Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D12496g5.524ON2385199973020.0
TDEL0A038805.524ON16966578979e-97
SAKL0G04862g5.524ON24445745971e-60
ADR200C5.524ON23386375737e-58
Suva_2.5975.524ON17975205592e-56
Smik_4.6955.524ON15555715314e-53
YDR420W (HKR1)5.524ON18025205314e-53
KLLA0A01826g5.524ON14644974402e-42
Kwal_47.186505.524ON21593184081e-38
KAFR0E033205.524ON11903313934e-37
KNAG0C032605.524ON15305193928e-37
KLTH0G03696g5.524ON20854483848e-36
Skud_4.6945.524ON15042473675e-34
CAGL0F03003g5.524ON11852343576e-33
Ecym_40605.524ON22013213552e-32
SAKL0H23188g4.150ON12622073452e-31
ZYRO0G11242g4.150ON14872153301e-29
AGR019C4.150ON11052143031e-26
KLLA0C17985g4.150ON9082562993e-26
TDEL0D030104.150ON11232052986e-26
Suva_7.2964.150ON11352032977e-26
YGR014W (MSB2)4.150ON13062032978e-26
Skud_7.2994.150ON11694362852e-24
Smik_7.3024.150ON11892402834e-24
KLTH0E08844g4.150ON15203072834e-24
Kwal_47.177034.150ON15683112801e-23
KAFR0F034704.150ON9493752762e-23
NCAS0A052304.150ON7852992743e-23
Kpol_363.145.524ON7612562724e-23
NDAI0K025804.150ON9852212682e-22
TPHA0K013904.150ON8262002645e-22
KNAG0D035904.150ON9942022621e-21
Ecym_73494.150ON11293212602e-21
TBLA0G012104.150ON18252032404e-19
Kpol_1062.374.150ON9731982281e-17
CAGL0F08833g4.150ON9362501832e-12
TPHA0L003605.524ON11614141823e-12
TBLA0G009505.524ON22531361717e-11
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D12496g
         (2385 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} som...  2817   0.0  
TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5....   350   9e-97
SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some ...   234   1e-60
ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON...   225   7e-58
Suva_2.597 Chr2 (1058501..1059391,1059470..1059725,1059765..1059...   219   2e-56
Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR42...   209   4e-53
YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Muc...   209   4e-53
KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] ...   174   2e-42
Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] ...   161   1e-38
KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {...   155   4e-37
KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {...   155   8e-37
KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some ...   152   8e-36
Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR42...   145   5e-34
CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some ...   142   6e-33
Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar ...   141   2e-32
SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} som...   137   2e-31
ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakl...   131   1e-29
AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON} ...   121   1e-26
KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa]...   119   3e-26
TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {...   119   6e-26
Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W...   119   7e-26
YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin...   119   8e-26
Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W...   114   2e-24
Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W...   113   4e-24
KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some ...   113   4e-24
Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR04...   112   1e-23
KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.1...   110   2e-23
NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4...   110   3e-23
Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {...   109   4e-23
NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {...   107   2e-22
TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {...   106   5e-22
KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.1...   105   1e-21
Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON...   104   2e-21
TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4....    97   4e-19
Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {O...    92   1e-17
CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly...    75   2e-12
TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {O...    75   3e-12
TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {...    70   7e-11

>ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2385

 Score = 2817 bits (7302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1519/1999 (75%), Positives = 1519/1999 (75%)

Query: 387  ITPASSSVPVSGSRLFSSSTHASGSNSLTSTEKSALDPGTSTNAGTASKSILLXXXXXXX 446
            ITPASSSVPVSGSRLFSSSTHASGSNSLTSTEKSALDPGTSTNAGTASKSILL       
Sbjct: 387  ITPASSSVPVSGSRLFSSSTHASGSNSLTSTEKSALDPGTSTNAGTASKSILLSGSYPTG 446

Query: 447  XXXXXXXXXAIESLSSKAPVSSLGNSIRSFSLWPSTXXXXXXXXXXXXXXXXXTANSDTL 506
                     AIESLSSKAPVSSLGNSIRSFSLWPST                 TANSDTL
Sbjct: 447  DSPSGTTSSAIESLSSKAPVSSLGNSIRSFSLWPSTSEASSNSFSQGSSGPTSTANSDTL 506

Query: 507  TDSSRNSAFPSYXXXXXXXXXXXXXXXXXXXXXXXLQSSSAQWAGSLQSSSQAPNPTTSY 566
            TDSSRNSAFPSY                       LQSSSAQWAGSLQSSSQAPNPTTSY
Sbjct: 507  TDSSRNSAFPSYSTKSSNSELASSSSPEPAIATSSLQSSSAQWAGSLQSSSQAPNPTTSY 566

Query: 567  SNSGSITHSSIAAAEKSATFSNFPNDNSFLSKSSNGATTXXXXXXXXXXXXXXXXXXXXD 626
            SNSGSITHSSIAAAEKSATFSNFPNDNSFLSKSSNGATT                    D
Sbjct: 567  SNSGSITHSSIAAAEKSATFSNFPNDNSFLSKSSNGATTSSAPNFESSSSAAPSLSLNFD 626

