Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D12540g5.526ON54854826710.0
TDEL0A039005.526ON6716887441e-89
SAKL0G04906g5.526ON6086087033e-84
KLTH0G03740g5.526ON6314246031e-69
Kwal_47.186465.526ON6354175926e-68
KLLA0A01782g5.526ON5285455691e-65
Smik_13.1455.526ON7741424292e-44
YML006C (GIS4)5.526ON7741414273e-44
Skud_13.1485.526ON7791414221e-43
Suva_13.1565.526ON7721424212e-43
Ecym_40615.526ON6634194164e-43
NCAS0H025505.526ON7433183991e-40
KNAG0B037105.526ON7111483902e-39
CAGL0K07271g5.526ON7761393885e-39
NDAI0C010705.526ON7571543796e-38
KAFR0C053905.526ON4551313521e-35
TBLA0D016605.526ON8661313433e-33
ADR198C5.526ON5493823233e-31
Kpol_1023.995.526ON551902933e-27
TPHA0K005405.526ON675902454e-21
NDAI0H015905.526ON371862023e-16
NCAS0F010805.526ON379881943e-15
KNAG0C032405.526ON32468960.004
TBLA0G009405.526ON78278940.009
CAGL0J05610g2.201ON1406198733.4
NCAS0B002408.854ON53654697.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D12540g
         (548 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some...  1033   0.0  
TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.5...   291   1e-89
SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some s...   275   3e-84
KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} simila...   236   1e-69
Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {...   232   6e-68
KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {...   223   1e-65
Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {...   169   2e-44
YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON} ...   169   3e-44
Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {...   167   1e-43
Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {...   166   2e-43
Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar t...   164   4e-43
NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.5...   158   1e-40
KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {O...   154   2e-39
CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa] ...   154   5e-39
NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {O...   150   6e-38
KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON} Anc_5...   140   1e-35
TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {O...   136   3e-33
ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}...   129   3e-31
Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa] ...   117   3e-27
TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {...    99   4e-21
NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON}               82   3e-16
NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.5...    79   3e-15
KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}      42   0.004
TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {O...    41   0.009
CAGL0J05610g Chr10 complement(534283..538503) [4221 bp, 1406 aa]...    33   3.4  
NCAS0B00240 Chr2 complement(24051..25661) [1611 bp, 536 aa] {ON}...    31   7.7  

>ZYRO0D12540g Chr4 (1059795..1061441) [1647 bp, 548 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 548

 Score = 1033 bits (2671), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/548 (91%), Positives = 500/548 (91%)

Query: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERK 60
           MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERK
Sbjct: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERK 60

Query: 61  DTKVLIVSIPEDVRRDITLLEYFLGDYLNLDNMEITKLTTSRIYNHENHYVVMDKENNFK 120
           DTKVLIVSIPEDVRRDITLLEYFLGDYLNLDNMEITKLTTSRIYNHENHYVVMDKENNFK
Sbjct: 61  DTKVLIVSIPEDVRRDITLLEYFLGDYLNLDNMEITKLTTSRIYNHENHYVVMDKENNFK 120

Query: 121 NSNFLHFASTNIQTGKGFTGGELAGTTVAAQAEKNISPTESAKFRAGQGLEPSDDTEGDE 180
           NSNFLHFASTNIQTGKGFTGGELAGTTVAAQAEKNISPTESAKFRAGQGLEPSDDTEGDE
Sbjct: 121 NSNFLHFASTNIQTGKGFTGGELAGTTVAAQAEKNISPTESAKFRAGQGLEPSDDTEGDE 180

Query: 181 ESLVFNFTHRDHHLTHPLRANGKEQEEAVGVSPSWNPQQQQRLQEHNASNDEMASIDSYN 240
           ESLVFNFTHRDHHLTHPLRANGKEQEEAVGVSPSWNPQQQQRLQEHNASNDEMASIDSYN
Sbjct: 181 ESLVFNFTHRDHHLTHPLRANGKEQEEAVGVSPSWNPQQQQRLQEHNASNDEMASIDSYN 240

Query: 241 LGSNSSRVVESFKGEPLTLTMTRTEDFXXXXXXXXXXXXXXXXXXXXXXXXXXXLMSILP 300
           LGSNSSRVVESFKGEPLTLTMTRTEDF                           LMSILP
Sbjct: 241 LGSNSSRVVESFKGEPLTLTMTRTEDFSSSDEYDSLASSPSSSDTDLSSFESCSLMSILP 300

Query: 301 SISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNL 360
           SISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNL
Sbjct: 301 SISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNL 360

Query: 361 QMLTLQDLSELNKGCPKVLFYSLVEVVDTPSLEDADTECXXXXXXXXXXXXXXXXXXXXX 420
           QMLTLQDLSELNKGCPKVLFYSLVEVVDTPSLEDADTEC                     
Sbjct: 361 QMLTLQDLSELNKGCPKVLFYSLVEVVDTPSLEDADTECATISNTASTSLSSAPTSTSVS 420

Query: 421 CEPRVFFPSNVNGDNSGCRLAKGNTNSSTLGHRSIVTTNSAADWRRQSVESNASIRKYDS 480
           CEPRVFFPSNVNGDNSGCRLAKGNTNSSTLGHRSIVTTNSAADWRRQSVESNASIRKYDS
Sbjct: 421 CEPRVFFPSNVNGDNSGCRLAKGNTNSSTLGHRSIVTTNSAADWRRQSVESNASIRKYDS 480

Query: 481 TAETYKGLNATHAVGIMERTRSTPLPTALKTISGSDRQRNKKWKGEFKRRGHGNAIRRFA 540
           TAETYKGLNATHAVGIMERTRSTPLPTALKTISGSDRQRNKKWKGEFKRRGHGNAIRRFA
Sbjct: 481 TAETYKGLNATHAVGIMERTRSTPLPTALKTISGSDRQRNKKWKGEFKRRGHGNAIRRFA 540

Query: 541 DDKGCIIC 548
           DDKGCIIC
Sbjct: 541 DDKGCIIC 548

>TDEL0A03900 Chr1 (698940..700955) [2016 bp, 671 aa] {ON} Anc_5.526
           YML006C
          Length = 671

 Score =  291 bits (744), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 226/688 (32%), Positives = 323/688 (46%), Gaps = 157/688 (22%)

Query: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNER- 59
           M KS++V DYF NDDNGLWSWYL++IR+GDFEE +RN+LK +L +RFL ++ +   +   
Sbjct: 1   MQKSIKVDDYFDNDDNGLWSWYLSHIRSGDFEEFSRNKLKVTLLRRFLNSHFDSNRSHYG 60

Query: 60  KDTKVLIVSIPEDVRRDITLLEYFLGDYLNLDNME---ITKLTTSRIYNHENHYVVMDKE 116
           ++TK+L VSIP+ V RD++LLE FL DY +L+++E   ITKLT S +YNHENHY+++DK 
Sbjct: 61  QNTKILFVSIPDKVHRDLSLLENFLRDYFHLEHLEHIEITKLTQSPVYNHENHYILIDKL 120

Query: 117 NNFKNSNFLHFASTNIQTGKGFT---------GGELAGTTVAAQAEKNISPTESAKFRAG 167
           NNF +  FL FAST  Q                G +     + +  K    T + + RAG
Sbjct: 121 NNFDDPTFLQFASTRWQQQLSNQQSNRLSDRQSGSIPNNDSSVEFNKKPCGTVTERSRAG 180

Query: 168 Q------GLEPSD----------------------------------DTEGDEESLVFNF 187
                     PSD                                  D + + ES+V +F
Sbjct: 181 SLSSFSANSGPSDLGSDTGGLQNIEVRSIQSESTAGQFNQIPINSINDQDDENESIVLDF 240

Query: 188 TH---RDHHLTHPLRANGKEQEEAVGVSPSWNPQQQQRLQEHNASN------DEMASIDS 238
           +H   R        +A    Q+E    +           ++ NAS+       E  SI+S
Sbjct: 241 SHSLLRKQMEEKKSQAQRIRQQEYSADTNQTITNLHTNDKDTNASDIYSPAISENVSINS 300

Query: 239 YNL-----GSNSSRVVESFKGEPLTLTMTRTEDFXXXXXXXXXXXXXXXXXXXXXXXXX- 292
           Y       GS+S    +S+ G+PL LT T  +D                           
Sbjct: 301 YEDESMRDGSDSITAKDSYSGQPLALTTTHYKDDTQGSSDDSQEENISELSSVSRSMKSL 360

Query: 293 --------------------XXLMSILPSISIADSFGHFRLVLQSVLFINPTSNEIFTAI 332
                                 ++SILPSISI+D+ GH+RLV+QS L  +P + EI+TAI
Sbjct: 361 GSQTSLGDNNDYENNSDSSDYSVVSILPSISISDARGHYRLVMQSSLLQDPETKEIYTAI 420

Query: 333 RQSNNKPTKADVDDDWLLYDSQFSMHNLQMLTLQDLSELNKGCPKVLFYSLVEVVD---- 388
           RQSNN+PT ADVDDDWLLYDSQFSM+NLQMLTLQ+L ++N+  PK++FYS++ V D    
Sbjct: 421 RQSNNQPTVADVDDDWLLYDSQFSMNNLQMLTLQELLDMNRSFPKIIFYSMIVVSDEQQE 480

