELMVKAKCSGDCQIMVQAHGLQSVL 377

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 34/59 (57%)

Query: 47  EAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVTE 105
           EAK++RTAQNRAAQ+AFR                LE  + QS V T++L+  L +L+ E
Sbjct: 11  EAKNERTAQNRAAQQAFRNRKEDKWKQLEEKTELLESRDAQSKVATDYLQGSLRSLLLE 69

>Smik_8.33 Chr8 complement(67646..68641) [996 bp, 331 aa] {ON}
           YHL009C (REAL)
          Length = 331

 Score = 36.6 bits (83), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 11/77 (14%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           +  ++K+K+ AQNRAAQ+AFR                L+EL Q  L+E+E  R  L+  +
Sbjct: 142 ISDDSKAKKKAQNRAAQKAFRERKEAR----------LKEL-QDKLLESEKNRQSLLKEI 190

Query: 104 TELKRYRPENPNDSQVL 120
            EL++   E   ++++L
Sbjct: 191 EELRKVNTEINAENRLL 207

>Suva_8.43 Chr8 complement(86607..87599) [993 bp, 330 aa] {ON}
           YHL009C (REAL)
          Length = 330

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 42/77 (54%), Gaps = 11/77 (14%)

Query: 44  LDSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLV 103
           L  ++K+K+ AQNRAAQ+AFR                L+EL +  L+E+E  R  L+  +
Sbjct: 138 LSGDSKAKKKAQNRAAQKAFRERKEAR----------LKEL-EDKLLESEKNRQSLLKEI 186

Query: 104 TELKRYRPENPNDSQVL 120
            EL++   E   ++++L
Sbjct: 187 EELRKANTEINAENRLL 203

>SAKL0E02420g Chr5 complement(192871..193839) [969 bp, 322 aa] {ON}
           some similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009C YAP3 bZIP transcription factor
          Length = 322

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 47/99 (47%), Gaps = 23/99 (23%)

Query: 10  LEPTVSLDFAEDEADDSPTSDEXXXXXXXXXXXXLDSEAKSKRTAQNRAAQRAFRXXXXX 69
           LE  + LD A   +D+ P   +             + E ++++ AQNRAAQRAFR     
Sbjct: 122 LEEKLHLDMAH--SDEKPVKQDNLT----------EKEIQARKKAQNRAAQRAFRERKEA 169

Query: 70  XXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVTELKR 108
                      L+EL ++ L+E+E  R  L+  V +L+R
Sbjct: 170 ----------KLKEL-ERKLMESEQNRESLLKEVEQLRR 197

>Skud_8.36 Chr8 complement(72120..73118) [999 bp, 332 aa] {ON}
           YHL009C (REAL)
          Length = 332

 Score = 34.7 bits (78), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 38/72 (52%), Gaps = 11/72 (15%)

Query: 49  KSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVTELKR 108
           K+K+ AQNRAAQRAFR                L EL Q  L+++E  R  L+  + EL++
Sbjct: 148 KAKKKAQNRAAQRAFRERKEAR----------LREL-QDKLMKSEKNRQSLLKEIKELRK 196

Query: 109 YRPENPNDSQVL 120
              E   ++++L
Sbjct: 197 VNTEINAENRLL 208

>CAGL0M10087g Chr13 (1005238..1006344) [1107 bp, 368 aa] {ON} some
           similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009c transcription factor
          Length = 368

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 39/72 (54%), Gaps = 12/72 (16%)

Query: 51  KRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVTELKRYR 110
           K+ AQNRAAQRAFR                 +EL Q+ + E+E  R QL+  + +L+++ 
Sbjct: 169 KKKAQNRAAQRAFRERKEA----------KFKEL-QRKVRESEIDRDQLLKELEKLRKWN 217

Query: 111 PE-NPNDSQVLQ 121
            E N  + ++LQ
Sbjct: 218 MEINAENRKLLQ 229

>KNAG0C05680 Chr3 complement(1096585..1097664) [1080 bp, 359 aa]
           {ON} Anc_2.493 YHL009C
          Length = 359

 Score = 34.7 bits (78), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 11/72 (15%)