Query: 627  LSYNGLKIGGGASSGSRTSFASNSITSLGTASEKSSSYTASVSNFPSETSSEQSIXXXXX 686
            LSYNGLKIGGGASSGSRTSFASNSITSLGTASEKSSSYTASVSNFPSETSSEQSI     
Sbjct: 627  LSYNGLKIGGGASSGSRTSFASNSITSLGTASEKSSSYTASVSNFPSETSSEQSIGSKKS 686

Query: 687  XXXXXDPATVESFSGTTNLPTSPSKTSSEGVTSSGQTTGEPXXXXXXXXXXXXXXXPGAS 746
                 DPATVESFSGTTNLPTSPSKTSSEGVTSSGQTTGEP               PGAS
Sbjct: 687  VVGSSDPATVESFSGTTNLPTSPSKTSSEGVTSSGQTTGEPTNSASSKSFSITTSSPGAS 746

Query: 747  FREPSSYTSNAPISSRGATGESSYAGTLGRPTNPXXXXXXXXXXXIPASKSRTTSVQDTX 806
            FREPSSYTSNAPISSRGATGESSYAGTLGRPTNP           IPASKSRTTSVQDT 
Sbjct: 747  FREPSSYTSNAPISSRGATGESSYAGTLGRPTNPTSSESSSQSTEIPASKSRTTSVQDTS 806

Query: 807  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDARTSTTPNTGGXXXXXXXXXXRDPIIF 866
                                           NDARTSTTPNTGG          RDPIIF
Sbjct: 807  FRQSSASSSNIASGESSLHTTSASISSSGISNDARTSTTPNTGGSSYKSSSASSRDPIIF 866

Query: 867  PITPSRGSSALSTSSDQHTVVSSDATSGKPXXXXXXXXXXXXXDNVSSGSFSRPLTSPAS 926
            PITPSRGSSALSTSSDQHTVVSSDATSGKP             DNVSSGSFSRPLTSPAS
Sbjct: 867  PITPSRGSSALSTSSDQHTVVSSDATSGKPSSYTTSTPFSSSTDNVSSGSFSRPLTSPAS 926

Query: 927  SANEYSTQETSSGENTAERSNTASGGLSSEIPASTSRTTSVQXXXXXXXXXXXXXXXXXX 986
            SANEYSTQETSSGENTAERSNTASGGLSSEIPASTSRTTSVQ                  
Sbjct: 927  SANEYSTQETSSGENTAERSNTASGGLSSEIPASTSRTTSVQDTSFRQSSSSSSNIVSGE 986

Query: 987  XXXHTTSAPISSSGISNEARTSTTPNTGGXXXXXXXXXXRDPIIFPITPSRESSALGTSS 1046
               HTTSAPISSSGISNEARTSTTPNTGG          RDPIIFPITPSRESSALGTSS
Sbjct: 987  SSLHTTSAPISSSGISNEARTSTTPNTGGSSYKSSSASSRDPIIFPITPSRESSALGTSS 1046

Query: 1047 DQHTVVSSDATSGKPXXXXXXXXXXXXXDNVSSGXXXXXXXXXXXXXXXXXTQETSSGEN 1106
            DQHTVVSSDATSGKP             DNVSSG                 TQETSSGEN
Sbjct: 1047 DQHTVVSSDATSGKPSSYTTSTPFSSSTDNVSSGSFSRSLTSPASSASEYSTQETSSGEN 1106

Query: 1107 TASRESYSNTPSVPISQSFFGKXXXXXXXXXXXXXXXNFPAFSSKTSSEQNSRASTKSSS 1166
            TASRESYSNTPSVPISQSFFGK               NFPAFSSKTSSEQNSRASTKSSS
Sbjct: 1107 TASRESYSNTPSVPISQSFFGKTSASSSNPTTSSYVSNFPAFSSKTSSEQNSRASTKSSS 1166

Query: 1167 NLAQXXXXXXXXXXQVRSGISNQIESSSTAHSKSANEINTSPFAXXXXXXXXXXXXXXXX 1226
            NLAQ          QVRSGISNQIESSSTAHSKSANEINTSPFA                
Sbjct: 1167 NLAQSLTSTSDSLTQVRSGISNQIESSSTAHSKSANEINTSPFATESSFTGESSKSTPSS 1226

Query: 1227 XXXXXXXXXXXLQPNXXXXXXXXXXXXXXXXGELGFTRXXXXXXXXXXXXXXXXIKLTET 1286
                       LQPN                GELGFTR                IKLTET
Sbjct: 1227 SAYKGEGSSSSLQPNTLLQSSGSSASSGTSQGELGFTRSESVVSSSRSPYSSQSIKLTET 1286