Query: 389 --------TPSLEDADTECXXXXXXXXXXXXXXXXXXXXXCEPRVFFPSNVNGDNSGCRL 440
                   T   + AD                         +P+ F+ +N++ D++    
Sbjct: 481 LLQWSNGMTQKEDTADASSSIPRADSYASMSR---------DPQQFY-ANMDDDDTSLSE 530

Query: 441 AKG---------NTNSSTLGHRSIVTTNSAADW--------------RRQSVESNASIRK 477
             G          +N+ST  HRSI T NS  DW              R  + ++  S  +
Sbjct: 531 QSGPMMYAPTRLQSNTST-AHRSIRTVNSIGDWAFVHKNETKRQGSHRGSTSQAGVSGVQ 589

Query: 478 YDSTAETYKGL--------NATHAVGIM------ERTRSTPLPTALKTISGSDRQRNKKW 523
           +DS  +  + L        N    V  M      ER++STPLP  L + S  D + +K W
Sbjct: 590 FDSDNQNLQFLHPERVHSRNGLSKVSTMASLNPVERSKSTPLPVILISFSNLDGE-SKHW 648

Query: 524 KGE---FKRRGHGNAIRRFADDKGCIIC 548
           K +   F+R+ +         +KGCII 
Sbjct: 649 KDKITTFRRKKNHR-----QHEKGCIIM 671

>SAKL0G04906g Chr7 (403654..405480) [1827 bp, 608 aa] {ON} some
           similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 608

 Score =  275 bits (703), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 205/608 (33%), Positives = 288/608 (47%), Gaps = 110/608 (18%)

Query: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERK 60
           M   V+V DYF ND NGLWSWYL+N+R+G FEELT N LK +L KRFL  +L   +  + 
Sbjct: 1   MPSVVKVKDYFENDYNGLWSWYLSNLRDGHFEELTNNVLKFTLLKRFLNEHLMQDI-VQF 59

Query: 61  DTKVLIVSIPEDVRRDITLLEYFLGDYLNLDNME---ITKLTTSRIYNHENHYVVMDKEN 117
           + K+L+VSIP+++ +DIT+LE FL  Y +LD+++   I KLT S+IYNHENHY++ D  N
Sbjct: 60  NKKMLLVSIPDNIHQDITILENFLRSYFHLDDLQYIQIKKLTDSQIYNHENHYLISDNLN 119

Query: 118 NFKNSNFLHFAST---NIQTGKGFTG-----GELAGTTVAAQAEKNISPTESAKFRAGQG 169
           NF + +FL F      N++    + G     GE    ++    E+N +   S       G
Sbjct: 120 NFHDRSFLGFGQKKHDNVRPQLSYNGYSVLSGETGYASLRTTEEQNGTHRPSGVVEQCNG 179

Query: 170 LEPSDDTEGDEESLVFNFTHRDHHLTHPLRANGKEQEEAVGVS----PSWNPQQ--QQRL 223
             P+              T RD     P++++  E+++  G      P   P+    QR 
Sbjct: 180 NSPA--------------TPRDVTAVEPVKSSEDEEDQESGEIVLNFPHKPPKNIINQRE 225

Query: 224 QEHNASNDEMASIDSYNLGSNSSRVVESFKGEPLTLTMTRTEDFXXXXXXXXXXXXXXX- 282
           QE   +  E  SI+S +          S+ GE L  T+TR ED                 
Sbjct: 226 QE-VVTTSEDVSINSED--------ASSYDGEALIQTITRDEDASSADEDNSNISELSSV 276

Query: 283 -------XXXXXXXXXXXXLMSILPSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQS 335
                              + SI P+ISI+D+FG FRLVLQS+L  NP + EIFTA+RQS
Sbjct: 277 DHSLNSLSYNSDISSDDYSMASIFPAISISDTFGTFRLVLQSILIQNPDTREIFTAVRQS 336

Query: 336 NNKPTKADVDDDWLLYDSQFSMHNLQMLTLQDLSELNKGCPKVLFYSLV-----EVVD-- 388
           NN P  A ++DDWLLYD +FSMHNLQML+L D+ E+N+  PK+LFY++V     E+ D  
Sbjct: 337 NNDPNVAHINDDWLLYDEKFSMHNLQMLSLHDVLEINRFFPKILFYTMVMLDTEEIADEA 396

Query: 389 -----------TPSLEDADTECXXXXXXXXXXXXXXXXXXXXXCE-----------PRVF 426
                       PS   A T                        E              +
Sbjct: 397 HAYIPNDPHLPPPSQGIASTSTLSQNTLRLLPTATSNVTYTRHNELLNAAATSAQDAENY 456

Query: 427 FPSN---------VNGDNSGCRLAKGNTNSSTLGHRSIVTTNSAADWR------------ 465
           FP +         VNG        + N+NS+T  HRSI+T NS  +W             
Sbjct: 457 FPEDNHDDEDDQEVNGVMPLYAPTRTNSNSTT-AHRSILTVNSIGEWAFHHNEPYPQNNH 515

Query: 466 ------RQSVESNASIRKYDSTAETYKGLNATHAVG---IMERTRSTPLPTALKTISGSD 516
                  Q+  +   +++  S   +   L  T  VG    +ER++STPLPT L+T+SG D
Sbjct: 516 SNISFADQNTSTAGKMKRVSSKGSSKNTLQKTTTVGSLSAVERSKSTPLPTLLRTLSGLD 575

Query: 517 RQRNKKWK 524
            +    WK
Sbjct: 576 DE-TMMWK 582

>KLTH0G03740g Chr7 (295985..297880) [1896 bp, 631 aa] {ON} similar
           to uniprot|Q04233 Saccharomyces cerevisiae YML006C GIS4
           CAAX box containing protein of unknown function proposed
           to be involved in the RAS/cAMP signaling pathway
          Length = 631

 Score =  236 bits (603), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 162/424 (38%), Positives = 219/424 (51%), Gaps = 55/424 (12%)

Query: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERK 60
           +  SV+V DYF ND+NGLWSWYL N+R+G+FEEL  NQLK +L +RFL    E  L++  
Sbjct: 2   LESSVKVDDYFDNDENGLWSWYLCNLRHGNFEELNNNQLKFALLRRFLN---EQLLSDSV 58

Query: 61  --DTKVLIVSIPEDVRRDITLLEYFLGDYLNLDNM---EITKLTTSRIYNHENHYVVMDK 115
             + K+L+VSIP+ +  +  LLE FL DY NLD++   +I KLT  R YNHENHY++ D 
Sbjct: 59  LFNKKLLLVSIPDAIHENTNLLENFLRDYFNLDDLQFIQIQKLTQDRCYNHENHYLISDS 118

Query: 116 ENNFKNSNFLHFASTNIQTGKGFTGGELAGTTVAAQAEKNISPTESAKFRAGQGLEPSDD 175
            +NF + +FL F + + +            T +  Q   N     S +  A   L  +  
Sbjct: 119 LSNFNDKSFLEFGAKSRRPRD--------DTEILGQDSNNQYSIISGETEADPALPAAIS 170

Query: 176 TEGDEESLVFNFTHRDHHLTHPLRANGKE--------QEEAVGVSPSWNPQQQQRLQ-EH 226
           +E      +      D     PLR +           QE A     S +   +  L+ EH
Sbjct: 171 SESPASVHLSKVVQED----VPLRTHNSSSRLLIVDNQECASSTDESDDASTELVLKFEH 226

Query: 227 N---------------ASNDEMASIDSYNLG-SNSSRVVESFKGEPLTLTMTRTEDFXXX 270
                           AS +E  +ID+ + G S  S  V S+ GE LT T+TR ED    
Sbjct: 227 RGMLGKQRLHPEVRKMASTEE--AIDTPSTGVSLRSDDVSSYDGEVLTQTITRDEDSVSL 284

Query: 271 XXXXXXXXXXXXXXXXXXXXX--------XXXLMSILPSISIADSFGHFRLVLQSVLFIN 322
                                           L SI PSISI++ FG FRLVLQS+L   
Sbjct: 285 MIEDDSISELSSVDHSLKSLSYDSEYSQGSSSLTSIFPSISISEKFGRFRLVLQSILVHQ 344

Query: 323 PTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNLQMLTLQDLSELNKGCPKVLFYS 382
           P + ++FTA+RQSNN PT A V+DDWLLYD +FSM+NLQ+L L D+ E+NK  PK+LFYS
Sbjct: 345 PDTRQLFTAVRQSNNDPTVAHVNDDWLLYDDKFSMNNLQILALHDVLEMNKFFPKILFYS 404

Query: 383 LVEV 386
           LV +
Sbjct: 405 LVMI 408

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 45/100 (45%), Gaps = 26/100 (26%)

Query: 442 KGNTNSSTLGHRSIVTTNSAADW--------------------RRQSVESNASIRKYDST 481
           + N+N ST  HRSI T  S  DW                      QSVE N  + K  S 
Sbjct: 506 RTNSNKST-AHRSIRTIKSIGDWAFHHDSSSRKLSPNDSTLEDSYQSVEGN--LMKVRSK 562