Query: 49  KSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVTELKR 108
           K+++ AQNRAAQ+AFR                L+EL ++ L E+E  R  L+  + +LK+
Sbjct: 149 KARKKAQNRAAQKAFRERKEAR----------LKEL-EEKLAESENSRHDLMLEIGKLKK 197

Query: 109 YRPENPNDSQVL 120
              E   +++VL
Sbjct: 198 LNAEIMLENKVL 209

>YHL009C Chr8 complement(84068..85060) [993 bp, 330 aa] {ON}
           YAP3Basic leucine zipper (bZIP) transcription factor
          Length = 330

 Score = 34.3 bits (77), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 11/62 (17%)

Query: 47  EAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVTEL 106
           ++K+K+ AQNRAAQ+AFR                ++EL Q  L+E+E  R  L+  + EL
Sbjct: 145 DSKAKKKAQNRAAQKAFRERKEAR----------MKEL-QDKLLESERNRQSLLKEIEEL 193

Query: 107 KR 108
           ++
Sbjct: 194 RK 195

>NDAI0B01800 Chr2 (429150..430490) [1341 bp, 446 aa] {ON} Anc_2.493
           YHL009C
          Length = 446

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 32/64 (50%)

Query: 45  DSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVT 104
           + E K+K+ AQNRAAQ+AFR             ++  E+  Q  L E + LR   + +  
Sbjct: 183 EEEIKAKKKAQNRAAQKAFRERKDAKLKELREKLNESEQNRQDLLKEVDSLRKLNMEINA 242

Query: 105 ELKR 108
           E K+
Sbjct: 243 ESKK 246

>KLTH0D05918g Chr4 (526400..527332) [933 bp, 310 aa] {ON} some
           similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009C YAP3 bZIP transcription factor
          Length = 310

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 45  DSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVT 104
           D+ A+ K+ AQNRAAQRAFR             +   E   Q  L + E LR + + ++T
Sbjct: 135 DASARKKK-AQNRAAQRAFRERKEAKMKQLQEQLVTSERDKQSLLRQMEELRERNLKMLT 193

Query: 105 E 105
           E
Sbjct: 194 E 194

>Ecym_2430 Chr2 (837395..838321) [927 bp, 308 aa] {ON} similar to
           Ashbya gossypii ABR018C
          Length = 308

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 32/64 (50%), Gaps = 11/64 (17%)

Query: 45  DSEAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVT 104
           D   K K+ AQNRAAQ+AFR                L+EL +Q L E+E  R  L   + 
Sbjct: 126 DGYVKEKKKAQNRAAQKAFRERKEAR----------LKEL-EQRLKESEENRDALNKEME 174

Query: 105 ELKR 108
           ELK+
Sbjct: 175 ELKK 178

>YPR199C Chr16 complement(938148..939032) [885 bp, 294 aa] {ON}
           ARR1Transcriptional activator of the basic leucine
           zipper (bZIP) family, required for transcription of
           genes involved in resistance to arsenic compounds
          Length = 294

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 13/55 (23%), Positives = 27/55 (49%)

Query: 524 LLKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQAEDVQYALNNRV 578
           LL   ++W  +  HPK +  D++ L  EL   A CS   +++  +      ++++
Sbjct: 240 LLSAMDIWSFMKVHPKVNTFDLEILGTELKKSATCSNFDILISLKHFIKVFSSKL 294

>Skud_5.141 Chr5 (212966..215590) [2625 bp, 874 aa] {ON} YER032W
           (REAL)
          Length = 874

 Score = 32.3 bits (72), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 4/53 (7%)

Query: 342 IPQKQKSSYSSPAVPK-SPIVFSNTWDTPSEDPQQQLP---TLEENLSDPSIR 390
           +P K  + Y+SP +PK SP+ F ++ ++P   P  Q P   + ++ +S PSI+
Sbjct: 508 LPVKDSTPYTSPEIPKRSPLRFKSSANSPDTSPNSQPPDNVSFQQEMSVPSIQ 560

>CAGL0K02585g Chr11 complement(233972..235078) [1107 bp, 368 aa]
           {ON} some similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009c transcription factor
          Length = 368