Query: 1287 ASHSGSFMGTXXXXXXXXXXXXXQRSELLSNYPNTGPTSLTSDSQVEXXXXXXXXXXXXX 1346
            ASHSGSFMGT             QRSELLSNYPNTGPTSLTSDSQVE             
Sbjct: 1287 ASHSGSFMGTGSSIPLNSISGSSQRSELLSNYPNTGPTSLTSDSQVESSTLTGLLSSTPS 1346

Query: 1347 RIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNAMSTSTPASSMIASSRP 1406
            RIG                                       NAMSTSTPASSMIASSRP
Sbjct: 1347 RIGASTLLSSPTSTSSSGTAAEHASSHASLTSYETSSSLEPSNAMSTSTPASSMIASSRP 1406

Query: 1407 YXXXXXXXXXXXXXXXXTTAAETSQSLESGSVSAPTNLASQFSSQPTRLXXXXXXXXXXX 1466
            Y                TTAAETSQSLESGSVSAPTNLASQFSSQPTRL           
Sbjct: 1407 YSGILMSGSSKSSVMESTTAAETSQSLESGSVSAPTNLASQFSSQPTRLSSSYISTETSS 1466

Query: 1467 PVTGTQXXXXXXXXXXXXXXESSTYSRSGFVTTEKASSETLSSLSTRGELSSLFENTSKG 1526
            PVTGTQ              ESSTYSRSGFVTTEKASSETLSSLSTRGELSSLFENTSKG
Sbjct: 1467 PVTGTQISSRLVRSSGISSLESSTYSRSGFVTTEKASSETLSSLSTRGELSSLFENTSKG 1526

Query: 1527 TTTQSSNSLMTAMGSSSQTMAPSEASGQHTKTVSSRSNLESQIXXXXXXXXXXXLVPVST 1586
            TTTQSSNSLMTAMGSSSQTMAPSEASGQHTKTVSSRSNLESQI           LVPVST
Sbjct: 1527 TTTQSSNSLMTAMGSSSQTMAPSEASGQHTKTVSSRSNLESQISSPSSLHTGSSLVPVST 1586

Query: 1587 DVSDQSTRTLSTPIPDASASSTEISTSDTNDVSSLVSPSTITNIGSSVPSATSAPTESNT 1646
            DVSDQSTRTLSTPIPDASASSTEISTSDTNDVSSLVSPSTITNIGSSVPSATSAPTESNT
Sbjct: 1587 DVSDQSTRTLSTPIPDASASSTEISTSDTNDVSSLVSPSTITNIGSSVPSATSAPTESNT 1646

Query: 1647 NWLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQIDYDF 1706
            NWLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQIDYDF
Sbjct: 1647 NWLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQIDYDF 1706

Query: 1707 LVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKTTTLQPYRDVMVRTNK 1766
            LVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKTTTLQPYRDVMVRTNK
Sbjct: 1707 LVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKTTTLQPYRDVMVRTNK 1766

Query: 1767 KHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTN 1826
            KHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTN
Sbjct: 1767 KHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTN 1826

Query: 1827 PTLFALADLIDPSIPLTGMVXXXXXXXXXXXXXXXXXXXXHASQSPHSFQNGNEDNGNLE 1886
            PTLFALADLIDPSIPLTGMV                    HASQSPHSFQNGNEDNGNLE
Sbjct: 1827 PTLFALADLIDPSIPLTGMVDDNGDVNNGGSGSGSSGEGNHASQSPHSFQNGNEDNGNLE 1886

Query: 1887 TANSTSHITGVITKRLAIFLNCFAFGVLLWILSFLFIFRKIRKVQPPEEGESYAELDTSG 1946
            TANSTSHITGVITKRLAIFLNCFAFGVLLWILSFLFIFRKIRKVQPPEEGESYAELDTSG
Sbjct: 1887 TANSTSHITGVITKRLAIFLNCFAFGVLLWILSFLFIFRKIRKVQPPEEGESYAELDTSG 1946

Query: 1947 DVLKLPSGSGEDNASGSSSGPQFFQEKATNNDSQNQETVDRNATPKLENSNEGIGGNAQS 2006
            DVLKLPSGSGEDNASGSSSGPQFFQEKATNNDSQNQETVDRNATPKLENSNEGIGGNAQS
Sbjct: 1947 DVLKLPSGSGEDNASGSSSGPQFFQEKATNNDSQNQETVDRNATPKLENSNEGIGGNAQS 2006

Query: 2007 PISDDLIVTGENTVYSTLHGLEYFVDEDGQFHYAGNRQISDESGTTKDEHDEIDDFDKYM 2066
            PISDDLIVTGENTVYSTLHGLEYFVDEDGQFHYAGNRQISDESGTTKDEHDEIDDFDKYM
Sbjct: 2007 PISDDLIVTGENTVYSTLHGLEYFVDEDGQFHYAGNRQISDESGTTKDEHDEIDDFDKYM 2066