Query: 482 AETYKGLNATHAVG---IMERTRSTPLPTALKTISGSDRQ 518
           +    GL  T  +G    +ER++S PLP+ LK++S  D +
Sbjct: 563 SSVKSGLTKTLTLGSLSTVERSKSVPLPSVLKSLSNFDEE 602

>Kwal_47.18646 s47 complement(909622..911529) [1908 bp, 635 aa] {ON}
           YML006C (GIS4) - CAAX box containing protein [contig
           191] FULL
          Length = 635

 Score =  232 bits (592), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 152/417 (36%), Positives = 220/417 (52%), Gaps = 33/417 (7%)

Query: 4   SVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERK--D 61
           SV+V DYF ND+NGLWSWYL N+R+G+FEEL  NQLK +L +RFL    E  ++E    +
Sbjct: 5   SVKVDDYFGNDENGLWSWYLCNLRHGNFEELNNNQLKSALLRRFLN---EQLMSETVPFN 61

Query: 62  TKVLIVSIPEDVRRDITLLEYFLGDYLNLDNM---EITKLTTSRIYNHENHYVVMDKENN 118
            K+L+VSIP+ +  +  LLE FL DY +LD++   +I KLT  + YNHENHY++ D  +N
Sbjct: 62  KKLLLVSIPDAIHENTNLLENFLRDYFHLDDLQYIQIRKLTQEKCYNHENHYLICDNLSN 121

Query: 119 FKNSNFLHFASTNIQTGKGFTGGELAGTT-------VAAQAEKNISPTESAKFRAGQGLE 171
           F + +FL F    I+      G EL+G T       ++ +   +++ +      + + + 
Sbjct: 122 FNDKSFLEFG---IKRVGACNGNELSGETSNNQYSIISGETSTDVTKSSLEIPLSPEFIR 178

Query: 172 PSDDTEGDEESLVFNFTHRDHHLTHPLRANGK------EQEEAVGVSPSWNPQQQQRLQE 225
            S  T+ D      + + R   + +    N        E E  +   P     ++Q   E
Sbjct: 179 DSKVTQEDPALQTQSTSSRSLRIENSGSLNSSDESDDTESEIVLRFKPRGTVGKRQLYSE 238

Query: 226 HNASNDEMASIDSYNLG-SNSSRVVESFKGEPLTLTMTRTEDFXXXXXXXXXXXXXXXXX 284
              S      ID+ + G S  S  V S+ GE L    +R ED                  
Sbjct: 239 VKRSPLANDYIDTPSTGMSLRSEDVSSYDGEELAHIASRDEDSASLSADEDNISELSSVD 298

Query: 285 XXXXXXX--------XXXLMSILPSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSN 336
                             + SI PSISI++ FG FRLVLQS+L     + +++TA+RQSN
Sbjct: 299 HSLNSLSYDSECTPGSSSMTSIFPSISISEKFGRFRLVLQSILIQQTDTRQLYTAVRQSN 358

Query: 337 NKPTKADVDDDWLLYDSQFSMHNLQMLTLQDLSELNKGCPKVLFYSLVEVVDTPSLE 393
           N PT A V+DDWLLYD +FSM+NLQ+L L D+ E+NK  PKVLFYSL+ V D  +++
Sbjct: 359 NDPTVAHVNDDWLLYDDKFSMNNLQILALHDVLEINKFFPKVLFYSLIVVTDEVAID 415

 Score = 38.5 bits (88), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 32/98 (32%), Positives = 46/98 (46%), Gaps = 22/98 (22%)

Query: 442 KGNTNSSTLGHRSIVTTNSAADW--------RRQS----------VESNASIRKYDSTAE 483
           + N+N ST  HRSI T  S  DW        RR S          ++   ++ K  S + 
Sbjct: 510 RTNSNKST-AHRSIRTIKSIGDWAFHHDSTSRRTSSAASFLEDPRLDDEGNLMKIKSKSS 568

Query: 484 TYKGLNATHAVG---IMERTRSTPLPTALKTISGSDRQ 518
              GL  T  +G    +ER++S PLP+ LKT+S  D +
Sbjct: 569 VKSGLTKTFTLGSLSTVERSKSVPLPSILKTLSNFDEE 606

>KLLA0A01782g Chr1 complement(157216..158802) [1587 bp, 528 aa] {ON}
           some similarities with uniprot|Q04233 Saccharomyces
           cerevisiae YML006C GIS4 CAAX box containing protein of
           unknown function proposed to be involved in the RAS/cAMP
           signaling pathway
          Length = 528

 Score =  223 bits (569), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 181/545 (33%), Positives = 259/545 (47%), Gaps = 84/545 (15%)

Query: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPT--LNE 58
           M  SV+V DY+ ND NGLWSWYL+N+RNG+FEELT N+LKH L KRFLR   + T  LN+
Sbjct: 1   MPTSVQVKDYYENDYNGLWSWYLSNLRNGEFEELTGNELKHGLLKRFLRDQFQATGPLNK 60

Query: 59  RKDTKVLIVSIPEDVRRDITLLEYFLGDYLNLD----NMEITKLTTSRIYNHENHYVVMD 114
               K+L+VSIP+++ +DI +LE FL +Y +L     N+ I KLT   +Y HENHY++ D
Sbjct: 61  ----KLLLVSIPDEIHQDIKVLEEFLSEYFHLKDDHTNIVIDKLTRGTVYKHENHYLIQD 116

Query: 115 KENNFKNSNFLHFASTNIQTGKGFTGGELAGTTVAAQAEKNISPTESAKFRAGQGLEPSD 174
           K  NF +  FL        +G        +      + E +    +S    +   L   D
Sbjct: 117 KLTNFNDEWFLEMKKDVSISGNSSKDATDSAENCGQEMEDDSPRRDSDSSDSYSIL-TGD 175

Query: 175 DTEGDEESLVFNFTHRDHHLTHPLRANGKEQEEAVGVSPSWN---PQQQQRLQEHNASND 231
             + +  S+V NF H +  +  P+    K  +  V +SP  N   P + Q          
Sbjct: 176 TFDTESHSIVLNFKHPE-VMVKPIT---KTTQRIVRISPGNNIGSPAESQ---------- 221

Query: 232 EMASIDSYNLGSNSSRVVESFKGEPLTLTMTRTEDFXXXXXXXXXXXXXXXXXXXXXXXX 291
              SI ++  G +    +ES++GE L  T+TR  D                         
Sbjct: 222 --VSIVTH--GDD----LESYRGEALVQTVTRAIDEDEEDEDDDDHHHDVESADDMKSKD 273

Query: 292 XXXLMSILPSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLY 351
                    SISI+D+FG FRLVLQS+L  N  + +IFT IRQS N  + AD++DDWLLY
Sbjct: 274 ISIPP----SISISDNFGTFRLVLQSILITNKETEQIFTGIRQSENDRSNADINDDWLLY 329

Query: 352 DSQFSMHNLQMLTLQDLSELNKGCPKVLFYSLVEVVDTPSLEDADTECXXXXXXXXXXXX 411
           D+ F++ NLQML+L D+ + +K  PK+LFYS++ V D+    D +TE             
Sbjct: 330 DTDFNLGNLQMLSLYDILDFSKFLPKILFYSMIHVKDSV---DDNTEL---------SLQ 377

Query: 412 XXXXXXXXXCEPRVFFP-------SNVNGDNSGCRLAKGNTNSS---------------- 448
                        ++ P       S ++ DNS      GN+N S                
Sbjct: 378 HLITVNNTLTNGNMYSPHEVDDSMSELSSDNS-IECYTGNSNDSIADEPVIGLYSPATAA 436

Query: 449 TLGHRSIVTTNSAADWRRQSVESNASIRKYDSTAETYKGLNATHAVG-IMERTRSTPLPT 507
           T GHRSI T  S   W      +  S+       ET +   +  + G  M R +S P+P 
Sbjct: 437 TAGHRSIRTVESIGAWALNRSNTKKSM-------ETVQNTVSRDSRGNFMNRIKSQPMPV 489

Query: 508 ALKTI 512
            L+T+
Sbjct: 490 LLQTL 494

>Smik_13.145 Chr13 complement(244766..247090) [2325 bp, 774 aa] {ON}
           YML006C (REAL)
          Length = 774

 Score =  169 bits (429), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 106/142 (74%), Gaps = 5/142 (3%)

Query: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRT--YLEPTLNE 58
           M KSVRVGDYF NDDNGLWSWYLTN+R GDFEEL  NQLK++L KRFL +  Y + +++ 
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNSISV 60

Query: 59  RKDTKVLIVSIPEDVRRDITLLEYFLGDYLNLDNME---ITKLTTSRIYNHENHYVVMDK 115
           R + K+L+VSIPE+V  DI++LE FL DY +L+ +E   I+KLT S  YNHENHY++ D 
Sbjct: 61  RSNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 116 ENNFKNSNFLHFASTNIQTGKG 137
            NNF++  FL FAST+ Q  K 
Sbjct: 121 LNNFQDPTFLEFASTSWQVQKN 142