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 11/74 (14%)

Query: 47  EAKSKRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVTEL 106
           E K+++ AQNRAAQ+AFR                L+EL +  L + E  R  LV  + +L
Sbjct: 193 EIKARKKAQNRAAQKAFRERKEAR----------LKEL-ENKLSDIEKNRDLLVNELEDL 241

Query: 107 KRYRPENPNDSQVL 120
           +R   E   ++++L
Sbjct: 242 RRLNMEINEENRIL 255

>Kwal_26.7848 s26 (539163..540038) [876 bp, 291 aa] {ON} YHL009C
           (YAP3) - bZip DNA binding proteins [contig 55] FULL
          Length = 291

 Score = 31.6 bits (70), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 34/73 (46%)

Query: 51  KRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVTELKRYR 110
           K+ AQNRAAQRAFR             +   E   Q  L + E L+   + +VTE K   
Sbjct: 119 KKKAQNRAAQRAFRERKEAKLKELEEKLIDSERDKQLLLQQMEELKHNNLEVVTENKLLL 178

Query: 111 PENPNDSQVLQYL 123
            +   +SQ  Q++
Sbjct: 179 EKKREESQSHQFV 191

>ABR018C Chr2 complement(425339..426187) [849 bp, 282 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHL009C
           (YAP3)
          Length = 282

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 29/58 (50%), Gaps = 11/58 (18%)

Query: 51  KRTAQNRAAQRAFRXXXXXXXXXXXXXVHALEELNQQSLVETEFLRSQLVTLVTELKR 108
           K+ AQNRAAQ+AFR                L EL +Q L E+E  R  L   V +LKR
Sbjct: 115 KKKAQNRAAQKAFRERKEAR----------LREL-EQKLKESEQNRDALFREVEQLKR 161

>KAFR0D03420 Chr4 complement(673634..674455) [822 bp, 273 aa] {ON}
           Anc_2.493 YHL009C
          Length = 273

 Score = 30.8 bits (68), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 41/100 (41%), Gaps = 25/100 (25%)

Query: 468 PDQDEFLASGMVQEEPAVTTGEVKDNTNDNVKDGKIQDEGKEAPNSDVVVPSSDG-KLLK 526
           P QD+F A+ +         G V+D +N  +K     D              SDG +LL 
Sbjct: 183 PTQDQFFANML--------NGTVRDQSN--LKSVDYMD--------------SDGNRLLT 218

Query: 527 CSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSERGVVVQ 566
              VW+ + S   Y D+DI  + + L    +C+  G   +
Sbjct: 219 IPAVWEYLNSLTNYFDIDIPNVMENLKGHEQCNGFGAAYK 258

>Kpol_416.9 s416 complement(32320..33552) [1233 bp, 410 aa] {ON}
           complement(32320..33552) [1233 nt, 411 aa]
          Length = 410

 Score = 31.2 bits (69), Expect = 8.3,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 48/97 (49%), Gaps = 4/97 (4%)

Query: 466 TSPDQDEFLASGMVQEEPAVTTGEVKDNTND-NVKDGKIQDEGKEAPNSDVVVPSSDGKL 524
           T  DQD+F A+   + E AV TG  KD      + DG+I D   E P  + V P S  K 
Sbjct: 193 TRQDQDKFAANSYNKAEKAVKTGLFKDEILPIQLPDGRIVDT-DEGPRPN-VTPESLSK- 249

Query: 525 LKCSEVWDRITSHPKYSDMDIDGLCQELMAKAKCSER 561
           +K + + D+ T+    +    DG+   L+A+   +E+
Sbjct: 250 IKPAFIKDKGTTTAGNASQVSDGVAGVLLARRSVAEK 286

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.125    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 63,009,958
Number of extensions: 3051644
Number of successful extensions: 16483
Number of sequences better than 10.0: 280
Number of HSP's gapped: 16189
Number of HSP's successfully gapped: 349
Length of query: 579
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 464
Effective length of database: 40,294,809
Effective search space: 18696791376
Effective search space used: 18696791376
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 68 (30.8 bits)