Query: 2067 YAGSEEMSVHVSEAPEVDMSSLEVDEEGNFVLMNDEIYDNLQENSRSGSGNKNSDTVESY 2126
            YAGSEEMSVHVSEAPEVDMSSLEVDEEGNFVLMNDEIYDNLQENSRSGSGNKNSDTVESY
Sbjct: 2067 YAGSEEMSVHVSEAPEVDMSSLEVDEEGNFVLMNDEIYDNLQENSRSGSGNKNSDTVESY 2126

Query: 2127 NNNHLYKMTRSSDSEGVTKDAFLSSDEGSPEIYGYGTEAGDEYMIPSSVHDYGNLEPATD 2186
            NNNHLYKMTRSSDSEGVTKDAFLSSDEGSPEIYGYGTEAGDEYMIPSSVHDYGNLEPATD
Sbjct: 2127 NNNHLYKMTRSSDSEGVTKDAFLSSDEGSPEIYGYGTEAGDEYMIPSSVHDYGNLEPATD 2186

Query: 2187 YDQYYSPPYMIGSSTDDTNNNGLTDLPLDFDEYMYQEGDGDAPYISXXXXXXXXXXXXGK 2246
            YDQYYSPPYMIGSSTDDTNNNGLTDLPLDFDEYMYQEGDGDAPYIS            GK
Sbjct: 2187 YDQYYSPPYMIGSSTDDTNNNGLTDLPLDFDEYMYQEGDGDAPYISDMDDVRIEDIDDGK 2246

Query: 2247 VXXXXXXXXXXXXEEMYQRLSKIMIERSIARNRATGQSNIGVPENFRKTNVPPMPFIXXX 2306
            V            EEMYQRLSKIMIERSIARNRATGQSNIGVPENFRKTNVPPMPFI   
Sbjct: 2247 VDDLQIDDFDDLDEEMYQRLSKIMIERSIARNRATGQSNIGVPENFRKTNVPPMPFISSA 2306

Query: 2307 XXXXTDTTGMITSSSKPNFNSYAATTDTITNAPDRSIQGASTSMIGSTKSKSKRKLSGGE 2366
                TDTTGMITSSSKPNFNSYAATTDTITNAPDRSIQGASTSMIGSTKSKSKRKLSGGE
Sbjct: 2307 SAASTDTTGMITSSSKPNFNSYAATTDTITNAPDRSIQGASTSMIGSTKSKSKRKLSGGE 2366

Query: 2367 SRKLSISGPIESRNSLGWY 2385
            SRKLSISGPIESRNSLGWY
Sbjct: 2367 SRKLSISGPIESRNSLGWY 2385

 Score =  393 bits (1010), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/257 (78%), Positives = 202/257 (78%)

Query: 1   MVPHMLIRHVWLLLFCWTLVQALSGSIGLPFGNTNGNSYNLAGSSAQTTGSNEGDDVSSN 60
           MVPHMLIRHVWLLLFCWTLVQALSGSIGLPFGNTNGNSYNLAGSSAQTTGSNEGDDVSSN
Sbjct: 1   MVPHMLIRHVWLLLFCWTLVQALSGSIGLPFGNTNGNSYNLAGSSAQTTGSNEGDDVSSN 60

Query: 61  IVTSSTAYTSADPSTSNQATPSTSNDNTQNNQXXXXXXXXXXXXXXXVLSRITSSIGSTG 120
           IVTSSTAYTSADPSTSNQATPSTSNDNTQNNQ               VLSRITSSIGSTG
Sbjct: 61  IVTSSTAYTSADPSTSNQATPSTSNDNTQNNQDGSSTFDSGPSGSSPVLSRITSSIGSTG 120

Query: 121 NTPFPSSTGDYLHASYGGNSVLNSPESSGSSYVSKTSNSISGPTPKHQLASSNGFNXXXX 180
           NTPFPSSTGDYLHASYGGNSVLNSPESSGSSYVSKTSNSISGPTPKHQLASSNGFN    
Sbjct: 121 NTPFPSSTGDYLHASYGGNSVLNSPESSGSSYVSKTSNSISGPTPKHQLASSNGFNSDSA 180

Query: 181 XXXXXXXXLPHTDSLSGGEFTTQDDRXXXXXXXXXXXXXXNTEPANSFTSSSGTLPASGX 240
                   LPHTDSLSGGEFTTQDDR              NTEPANSFTSSSGTLPASG 
Sbjct: 181 GSSETSASLPHTDSLSGGEFTTQDDRSQQSGSSSGSASASNTEPANSFTSSSGTLPASGS 240

Query: 241 XXXXXXXXXXXXXPIGL 257
                        PIGL
Sbjct: 241 TPSNSSPTSNSQQPIGL 257

>TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5.524
            YDR420W
          Length = 1696

 Score =  350 bits (897), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 230/657 (35%), Positives = 346/657 (52%), Gaps = 70/657 (10%)

Query: 1646 TNWLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQIDYD 1705
            T WLP SI +QS P+ S   SF+P VTATLP  IAP T V  P N+S IT+GFK+ ++Y+
Sbjct: 1067 TFWLPSSIQVQSDPTRSGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYE 1126