 Score =  149 bits (375), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 109/327 (33%), Positives = 161/327 (49%), Gaps = 88/327 (26%)

Query: 295 LMSILPSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQ 354
           ++SILPSISI DS G+FRLVLQS+L  +P + EIFTAIRQSNN+PT A V DDWLLYDS 
Sbjct: 436 VLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNRPTIASVTDDWLLYDSN 495

Query: 355 FSMHNLQMLTLQDLSELNKGCPKVLFYSLVEVVDT-PSLEDADTECXXXXXXXXXXXXXX 413
           FSM+NLQ+LTLQDL ++ +  PK+LFY++V V ++   +E+                   
Sbjct: 496 FSMNNLQILTLQDLLDIKRSFPKILFYTMVIVTESGQQIEEEPKNPNYGTREDMLKEQPL 555

Query: 414 XXXXXXXCEPRVFFPSNVN------------------GDNSGCRL---AKGNTNSSTLGH 452
                   +P+ +FP+  N                   + SG ++    +  +N +T  H
Sbjct: 556 NSDLLLSHDPKQYFPNAYNNDYDEYIDDEDDDDDASLSEQSGPQMYIPTRMESNVTT-AH 614

Query: 453 RSIVTTNSAADW---RRQSV----ESNA-------------------------------- 473
           RSI T NS  +W   R  SV    +SN+                                
Sbjct: 615 RSIRTVNSIGEWAFNRHNSVTKINKSNSNESDDSENNDDRLSSDEPYPMTQISNFNTSSS 674

Query: 474 ----SIRKYDST-------------AETYKGLNATHAVGIMERTRSTPLPTALKTIS--- 513
               S++K +++             +E  K  N+ +A+  +ER++S PLPT LK++S   
Sbjct: 675 NFSHSLKKKNTSKVNSKINNESNSKSELKKIKNSINAMSAVERSKSLPLPTLLKSLSSID 734

Query: 514 ----GSDRQRNKKWKGEFKR-RGHGNA 535
               G+++ R K+WK +  R R H N+
Sbjct: 735 NNTHGTNKDR-KRWKFQMNRFRNHKNS 760

>YML006C Chr13 complement(256092..258416) [2325 bp, 774 aa] {ON}
           GIS4CAAX box containing protein of unknown function,
           proposed to be involved in the RAS/cAMP signaling
           pathway
          Length = 774

 Score =  169 bits (427), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 83/141 (58%), Positives = 105/141 (74%), Gaps = 5/141 (3%)

Query: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRT--YLEPTLNE 58
           M KSVRVGDYF NDDNGLWSWYLTN+R GDFEEL  NQLK++L KRFL +  Y +  ++ 
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNISA 60

Query: 59  RKDTKVLIVSIPEDVRRDITLLEYFLGDYLNLDNME---ITKLTTSRIYNHENHYVVMDK 115
           R + K+L+VSIPE+V  DI++LE FL DY +L+ +E   I+KLT S  YNHENHY++ D 
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 116 ENNFKNSNFLHFASTNIQTGK 136
            NNF++  FL FAST+ Q  K
Sbjct: 121 LNNFQDPTFLEFASTSWQVQK 141

 Score =  146 bits (368), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 109/329 (33%), Positives = 156/329 (47%), Gaps = 89/329 (27%)

Query: 295 LMSILPSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQ 354
           ++SILPSISI DS G+FRLVLQS+L  +P + EIFTAIRQSNNKPT A V DDWLLYDS 
Sbjct: 433 VLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSN 492

Query: 355 FSMHNLQMLTLQDLSELNKGCPKVLFYSLVEVVDT-PSLEDADTECXXXXXXXXXXXXXX 413
           FSM+NLQ+LTLQDL ++ +  PK+LFY++V V ++   +E+                   
Sbjct: 493 FSMNNLQILTLQDLLDIKRSFPKILFYTMVIVTNSGKQVEEEFKNPNYDNREGISKEQPL 552

Query: 414 XXXXXXXCEPRVFFPSNVN---------------------GDNSGCRL---AKGNTNSST 449
                   +P+ +FP+  N                      + SG ++    +  +N +T
Sbjct: 553 DSELSLTNDPQQYFPTAYNNGYNDYIDDEDDEDDGDDASLSEQSGPQMYIPTRMESNVTT 612

Query: 450 LGHRSIVTTNSAADW---RRQSV----ESNA----------------------------- 473
             HRSI T NS  +W   R  SV    +SN+                             
Sbjct: 613 -AHRSIRTVNSIGEWAFNRHNSVTKIDKSNSNELDNSKTGESTVLSSEPHPMTQLSNSNT 671

Query: 474 -------SIRKYDSTAETYKGLN-------------ATHAVGIMERTRSTPLPTALKTIS 513
                  S++  +S     KG N             + +A+  +ER++S PLPT LK++S
Sbjct: 672 TSSNFSHSLKTKNSHKPNSKGNNESNSKNELKKIKSSINAMSAVERSKSLPLPTLLKSLS 731

Query: 514 GSD------RQRNKKWKGEFKR-RGHGNA 535
           G D       +  K+WK +  R + H N+
Sbjct: 732 GIDNPTHATNKDRKRWKFQMNRFKNHKNS 760

>Skud_13.148 Chr13 complement(242351..244690) [2340 bp, 779 aa] {ON}
           YML006C (REAL)
          Length = 779

 Score =  167 bits (422), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 83/141 (58%), Positives = 103/141 (73%), Gaps = 5/141 (3%)

Query: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLN--E 58
           M KSVRVGDYF NDDNGLWSWYLTN+R GDFEEL  NQLK++L KRFL ++     N   
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDYNTSA 60

Query: 59  RKDTKVLIVSIPEDVRRDITLLEYFLGDYLNLDNME---ITKLTTSRIYNHENHYVVMDK 115
           R + K+L+VSIPE+V  DI++LE FL DY +L+ +E   I+KLT S  YNHENHY++ D 
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDN 120

Query: 116 ENNFKNSNFLHFASTNIQTGK 136
            NNF++  FL FAST+ Q  K
Sbjct: 121 LNNFQDPTFLEFASTSWQVQK 141

 Score =  144 bits (364), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 112/208 (53%), Gaps = 22/208 (10%)

Query: 295 LMSILPSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQ 354
           ++SILPSISI DS G+FRLVLQS+L  +P + EIFTAIRQSNNKPT A V DDWLLYDS 
Sbjct: 440 VLSILPSISICDSLGYFRLVLQSILIQDPDTKEIFTAIRQSNNKPTMASVTDDWLLYDSN 499

Query: 355 FSMHNLQMLTLQDLSELNKGCPKVLFYSLVEVVDT--PSLEDADTECXXXXXXXXXXXXX 412
           FSM+NLQ+LTLQDL ++ +  PK+LFY++V V D+    +E+                  
Sbjct: 500 FSMNNLQILTLQDLLDIKRSFPKILFYTMVIVTDSGHQQIEEEHKSSSHRGTVDTSKEEP 559

Query: 413 XXXXXXXXCEPRVFFPSNVN------------------GDNSGCRLAKGNTNSS--TLGH 452
                    +P+ +FP+  N                   + SG ++      +S  T  H
Sbjct: 560 LNSELSLSHDPQQYFPTAYNIDYDEYTDDEDEGDDASLSEQSGPQMYLPTRMASNVTTAH 619

Query: 453 RSIVTTNSAADWRRQSVESNASIRKYDS 480
           RSI T NS  +W      S   I K DS
Sbjct: 620 RSIRTVNSIGEWAFNRHNSVTKINKSDS 647

 Score = 34.7 bits (78), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 30/52 (57%), Gaps = 6/52 (11%)

Query: 479 DSTAETYKGLNATHAVGIMERTRSTPLPTALKTISGSDRQRN------KKWK 524
           +S  E  K   + +A+  +ER++S PLPT LK++SG D   +      K+WK
Sbjct: 702 NSKNELKKIKTSINAMSAVERSKSLPLPTLLKSLSGIDNHTHGANKDRKRWK 753

>Suva_13.156 Chr13 complement(246662..248980) [2319 bp, 772 aa] {ON}
           YML006C (REAL)
          Length = 772

 Score =  166 bits (421), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 105/142 (73%), Gaps = 5/142 (3%)

Query: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRT--YLEPTLNE 58
           M KSVRVGDYF NDDNGLWSWYLTN+R GDFEEL  NQLK++L KRFL +  Y +   + 
Sbjct: 1   MQKSVRVGDYFDNDDNGLWSWYLTNLRLGDFEELIGNQLKYTLLKRFLNSHFYGDNNTSI 60

Query: 59  RKDTKVLIVSIPEDVRRDITLLEYFLGDYLNLDNME---ITKLTTSRIYNHENHYVVMDK 115
           R + K+L+VSIPE+V  DI++LE FL DY +L+ +E   I+KLT S  YNHENHY++ D 
Sbjct: 61  RPNKKILLVSIPENVHEDISILEIFLKDYFHLEKLEHIQISKLTHSHCYNHENHYLLTDY 120

Query: 116 ENNFKNSNFLHFASTNIQTGKG 137
            NNF++ +FL FAST+ Q  K 
Sbjct: 121 LNNFQDPSFLEFASTSWQVQKN 142

 Score =  145 bits (365), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 108/320 (33%), Positives = 150/320 (46%), Gaps = 85/320 (26%)