Query: 1706 FLVNNPLSSAQIFTFLPDVLIYPFNYDQNID-----KGTHTNESSHYKRKTTTLQP---Y 1757
            FLV++  ++AQIF FLP VL +PF  +   D     +GT    S  +   TTTL P   +
Sbjct: 1127 FLVSSSTTAAQIFHFLPFVLSFPFEENGTKDFSYKRRGTLLVSSFEFN-NTTTLMPAQFH 1185

Query: 1758 RDVMVRTNKKHKVQM-ISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKN 1816
            ++ +   +K+   +   + + V VIQIMPM+ +D++YL ++A LYFP+ YV++L+  + +
Sbjct: 1186 QETVTGISKRSDSEFPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSELQSMVSD 1245

Query: 1817 SNSMLYNNTNPTLFALADLIDPSIPLTGMVXXXXXXXXXXXXXXXXXXXXHASQSPHSFQ 1876
              S L+NN +PTL ALA LIDPSIPLTG++                    H+  SP+  Q
Sbjct: 1246 DTSQLFNNPDPTLDALAALIDPSIPLTGLI----DGSTGSLNGGNPSTQSHSPSSPYKSQ 1301

Query: 1877 NGNEDNGNLETANSTSHITGVITKRLAIFLNCFAFGVLLWILSFLFIFRKI--------R 1928
            + ++++G+L TA + S ++  + KRL I+L C  FG LLWIL F+F+++ +        R
Sbjct: 1302 SSDDNSGSLGTA-TNSGLSSAVKKRLVIYLTCLVFGTLLWILVFMFLYKHLYGGRVIAKR 1360

Query: 1929 KVQ---PPEEGESYAELDTSGDVLKLPSGSGEDNASGSSSGPQFFQEKATNNDSQNQETV 1985
              Q     EE + Y       D+  + S   E     S   P   QEK   + SQ+    
Sbjct: 1361 AYQRDAAQEEKQHY----NFADITSVHSAETEPANDKSDDVP---QEKDVASASQS---- 1409

Query: 1986 DRNATPKLENSNEGIGGNAQSPISDDLIVTGENTVYSTLHGLEYFVDEDGQFHYAGNRQ- 2044
             R + P+                  DL++TGENTVYS   GL+YFV EDG F+YAG  Q 
Sbjct: 1410 -RYSLPE------------------DLMITGENTVYSVSQGLQYFVAEDGSFYYAGPLQS 1450

Query: 2045 ISDESGTTKDEHDEIDDFDKYMYAGSEEMSVHVSEAPEVDMSSLEVDEEGNFVLMNDEIY 2104
             S+E+ TTK +  +I+D + Y+Y+  +E S+  +E    D+ SL++DEEGNFV+ +    
Sbjct: 1451 TSEENETTKGDSADIEDINDYLYSADQERSIVTNEQSSCDIGSLQIDEEGNFVVSDPSPN 1510

Query: 2105 DNLQENSRSGSGNKNSDTVESYNNNHLYKMTRSSDSEGVTKDAFLSSD-EGSPEIYGYGT 2163
            +   E + S     NS T+E YNNN+LYKMTR+ +S  ++   +L  D +G     G G 
Sbjct: 1511 EEEHEITSS-----NSATIELYNNNNLYKMTRTVNSNEISSPRYLDQDSQGEISDAGMGQ 1565

Query: 2164 EAGDEYMIPSSVHDYGNLEPATDYDQYYSPPYMIGSSTDDTNNNGLTDLPLD--FDEYMY 2221
            E   +++  S+  ++    P  D  + +    + G    D +NN +  LP +   DEY+Y
Sbjct: 1566 EGNPDFL-SSTEQNWHISSP--DESENFPGRSVFGFYGSDDSNNIVQSLPAENCIDEYLY 1622

Query: 2222 QEGDGDAPYISXXXXXXXXXXXXGKVXXXXXXXXXXXXEEMYQRLSKIMIERSIARN 2278
              GD D+  +                            EEMY+R SK+M ++    N
Sbjct: 1623 VSGDDDS--LLDSPLGVRIEEIDDDAVDVHVDDLDELDEEMYKRRSKLMTQQQRTEN 1677

>SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2444

 Score =  234 bits (597), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 178/574 (31%), Positives = 282/574 (49%), Gaps = 93/574 (16%)

Query: 1632 SSVPSATSAPTESNT----NWLPYSIIMQSTP-SPSSAPSFNPEVTATLPHAIAPQTPVS 1686
            S  PS+   P  ++T    NWLPYS+I++S   S  S+ + +   T+TLP AI P T V 
Sbjct: 1454 SVTPSSNDGPLHTSTISTHNWLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVP 1513

Query: 1687 EPPNSSTITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFN---------YDQNIDK 1737
            +P   S ITIGFK  ++Y FL+++PLSSAQIF+FLP VL YPF+           Q+I+ 
Sbjct: 1514 QPAGHSLITIGFKEALNYPFLISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEV 1573