Query: 295 LMSILPSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQ 354
           ++SILPSISI DS G+FRLVLQS+L  NP + EIFTAIRQSNN+PT A V DDWLLYDS 
Sbjct: 432 ILSILPSISICDSLGYFRLVLQSILIQNPDTKEIFTAIRQSNNEPTVASVTDDWLLYDSN 491

Query: 355 FSMHNLQMLTLQDLSELNKGCPKVLFYSLVEVVDT--PSLEDADTECXXXXXXXXXXXXX 412
           FSM+NLQ+LTLQDL ++ +  PK+L Y++V V ++    +E+ +T               
Sbjct: 492 FSMNNLQILTLQDLLDIKRSFPKILLYTMVIVTNSGQQQIEEENTNLNQQHREVDLTEEK 551

Query: 413 XXXXXXXXC-EPRVFFPSNVN------------------GDNSGCRLAKGNTNSS--TLG 451
                     +P+ +FPS  +                   + SG ++      +S  T  
Sbjct: 552 PPNSELSLSNDPQRYFPSTFDDDYDEYIDDDDGGDDASLSEQSGPQMYLPTRMASNVTTA 611

Query: 452 HRSIVTTNSAADW---RRQSV------ESNAS---------------------------- 474
           HRSI T NS  +W   R  SV       SN S                            
Sbjct: 612 HRSIRTVNSIGEWAFNRHNSVTKINKSSSNESDNLKECGDRISPVEPYPMTQLSNSNTVT 671

Query: 475 ------IRKYDSTAETYKGLN-------------ATHAVGIMERTRSTPLPTALKTISGS 515
                 ++  +S   T KG N             + +A+  +ER++S PLPT LK++SG 
Sbjct: 672 SNFSHLLKNKNSYKRTSKGNNESNSKNELKKIKTSINAMSAVERSKSLPLPTLLKSLSGM 731

Query: 516 DRQRN------KKWKGEFKR 529
           D   +      K+WK +  R
Sbjct: 732 DNHTDSNNKDRKRWKFKMTR 751

>Ecym_4061 Chr4 (133342..135333) [1992 bp, 663 aa] {ON} similar to
           Ashbya gossypii ADR198C
          Length = 663

 Score =  164 bits (416), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 126/419 (30%), Positives = 197/419 (47%), Gaps = 57/419 (13%)

Query: 13  NDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERKDTKVLIVSIPED 72
           +D NGLWSWYL N+R G+FEEL+ + +K  L KR ++ Y   T++     +VL+VS+P+D
Sbjct: 10  DDCNGLWSWYLHNLRCGEFEELSSDIVKCRLMKRLVKEYSGGTMS--ASNRVLLVSVPDD 67

Query: 73  VRRDITLLEYFLGDYL----NLDNMEITKLTTSR-IYNHENHYVVMDKENNFKNSNFL-- 125
           +R+  ++LE FL   L     + +  ITKLT  + + N E+HY++ D +           
Sbjct: 68  IRQGASILEEFLRSSLPGMREVRDGNITKLTGRKDLLNGEDHYLINDTKGGVAGVGLTAN 127

Query: 126 --------HFASTNIQTGKGFTGGELAGTTVAAQAEKNISPTESAKFRAGQGLEPSDDTE 177
                   HF   + Q    F+ G          +  ++  T +    A  GLE      
Sbjct: 128 RPVESFGSHFQRQD-QCDNEFSFG---------HSNASLEETLNVSLCANTGLENVAGIS 177

Query: 178 GDEESLVFNFTHRD-HHLTHPLRANGKEQE-EAVGVS----PSWNPQQQQRLQEHNASND 231
              + + F+    D  ++   +  + +E   +  GV      S  P+  +R      +N 
Sbjct: 178 TQLKGIGFDPVSNDISYMQQNIDVDRREHTLDGGGVGDTEVASEKPRNGERFTTSFKANS 237

Query: 232 EMASIDS--YNLGSNSSRV----------------VESFKGEPLTLTMTRTEDFXXXXXX 273
             A  +S  +  G +SS +                 +S+ GE L  T+TR E        
Sbjct: 238 LTAVDNSKLFTFGLSSSAISTCKNSEEVSIRSSESYQSYDGEVLARTLTREEHIQGSCCP 297

Query: 274 XXXXXXXXXXXXXXXXXXXXXLMSI------LPSISIADSFGHFRLVLQSVLFINPTSNE 327
                                  S+       PSISI+   G FR+VLQS+L  N T ++
Sbjct: 298 TEHRHEELYNEGDSTSELSSACNSVSSDCSIFPSISISGDEGDFRIVLQSILIYNTTLDQ 357

Query: 328 IFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNLQMLTLQDLSELNKGCPKVLFYSLVEV 386
           + TA+RQSNN  T AD++DDWLLYD +FSM+N+QM++L D+ E+N   PK+LFYS+V +
Sbjct: 358 LLTAVRQSNNDTTVADINDDWLLYDERFSMNNIQMVSLIDIFEMNGVFPKILFYSVVAI 416

>NCAS0H02550 Chr8 (506755..508986) [2232 bp, 743 aa] {ON} Anc_5.526
           YML006C
          Length = 743

 Score =  158 bits (399), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 114/318 (35%), Positives = 163/318 (51%), Gaps = 72/318 (22%)

Query: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYL----EPTL 56
           M KSVRV DYF NDDNGLWSWYLTNIR GDFEE+T NQLK++L KRFL ++     + T 
Sbjct: 1   MQKSVRVTDYFDNDDNGLWSWYLTNIRLGDFEEVTGNQLKYTLLKRFLNSHFYSNSDVTA 60

Query: 57  NERKDT--------------------KVLIVSIPEDVRRDITLLEYFLGDYLNLDNME-- 94
            E                        K+L+VSIP+ V RD+++LE FL DY +L+++E  
Sbjct: 61  TESPQQHNNNNNTNNNNTQQLKPNFRKILLVSIPDKVHRDLSILETFLRDYFHLEHLEGI 120

Query: 95  -ITKLTTSRIYNHENHYVVMDKENNFKNSNFLHFASTNIQTGKGFTGGELAGTTVAAQAE 153
            I +LT S+ YNHENHY++ D  NNF +  FL FA +N Q  K           +  + +
Sbjct: 121 QIQRLTQSKCYNHENHYLLTDTINNFDDPVFLEFAGSNWQARKNLH----LNNHLDHRDD 176

Query: 154 KNISP----TESA------KFRAGQGLEPS------------DDTEGDEESLVFNFTH-R 190
             ISP    T SA      +    Q ++ +            DD +    S+V NF+H R
Sbjct: 177 DRISPQSIDTHSALNKNDDQILVTQPIDSTLVTPETREKENLDDIDVGGSSIVLNFSHTR 236

Query: 191 DHHLTHPLRANGKEQEEAVGVSPS--WNPQQQQRLQEHNASNDEMASIDSYNLGSNSSRV 248
           +H          K++E++   SP+  + P Q            E+ SI+S++ G +    
Sbjct: 237 EHRKDKDPLNMVKQEEQSNKFSPNMMFTPPQS-----------ELVSINSFDDGDSM--- 282

Query: 249 VESFKGEPLTLTMTRTED 266
             ++ G PL LT+TR ++
Sbjct: 283 --NYNGHPLKLTLTRQDE 298

 Score =  140 bits (352), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 106/314 (33%), Positives = 143/314 (45%), Gaps = 76/314 (24%)

Query: 295 LMSILPSISIADSF-GHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDS 353
           ++SILPSISI+D+  GHFRLVLQS+L  +P + EI+TAIRQSNN+PT AD+ DDWLLYDS
Sbjct: 419 VLSILPSISISDAIEGHFRLVLQSILIQHPVTKEIYTAIRQSNNEPTIADIMDDWLLYDS 478

Query: 354 QFSMHNLQMLTLQDLSELNKGCPKVLFYSLVEVVDT-------------PSLEDA----- 395
           QFSM NLQ+LTLQDL + N+  PK+LFYS+V V D              P L  +     
Sbjct: 479 QFSMDNLQILTLQDLLDTNRSFPKILFYSMVIVTDAHHQPIQGPTSTAGPDLTTSYLSNK 538

Query: 396 -DTECXXXXXXXXXXXXXXXXXXXXXCEPRVFFPSNVNG-------------DNSGCRL- 440
            ++                        +P+ FFP   +              + +G  + 
Sbjct: 539 LESIAGDETNQRFENRYYPMADDQVEDQPQQFFPQEDDHDDDNMYDTDDSLMEEAGPEMY 598

Query: 441 --AKGNTNSSTLGHRSIVTTNSAADWRRQSVESNASIRK--------------------- 477
              +  TN++T  HRSI T NS  +W      +N S  K                     
Sbjct: 599 LPTRMETNNTT-AHRSIRTVNSIGEWAFNRNNTNGSSSKSAIGREDEDGDEEEETNHHND 657

Query: 478 ---YDSTAETYKGLNATHAVGIMERTRS--------------TPLPTALKTISGSDRQRN 520
              +D+     K      + G  +  RS              TPLPT LK+ISG+   + 
Sbjct: 658 GQTHDNNHHHNKKTGKKGSYGGAKNKRSGNIEAMKAVERTKSTPLPTLLKSISGTGTDK- 716

Query: 521 KKWKGEFKRRGHGN 534
           K+WK   K     N
Sbjct: 717 KRWKDRLKEMKKKN 730

>KNAG0B03710 Chr2 complement(710003..712138) [2136 bp, 711 aa] {ON}
           Anc_5.526 YML006C
          Length = 711

 Score =  154 bits (390), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 104/148 (70%), Gaps = 10/148 (6%)

Query: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERK 60
           M KS+RV DY+ NDDNGLWSWYL NIR+GDFEELT N+LK++L KRFL+ +   T  E  
Sbjct: 1   MQKSIRVNDYYDNDDNGLWSWYLQNIRSGDFEELTHNELKYTLLKRFLKNHF--TSLEGI 58

Query: 61  DTKVLIVSIPEDVRRDITLLEYFLGDYLNLD---NMEITKLTTSRIYNHENHYVVMDKEN 117
           ++K+L +SIP+ V  DI++LE FL DY +L+   N++I KLTTS  YNHENHY++ D  N
Sbjct: 59  NSKILFISIPDKVHSDISVLETFLKDYFHLEDLQNIKIQKLTTSNCYNHENHYLLTDTLN 118

Query: 118 NFKNSNFLHFASTNIQTGKGF-TGGELA 144
           NF +  FL +    +  G+ F   G++A
Sbjct: 119 NFNDRKFLRY----LNPGRKFENSGDMA 142

 Score =  116 bits (290), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 102/183 (55%), Gaps = 21/183 (11%)

Query: 297 SILPSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFS 356
           SILPSI+I D+ GHFRLVLQSVL +      IFTAIRQSNNK  +A V DDW+LYDS FS
Sbjct: 460 SILPSITIKDTEGHFRLVLQSVL-LQREDKAIFTAIRQSNNKVDRATVQDDWILYDSDFS 518

Query: 357 MHNLQMLTLQDLSELNKGCPKVLFYSLVEVVDTPSLEDADTECXXXXXXXXXXXXXXXXX 416
           M+NL M+TL+ L   ++   K+LFYS++ V D  + +D   E                  
Sbjct: 519 MNNLMMMTLRGLFNFSENMSKILFYSMIIVDDAETADDMLDE------------EATHSG 566

Query: 417 XXXXCEPRVFFPSNVNGDNSGCR-----LAKGNTNSSTLGHRSIVTTNSAADWRRQSVES 471
                +P++ F  +    +SG +     L +   + +T  HRSI T NS  +W  +  +S
Sbjct: 567 DVSDTQPQLMF--DEEDSDSGVQEPQMYLPQKTASHATTAHRSIRTVNSIGEWAYKK-KS 623

Query: 472 NAS 474
           NA+
Sbjct: 624 NAT 626

>CAGL0K07271g Chr11 complement(712294..714624) [2331 bp, 776 aa]
           {ON} similar to uniprot|Q04233 Saccharomyces cerevisiae
           YML006c
          Length = 776

 Score =  154 bits (388), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 73/139 (52%), Positives = 100/139 (71%), Gaps = 8/139 (5%)

Query: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERK 60
           M KSVRVGDY+ ND+NG+WSWYL+N+R+GDFEE+  N+LK++L KRFL + L    +   
Sbjct: 1   MSKSVRVGDYYGNDENGVWSWYLSNLRSGDFEEIIENKLKYTLLKRFLNSNLLGNFSPES 60

Query: 61  DT-----KVLIVSIPEDVRRDITLLEYFLGDYLN---LDNMEITKLTTSRIYNHENHYVV 112
            T     K++ VSIPEDV +DI++LE FL DY +   LDN +I KLT  ++Y+HENHY +
Sbjct: 61  PTRFINKKLIFVSIPEDVHQDISILELFLRDYFHLKVLDNNQIHKLTQDKVYHHENHYFL 120

Query: 113 MDKENNFKNSNFLHFASTN 131
           MD+ NNF++  FL F  +N
Sbjct: 121 MDELNNFEDPTFLEFGKSN 139

 Score =  149 bits (375), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 96/275 (34%), Positives = 132/275 (48%), Gaps = 56/275 (20%)

Query: 295 LMSILPSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQ 354
           L+SILPSISI D+ G+FRLVLQS+L  +P + E+FTA+RQSNNKPT AD+ DDWLLYD++
Sbjct: 451 LLSILPSISIFDTLGYFRLVLQSILIQDPQTKEVFTAVRQSNNKPTIADITDDWLLYDAE 510

Query: 355 FSMHNLQMLTLQDLSELNKGCPKVLFYSLVEVVDTPSLE-----DADTECXXXXXXXXXX 409
           FSMHNLQ+LTLQD+  + K  PK+LFY++V + D   +      +               
Sbjct: 511 FSMHNLQILTLQDIMTIKKDYPKILFYTMVVINDRSEIACEFPYNGAQFTKAPSPITNKS 570

Query: 410 XXXXXXXXXXXCEPRVFFPSN-------VNGDNSG------CRLAKGNTNSSTLGHRSIV 456
                       E + +FP N       +  +N        C+  +  +N +T  HRSI 
Sbjct: 571 HEVEKEELDQPTEVQAYFPGNGQAIKDSIKPNNRDSLTFDLCQAERTKSNMTTT-HRSIR 629

Query: 457 TTNSAADWRRQSVESNASIRKYDSTAETYK-------------------------GLNAT 491
           T NS  DW      +  + R   +T+  Y                          G  + 
Sbjct: 630 TVNSIGDWSISRDTTGIATRAATNTSGQYDDHYQALKFDESSKERLIQGRKDGSGGKYSK 689

Query: 492 HAVG------------IMERTRSTPLPTALKTISG 514
           H +              +ERT+S PLPT LKT SG
Sbjct: 690 HQISRVNTNGSSMPLDSVERTKSLPLPTLLKTASG 724

>NDAI0C01070 Chr3 complement(209024..211297) [2274 bp, 757 aa] {ON}
           Anc_5.526 YML006C
          Length = 757

 Score =  150 bits (379), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 81/154 (52%), Positives = 102/154 (66%), Gaps = 21/154 (13%)

Query: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEP------ 54
           M  SVRV DY++NDDNGLWSWYL NIR GDFEELT NQLK++L KRFL ++         
Sbjct: 1   MQNSVRVRDYYNNDDNGLWSWYLRNIRLGDFEELTGNQLKYTLLKRFLNSHFYSNATTTD 60

Query: 55  ----------TLNERKDT--KVLIVSIPEDVRRDITLLEYFLGDYL---NLDNMEITKLT 99
                     ++N+ K T  K+L+VSIP+ V  DI+LLE FL DY    +L+N++ITKLT
Sbjct: 61  TAIDDNNNTNSVNDIKPTVKKILLVSIPDKVHSDISLLELFLRDYFHLEDLENIQITKLT 120

Query: 100 TSRIYNHENHYVVMDKENNFKNSNFLHFASTNIQ 133
            S  YNHENHY++ DK NNF +  FL FA +  Q
Sbjct: 121 QSECYNHENHYLLTDKVNNFDDPMFLEFAGSTWQ 154

 Score =  129 bits (325), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 82/102 (80%), Gaps = 2/102 (1%)

Query: 295 LMSILPSISIAD-SFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDS 353
           ++SILPSISI+D + GHFRLVLQS L  NP + EIFTAIRQSNN+PT A + DDWLLYDS
Sbjct: 458 VLSILPSISISDRNEGHFRLVLQSTLIQNPITKEIFTAIRQSNNEPTIAHITDDWLLYDS 517

Query: 354 QFSMHNLQMLTLQDLSELNKGCPKVLFYSLVEVVD-TPSLED 394
           +F+M NLQ+LTLQDL + N+  PK+LFYS+V V + +P + D
Sbjct: 518 KFAMDNLQILTLQDLLDSNRTFPKILFYSMVIVNESSPPIND 559

 Score = 32.0 bits (71), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 15/89 (16%)

Query: 179 DEESLVFNFTHRDHHLTHPLRA-NGKEQEEAVGVSPSWNPQQQQRLQEHNASNDEMASID 237
           D  S+V NF H   H   P +    ++QEE +  +  + P Q            E+ SI+
Sbjct: 249 DNSSIVLNFPHLRKHSKDPKQTIINEQQEEPLANNQYYTPPQS-----------ELVSIN 297

Query: 238 SYNLGSNSSRVVESFKGEPLTLTMTRTED 266
           S+  G + +  + +++G PL L +TR ++
Sbjct: 298 SF--GDDDTNSM-AYQGHPLHLVLTRQDE 323

>KAFR0C05390 Chr3 (1080797..1082164) [1368 bp, 455 aa] {ON}
           Anc_5.526 YML006C
          Length = 455

 Score =  140 bits (352), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 68/131 (51%), Positives = 97/131 (74%), Gaps = 6/131 (4%)