Query: 1738 GT-----HTNESSHYKRKTTTLQPYRDVMV------------RTNKKH----------KV 1770
             T      T+ ++     + + Q Y  + +            RT++++          KV
Sbjct: 1574 MTLLQRRLTSSAAEIDTCSLSFQNYDKIQLVSVKLALLKSTNRTDQENNSLHRRSVNDKV 1633

Query: 1771 QM---------ISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSML 1821
             +         I  + + V QI+P++S   +Y+V+VAE+YFP   ++ L+  ++N NS L
Sbjct: 1634 SVMNSTSDSSNIDYSQIVVKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSEL 1693

Query: 1822 YNNTNPTLFALADLIDPSIPLTGMVXX--------XXXXXXXXXXXXXXXXXXHASQSPH 1873
            Y N   +L ALA LIDPS+PLTG+V                             +  S  
Sbjct: 1694 YKNPENSLKALASLIDPSVPLTGLVDSDGNSVTNEEGGNSGSSGSNSSGDSDPSSGGSGE 1753

Query: 1874 SFQNGNEDNGNLETANSTSH--ITGVITKRLAIFLNCFAFGVLLWILSFLFIFRKIRKVQ 1931
            S    N D   L + +  ++  ++  ITKRL I+L  F+F  +LWI+++L+  +++  ++
Sbjct: 1754 SQGGANGDGSALGSLDDGAYGKMSLAITKRLIIYLLVFSFVTILWIVAWLYFLKRLYGIE 1813

Query: 1932 PPEEGESYAELDTSGDVLKLPSGSGEDNASGSSSGPQFFQEKAT------NNDSQNQETV 1985
                          G  LK       ++ + SSS   F+           NN   + E  
Sbjct: 1814 ------------VIGKRLK------PNDKTWSSSPGAFYNHHYNSHYSDPNNPFYDPERS 1855

Query: 1986 DRNATPKLENSNEGIGGNAQSP-ISDDLIVTGENTVYSTLHGLEYFVDEDGQFHYAGNRQ 2044
             R      E  +       Q   + DDL+VTG+NTVYST  GL YF+DE+G ++YAG   
Sbjct: 1856 LREKCSFDERYDYDYDTEEQDGYLYDDLVVTGDNTVYSTSRGLSYFIDENGNYYYAGMDF 1915

Query: 2045 ISDESGTTKD--EHDEIDDFDKYMYAGSEEMS--VHVSEAPEVDMSSLEVDEEGNFVLMN 2100
            I +E+    +  +H+++   + ++Y G + ++    + E    D+++++VDEEGN  L +
Sbjct: 1916 IVNENEQANEFVDHNQLQSME-HIYEGHDSIAGGALIDEEGAFDINAVDVDEEGNIELPD 1974

Query: 2101 DEIYDNLQENSRSGSGNKNSDTVESYNNNHLYKM 2134
             +   N+        G K +DTVESYNNN  YKM
Sbjct: 1975 SDF--NVPTTVTDVEGGK-TDTVESYNNNQYYKM 2005

>ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR420W
            (HKR1)
          Length = 2338

 Score =  225 bits (573), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 193/637 (30%), Positives = 295/637 (46%), Gaps = 108/637 (16%)

Query: 1598 TPIPDASASSTEISTSDTNDVSSLVSPSTITNIGSSVPSATSAPTESNTNWLPYSIIMQS 1657
            TP    +A +TEI T+  N ++S  +P+     GSS   A S+     T+WLP +II +S
Sbjct: 1453 TPTNTVTAFNTEIPTTR-NSIASAPTPAA----GSSNAVAASSKVFEKTDWLPATIITES 1507

Query: 1658 TPS--PSSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQIDYDFLVNNPLSSA 1715
                 P++A +     T  LP AI PQ+ V        I+IGF + ++Y F+ +  LSSA
Sbjct: 1508 VQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNYVFVTSFALSSA 1567

Query: 1716 QIFTFLPDVLIYPFN---------YD----QNIDKGTHTNESSHYKRKTTTLQPYRDVMV 1762
            QIFTFLP VL YPF          +D    + +++    +  S   R TTTL  +    V
Sbjct: 1568 QIFTFLPPVLTYPFESHTEETVKIHDPTEKRQLERPPPVSFYSRASRDTTTLSSFTHSQV 1627

Query: 1763 RTNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLY 1822
               +K    +   + V V Q+ P +S ++ Y+  +A +YFP++ V KL++ + +S S LY
Sbjct: 1628 IAVQKETSDVPDLSFVKVKQLAPDVSEERGYIATLAHVYFPSKLVPKLQELILDSESPLY 1687

Query: 1823 NNTNPTLFALADLIDPSIPLTGMVXXXXXXXXXXXXXXXXXXXXHASQSPHSFQNG---- 1878
            NN +  L   A LIDP+I +  +                     H   +P   Q G    
Sbjct: 1688 NNPDVNLKIFASLIDPTIKVRII--------------------QHDRSNPRPAQGGGTSG 1727