Query: 1   MHKSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERK 60
           M  SV++ DYF ND+NGLWSWYLTN+R+G+FEEL  N+LK SL KRFLR  ++  +N++ 
Sbjct: 1   MPNSVQIHDYFDNDENGLWSWYLTNLRSGNFEELINNKLKDSLLKRFLRNQVD--INDQI 58

Query: 61  DTKVLIVSIPEDVRRDITLLEYFLGDYLNLD---NMEITKLTTSRIYNHENHYVVMDKEN 117
             K+L++SIP+ +  DI +LE FL DY +L+   N++I KLT   +YNHENHY+++D  N
Sbjct: 59  -KKILLISIPDHIFSDINVLEIFLSDYFHLNDLSNIKIIKLTKFNVYNHENHYLLIDSVN 117

Query: 118 NFKNSNFLHFA 128
           NFK+  FL++ 
Sbjct: 118 NFKDETFLNYV 128

 Score = 92.0 bits (227), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 68/92 (73%), Gaps = 2/92 (2%)

Query: 297 SILPSISIA-DSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQF 355
           SILP +SI  ++ GH+RLVLQS+L  N  + ++ T +RQSNN    A+++DDW+LYD +F
Sbjct: 251 SILPCVSINNEAIGHYRLVLQSMLICNKENLDLQTGVRQSNNLINYANINDDWMLYDEKF 310

Query: 356 SMHNLQMLTLQDLSEL-NKGCPKVLFYSLVEV 386
           SM NL +L+L+DLS + N    K+LFYS+++V
Sbjct: 311 SMRNLNILSLKDLSIIGNVDSIKILFYSMIDV 342

>TBLA0D01660 Chr4 complement(409692..412292) [2601 bp, 866 aa] {ON}
           Anc_5.526 YML006C
          Length = 866

 Score =  136 bits (343), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 67/131 (51%), Positives = 90/131 (68%), Gaps = 8/131 (6%)

Query: 3   KSVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERKD- 61
           K V+V DY+ ND+NGLWSWYL+NIRNG FEELT N LK +L KRFL+   +  +N     
Sbjct: 7   KPVQVNDYYDNDNNGLWSWYLSNIRNGMFEELTENILKITLLKRFLKENFQQDINSTSQH 66

Query: 62  ----TKVLIVSIPEDVRRDITLLEYFLGDYL---NLDNMEITKLTTSRIYNHENHYVVMD 114
               TK+L  SIP+++ +D+ +LE  L DY    NLDN++I KLT +R YNHENHY++ D
Sbjct: 67  STNCTKILFTSIPDNIHQDLPILENLLKDYFDLDNLDNIQILKLTQNRCYNHENHYILKD 126

Query: 115 KENNFKNSNFL 125
             +NF N++F 
Sbjct: 127 ILDNFGNTSFF 137

 Score =  117 bits (294), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 72/94 (76%)

Query: 298 ILPSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSM 357
           ILPSISI+DS GHFRLVLQ +L  +P + + +TAIRQS++    AD+ DDWLLYD +FSM
Sbjct: 499 ILPSISISDSLGHFRLVLQCILIYHPHAEKTYTAIRQSDSNRDVADIQDDWLLYDLKFSM 558

Query: 358 HNLQMLTLQDLSELNKGCPKVLFYSLVEVVDTPS 391
            NL++LTLQ+L + N+  PK+LFY+LV + D  S
Sbjct: 559 DNLEILTLQELLDFNRDYPKILFYTLVAINDNSS 592

>ADR198C Chr4 complement(1046482..1048131) [1650 bp, 549 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML006C
           (GIS4)
          Length = 549

 Score =  129 bits (323), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 109/382 (28%), Positives = 169/382 (44%), Gaps = 64/382 (16%)

Query: 14  DDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLR-TYLEPTLNERKDTKVLIVSIPED 72
           D +GLWSWYL N+R G FE+L  ++ ++S  K FLR  +   T  ER   ++ ++S P  
Sbjct: 4   DYHGLWSWYLGNLRKGRFEQLVGDEARYSQLKAFLRDCFAHSTGQER---RLQLLSFPAS 60

Query: 73  VRRDITLLEYFLGDYLNLDNMEITKLTTSRIYNHENHYVVMDKENNFKNSNFLHFASTNI 132
           V  D  +LE F+    N+ ++ I ++  +     E HY+V        + N++  A    
Sbjct: 61  VPCDYKILEEFIRQQGNI-SVAIPRVHAT---GTEKHYLV--------DGNYMVHA---- 104

Query: 133 QTGKGFTGGELAGTTVAAQAEKNISPTESAKFRAGQGLEPSDDTEGDEESLVFNFTHRDH 192
                  G  LA T        ++S  E ++  +G              SLVF+F  R  
Sbjct: 105 -----LEGCNLALTENEPFYTDSMSIEERSEIVSGM-------------SLVFDFKPRFE 146

Query: 193 HLTHPLRANGKEQEEAVGVSPSWNPQQQQR-----LQEHNASNDEMASIDSYNLGSNSSR 247
           H T                    NP    R     +   +  +   + +D  ++ SN S 
Sbjct: 147 HSTS-------------------NPVHSMRSSSSEMHSGSVRDAAFSGLDDMSIRSNES- 186

Query: 248 VVESFKGEPLTLTMTRTEDFXXXXXXXXXXXXXXXXXXXXXXXXXXXLMSILPSISIADS 307
             ESF G+ L   +T   D                              S+ PS+SI + 
Sbjct: 187 -CESFSGQELVRVLTHEGDSQEYQCDSTETRIFRESYSDISSLSQFSNHSVFPSLSITND 245

Query: 308 FGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNLQMLTLQD 367
           F  FR+VLQS+L  +   + I TA+RQ NN P  A+  DD LLYD++ S+   ++L+L D
Sbjct: 246 FSKFRVVLQSILVYDCEKDRINTAVRQYNNNPNIANCSDDCLLYDNKISLITFRILSLVD 305

Query: 368 LSELNKGCPKVLFYSLVEVVDT 389
           L ELN+  PK+LFYS+ E+ ++
Sbjct: 306 LMELNRAHPKMLFYSVAEIFNS 327

>Kpol_1023.99 s1023 complement(232194..233849) [1656 bp, 551 aa]
           {ON} complement(232194..233849) [1656 nt, 552 aa]
          Length = 551

 Score =  117 bits (293), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 51/90 (56%), Positives = 72/90 (80%)

Query: 297 SILPSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFS 356
           ++LP++++ D + +F+LVLQS+L  N  S+E+ TAIRQSNN+   AD+DDDWLLYDS+FS
Sbjct: 246 TVLPTVNLPDPYANFQLVLQSILIYNSDSDELITAIRQSNNEQDSADIDDDWLLYDSKFS 305

Query: 357 MHNLQMLTLQDLSELNKGCPKVLFYSLVEV 386
           M NLQ+L+L +L  +NK  PK+LFYSLV +
Sbjct: 306 MTNLQILSLNELLHINKDYPKILFYSLVSI 335

 Score = 39.3 bits (90), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 39/166 (23%), Positives = 72/166 (43%), Gaps = 32/166 (19%)

Query: 18  LWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERKDTKVL-IVSIPEDVRRD 76
           +W+WYL ++RNG FEE+  N+  + L K  L   ++   N  K  K+  ++SI  +   +
Sbjct: 15  VWTWYLCHVRNGSFEEILGNEDYYKLLKNNL---VDDVFNIDKGNKIFKLISI--NYLNN 69

Query: 77  ITLLEYFLGDYLNLDNMEITKLTTSRIYNHENHYVVMDKENNFKNSNFLHFASTNIQTGK 136
             LL+Y+           I K T           ++++K N+ +    LH+   N   G 
Sbjct: 70  NILLDYY---------NNIVKKTL----------LLLNKSNSIE----LHYLVIN---GT 103

Query: 137 GFTGGELAGTTVAAQAEKNISPTESAKFRAGQGLEPSDDTEGDEES 182
                +   +++A+  E N  P  S+   A      +D+ +   +S
Sbjct: 104 SSHSNDDTNSSIASSIEINFKPKLSSSLNANAITSVNDNQKKSNQS 149

>TPHA0K00540 Chr11 complement(107389..109416) [2028 bp, 675 aa] {ON}
           Anc_5.526 YML006C
          Length = 675

 Score = 99.0 bits (245), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 67/90 (74%)

Query: 295 LMSILPSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQ 354
           L+S+LPSI + +S+G F+LVLQS++ IN  S E FTA+RQSN+   +A  DD+WLLYDS+
Sbjct: 323 LLSLLPSIEMQNSYGEFKLVLQSMILINFESGESFTAVRQSNSLIHEATEDDEWLLYDSK 382

Query: 355 FSMHNLQMLTLQDLSELNKGCPKVLFYSLV 384
           FSM NL+++TL  L ++     K+ FYS+V
Sbjct: 383 FSMDNLEIVTLNYLMDIYADFVKIFFYSMV 412

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 61/121 (50%), Gaps = 22/121 (18%)