Query: 1879 ----------NEDNGNLETANSTSHITGVITKRLAIFLNCFAFGVLLWILSFLFIFRKIR 1928
                      N  +G+L+ + S   IT  ITKRL IFL    FGV LW L FL++FR++ 
Sbjct: 1728 SDGYSPSGYANHGDGSLDNSKS-PKITFKITKRLLIFLTVLTFGVFLWRLVFLYLFRRLY 1786

Query: 1929 KVQPPEEGESYAELDTSGDVLKLPSGSGEDNASGSSSGPQFFQEKATNNDSQNQETVDRN 1988
            ++   +      E        K+P   G            F+  +  N  S  + +    
Sbjct: 1787 RINKVKSKIVLGE-------KKIPPSLG-----------LFYSHQFNNRLSDLKPSALYE 1828

Query: 1989 ATPKLEN--SNEGIGGNAQS-PISDDLIVTGENTVYSTLHGLEYFVDEDGQFHYAGNRQI 2045
              P+ ++  + +G  G+       DD+IVTGENTVYS   G+ Y +DE+G ++YAG    
Sbjct: 1829 GDPEKQDGTATDGSSGSVHGYATDDDIIVTGENTVYSLSQGIAYHIDEEGNYYYAGIDPF 1888

Query: 2046 SDESGTTKDEHDEIDDFDKYMYAGSEEMSVHVSEAPEVDMSSLEVDEEGNFVLMNDEIYD 2105
            +D     + E D        +Y  SE  SV+V+    +D  S ++ EE   +  N E+YD
Sbjct: 1889 TD---AFEQEAD-------CLYHESEVESVNVN---NLDHLSSDIKEENIDLDGNIELYD 1935

Query: 2106 NLQENSRSGSGNKNSDTVESYNNNHLYKM----TRSSDSEGVTKDAFLSSDEGSPEIY-- 2159
            +  +++      K ++T+E YNNN  YKM    T SS+ +G T    LSSD G+  ++  
Sbjct: 1936 SDFDHTSLDQVPKATETIEKYNNNQYYKMNTLITDSSNCQGNT--VALSSDYGTTSVHVE 1993

Query: 2160 --------GYGTEAGDEYMIPSSVHDYGNLEPATDYD 2188
                    G+    GD   IP +  DY       D+D
Sbjct: 1994 NVSNENSLGFIRLQGD---IPENYDDYLYEGDEDDFD 2027

>Suva_2.597 Chr2
            (1058501..1059391,1059470..1059725,1059765..1059812,
            1059849..1059854,1059891..1061045,1061361..1064398) [5394
            bp, 1797 aa] {ON} YDR420W (REAL)
          Length = 1797

 Score =  219 bits (559), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 184/520 (35%), Positives = 256/520 (49%), Gaps = 73/520 (14%)

Query: 1648 WLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQIDYDFL 1707
            WLP +II++ T S +S  SFNP +TA+LP+ IAP   V+EP N + ITIGF   ++Y FL
Sbjct: 1205 WLPTAIIVEPTKSDTSTTSFNPSITASLPNVIAPAIAVTEPANHTLITIGFTAGLNYVFL 1264

Query: 1708 VNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKR-------------KTTTL 1754
            V NPLSSAQIF FLP VL YPF+     D  +   ESS Y+               TTTL
Sbjct: 1265 VQNPLSSAQIFNFLPLVLKYPFS-----DTTSQQEESSTYEMGSSSFVLSYQSGSSTTTL 1319

Query: 1755 QPYRDV----MVRTNKKHKVQ--MISTAN----------VSVIQIMPMLSRDKSYLVAVA 1798
             P   V    +VR  KK   +  ++STAN          + V QI+PM+   +SY++AVA
Sbjct: 1320 SP-ESVSSIPIVRKKKKKGGKNSVMSTANLDLPSIGNSSIVVKQIVPMIDSSRSYVIAVA 1378

Query: 1799 ELYFPAQYVNKLKDYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGMVXXXXXXXXXXXX 1858
            E+YFP + ++ L++ + ++NS LYNN   +L  LA LID S+PL G+             
Sbjct: 1379 EVYFPTEAISSLQELILDTNSTLYNNPQTSLQTLAGLIDSSVPLGGLTLYGSNNGCSICD 1438

Query: 1859 XXXXXXXXHASQSPHSFQNGNEDN-GNLE--TANSTSHITGVITKRLAIFLNCFAFGVLL 1915
                        + +S +NG  +  G L+  T + T H+   ITKR  I+L C   GVLL
Sbjct: 1439 SSSSSVS--EVSNTNSTKNGGTNKYGALDDFTNSLTDHMPWRITKRFIIYLTCLTAGVLL 1496

Query: 1916 WILSFLFIFRKIRKVQPPEEGESYAELDTSGDVLKLPSGSGEDNASGSSSGPQFFQEKAT 1975
            W+L  LF FR  R V       +  E   + +  +   G G  + S SSS    + EK  
Sbjct: 1497 WLLLALFAFRH-RNVLLGRRPSNCIEKTPNNE--RGLEGVGV-STSRSSSDNHNYNEKKP 1552