Query: 17  GLWSWYLTNIRNGDFEELTRNQLKH-SLFKRF---LRTYLEPTLNERKDT-----KVLIV 67
            LW+WYL  IRNG+FEEL + + K+ S+  +    L+T+      E +D       +L +
Sbjct: 14  SLWTWYLNCIRNGEFEELLKEEDKYRSILNKIRETLQTHARNIEMEEEDANISDGNILFL 73

Query: 68  SIPEDVRRDITLLEYFLGDYLNLDNMEITKLTTSRIYN-----------HENHYVVMDKE 116
           S+   + +D  +++ FL D  N  N++++ +    I N           HE +Y+V+D  
Sbjct: 74  SLHYTLDKDKEIIDDFLVD--NFPNVDLSNIVIREICNNNINSEHFKKDHETYYMVIDSL 131

Query: 117 N 117
           N
Sbjct: 132 N 132

>NDAI0H01590 Chr8 (385963..387078) [1116 bp, 371 aa] {ON} 
          Length = 371

 Score = 82.4 bits (202), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 58/86 (67%)

Query: 298 ILPSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSM 357
           ++PSIS    +G  R VLQS++F +  + E+ TAIRQS+     A   D+WLLYDS FS+
Sbjct: 282 VVPSISCHHPYGQIRFVLQSIVFKSVRTAELLTAIRQSSADRIVATSSDEWLLYDSDFSL 341

Query: 358 HNLQMLTLQDLSELNKGCPKVLFYSL 383
           +NL++ TLQD+   N   P++LFY++
Sbjct: 342 NNLEISTLQDILYPNYENPRILFYTM 367

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 59/117 (50%), Gaps = 10/117 (8%)

Query: 9   DYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERKD---TKVL 65
           D    DDN + SWYL N+R G FE +  ++ K+      L T L+  L + K    T  +
Sbjct: 4   DNIKKDDNEVLSWYLRNLREGRFENIIEDRAKN----YHLNTILDRQLFDNKQYGATNKI 59

Query: 66  IVSIPEDVRRDITLLEYFLG---DYLNLDNMEITKLTTSRIYNHENHYVVMDKENNF 119
           +VS    +   +++ + FLG   D+  L  +E+ +L + +  N E HY + D  N+F
Sbjct: 60  LVSTLTSIDEIVSIKDIFLGQLFDHERLQYIEVEELKSLKGDNKETHYFLTDHLNSF 116

>NCAS0F01080 Chr6 (214243..215382) [1140 bp, 379 aa] {ON} Anc_5.526
           YML006C
          Length = 379

 Score = 79.3 bits (194), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 56/88 (63%)

Query: 299 LPSISIADSFGHFRLVLQSVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMH 358
           +P+ + +   G  R VL S+L  N  S E FTAIRQ ++ P  A++ D+WLLYDS+FS+ 
Sbjct: 290 IPTQTFSYKSGQLRFVLHSLLIQNAQSKETFTAIRQRSSDPNTANILDEWLLYDSKFSLD 349

Query: 359 NLQMLTLQDLSELNKGCPKVLFYSLVEV 386
           NL+M TLQD+   NKG   +L Y  + +
Sbjct: 350 NLEMGTLQDILLSNKGNSMLLLYKTILI 377

 Score = 52.0 bits (123), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 25/118 (21%), Positives = 62/118 (52%), Gaps = 6/118 (5%)

Query: 11  FSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERKDTKVLIVSIP 70
           + +D + +WSWYL+N+++G+FE L    ++    + + ++         + +K +++S+P
Sbjct: 9   YPDDIDDMWSWYLSNLQSGNFEALVNGSVRQQHLEAYFKSQFTSG---NEGSKKILLSVP 65

Query: 71  EDVRRDITLLEYFLGDYLN---LDNMEITKLTTSRIYNHENHYVVMDKENNFKNSNFL 125
             + +++++   FLG   N   L  + + + + S     + HY++ D  + F  + F+
Sbjct: 66  SMLCQEVSIKRLFLGSIFNEERLQYINVMEFSKSPKQTEKKHYLLTDALSGFNEAAFI 123

>KNAG0C03240 Chr3 complement(634593..635567) [975 bp, 324 aa] {ON}
          
          Length = 324

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 33/68 (48%)

Query: 7  VGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTYLEPTLNERKDTKVLI 66
          VG     + N  W WY+ N+  G+FEEL  N +K +    FL  Y       +   ++L+
Sbjct: 9  VGKNQCRESNNFWFWYIDNLVAGNFEELNDNLIKRNQLCSFLAHYFGGKQTTKLQRRLLL 68

Query: 67 VSIPEDVR 74
          V+ P  +R
Sbjct: 69 VTSPYGLR 76

 Score = 36.2 bits (82), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 32/52 (61%), Gaps = 8/52 (15%)

Query: 317 SVLFINPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNLQMLTLQDL 368
           S+L  +  S +++ A+RQ          DDDW++YD+ FS++NL+   L+D+
Sbjct: 263 SLLGKDDASGKLWHAVRQLQ--------DDDWVIYDADFSLNNLENCKLEDI 306

>TBLA0G00940 Chr7 complement(228909..231257) [2349 bp, 782 aa] {ON} 
          Length = 782

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/78 (30%), Positives = 39/78 (50%), Gaps = 8/78 (10%)

Query: 312 RLVLQSVLF--INPTSNEIFTAIRQSNNKPTKADVDDDWLLYDSQFSMHNLQMLTLQDLS 369
           R+ L  ++   I  T+ + FTAI++ N   +K      WL++DS F     Q+++   L 
Sbjct: 564 RMNLNCIILKKIGNTNGDFFTAIKEYNELYSK------WLIFDSTFQTEKSQLVSFDKLL 617

Query: 370 ELNKGCPKVLFYSLVEVV 387
           E+ K   K+ FYS    V
Sbjct: 618 EIAKSFSKIFFYSYNNTV 635

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 57/125 (45%), Gaps = 15/125 (12%)

Query: 14  DDN----GLWSWYLTNIRNGDFEELT--RNQLKHS--LFKRFLRTYLEPTLNERKDTKVL 65
           DDN     LW+WYL NI    F E     N+ K+S        + +    +N +K   ++
Sbjct: 13  DDNDIEYNLWTWYLNNIEEKTFHEFNEIENKEKYSKLKKLIDKKLFTVTNINTKKVKNII 72

Query: 66  IVSIPEDVRRDITLLEYFLGDYLNLDNMEITKLTTSRIYNHE------NHYVVMDKENNF 119
            +++P+          ++L  YL L    + +L  +++ N+       N+ ++MD   NF
Sbjct: 73  FLTLPKTKNFQTRDSYFYLQKYLELI-FSVQQLYITKLQNNTSTTPSCNYCLIMDPILNF 131

Query: 120 KNSNF 124
           +N+ F
Sbjct: 132 QNTTF 136

>CAGL0J05610g Chr10 complement(534283..538503) [4221 bp, 1406 aa]
           {ON}
          Length = 1406

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 81/198 (40%), Gaps = 33/198 (16%)

Query: 4   SVRVGDYFSNDDNGLWSWYLTNIRNGDFEELTRNQLKHSLFKRFLRTY-----LEPTLNE 58
           S  + +YFSN D  L  ++     + D  +L  ++ K    K +LR Y     L+PTLNE
Sbjct: 608 SPEIIEYFSNLDTHLKKFHALQGDDKDLIDLAFSKKKADDRKEWLRQYEPGTVLDPTLNE 667

Query: 59  RK-----DTKVLIVSIPEDVRRDITLLEYFL-GDYLNLDNMEITKLTTSR---------- 102
                  + ++++ S+ ++VR   ++L+ F  G    L       LTT +          
Sbjct: 668 IPISDFINKELILFSLADNVRSIPSVLDGFKPGQRKVLYTCFKKNLTTEKKVANLAPAVS 727

Query: 103 ---IYNHENHYVV---MDKENNFKNSNFLHFASTNIQTGKGFTGGELAG------TTVAA 150
               Y+H    +V   +    NF  +N ++F   N   G   TGG+ A       T +  
Sbjct: 728 DYTAYHHGEQALVQTIIGMAQNFVGTNNIYFLKPNGAFGTRATGGKDAAAARYIYTELNK 787

Query: 151 QAEKNISPTESAKFRAGQ 168
            A K   P +   FR  Q
Sbjct: 788 IARKVFHPADDPLFRYVQ 805

>NCAS0B00240 Chr2 complement(24051..25661) [1611 bp, 536 aa] {ON}
           Anc_8.854
          Length = 536

 Score = 31.2 bits (69), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 28/54 (51%), Gaps = 12/54 (22%)

Query: 102 RIYNHENHYVVMDKENNFKNSNFLHF----------ASTNIQTGKG--FTGGEL 143
           ++ N +N Y ++ +EN FK  N++HF          A  NI  GK   +TGG L
Sbjct: 442 KLANRKNKYDLLFEENKFKKFNYIHFGALAYLGSEKAIANITYGKRSLYTGGGL 495

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.131    0.383 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,219,899
Number of extensions: 2497251
Number of successful extensions: 9359
Number of sequences better than 10.0: 53
Number of HSP's gapped: 9635
Number of HSP's successfully gapped: 89
Length of query: 548
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 433
Effective length of database: 40,294,809
Effective search space: 17447652297
Effective search space used: 17447652297
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)