Query: 1976 NNDSQNQETVDRNATPKLENSNEGIGGNAQSPISDDLIVTGENTVYSTLHGLEYFVDEDG 2035
            N +S++  +++                       D  I TGENTVYS  HGL Y VDEDG
Sbjct: 1553 NTESESFYSME----------------------DDQYIPTGENTVYSATHGLHYTVDEDG 1590

Query: 2036 QFHYAGNRQISDESGTTKDEHDEIDDFDKYMYAGSEEMSVHVSEAPEVDMSS-LEVDEEG 2094
               Y  +   +D     ++E   ID   +       + +  V    E  MSS L+VDE G
Sbjct: 1591 DLFYRKSMP-NDIDEINENEDSGIDSILRECVYDRHQDTTEVYLNDEESMSSILDVDENG 1649

Query: 2095 NFVLMNDEIYDNLQENSRSGSGNKNSDTVESYNNNHLYKM 2134
            N  L     YD+  E+      +   + +E YNN+H+YKM
Sbjct: 1650 NIRL-----YDSYSEDDEPNCPHLQEEVIEDYNNSHVYKM 1684

>Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR420W
            (REAL)
          Length = 1555

 Score =  209 bits (531), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 180/571 (31%), Positives = 273/571 (47%), Gaps = 79/571 (13%)

Query: 1607 STEISTSDTNDVSSLVSPSTITNIGSSVP--SATSAPTESNTN---WLPYSIIMQSTPSP 1661
            ST+IST     +++ V    I+N+ S  P  S  S   +S++N   WLP +II+QS+ + 
Sbjct: 925  STKIST---GTITTAVQTQVISNLESPTPVLSIYSTNLDSSSNSYAWLPTAIIVQSSETD 981

Query: 1662 SSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQIDYDFLVNNPLSSAQIFTFL 1721
            +S   FNP +T +LP+ I P    SEP N + IT+GF   ++Y FLV NPLSSAQIF FL
Sbjct: 982  TSTTLFNPTITGSLPNLIEPAVTASEPINHTLITVGFTAALNYVFLVQNPLSSAQIFNFL 1041

Query: 1722 PDVLIYPFNYDQNIDKGTHTNESSH---YKR--KTTTLQPYRD---VMVRTNKKHKVQM- 1772
            P VL YPF+   +  + ++   SS    Y+    TTTL P       +VR  KK   +  
Sbjct: 1042 PLVLKYPFSDTSSGVESSNGELSSFILSYRSGTSTTTLSPQSKSSLSIVRKKKKGDKEKP 1101

Query: 1773 -----------ISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSML 1821
                       I+ ++++V QI+PM+   K+Y++AVAE+YFP + V+ L++ + + NS L
Sbjct: 1102 PTSTMDLYFPSINASSIAVKQIVPMMDSSKAYIIAVAEVYFPTEAVSYLQELILDVNSTL 1161

Query: 1822 YNNTNPTLFALADLIDPSIPLTGMVXXXXXXXXXXXXXXXXXXXXHASQSPH----SFQN 1877
            YNN    L  LA LID SIPL  +                      + ++      +++ 
Sbjct: 1162 YNNPQSPLRTLAGLIDNSIPLGSLTLYSSGNEGHVSSLFPSGVLDSSKENSKGIVATYKY 1221

Query: 1878 GNED---NGNLETANSTSHITGVITKRLAIFLNCFAFGVLLWILSFLFIF--RKIRKVQP 1932
            G  D   N   ++A   S+       R  +FL     G LLW+L   F+F  R I   + 
Sbjct: 1222 GALDDFTNSFTDSAPGWSY-----AARTIVFLAILTIGALLWLLFAFFVFHYRNILLKRY 1276

Query: 1933 PEEGESYAELDTSGDVLKLPSGSGEDNASGSSSGPQFFQEKATNNDSQNQETVDRNATPK 1992
            P++        + G+  K  S +     S SSSG Q F EK + ++              
Sbjct: 1277 PKDCIE----KSLGNERKFDSTA----LSRSSSGNQIFNEKPSGSE-------------- 1314

Query: 1993 LENSNEGIGGNAQSPISDDLIVTGENTVYSTLHGLEYFVDEDGQFHYAGNRQISDESGTT 2052
                NE +     S   D  I+TGENTVYST HGL Y +++DG   Y     ++D   T 
Sbjct: 1315 ----NESV----HSVTDDHYIITGENTVYSTTHGLHYTINDDGDLFY-KEATLNDLEETA 1365

Query: 2053 KDEHDEIDDFDKYMYAGSEEMSVHVSEAPEVDMSSL-EVDEEGNFVLMNDEIYDNLQENS 2111
            + E   ID   +       + S       E  +SS+ +VDE GN       +YD+  ++ 
Sbjct: 1366 EREDSGIDSILRDCVYDEHQESTEAYLNDEESISSIVDVDENGNI-----RLYDSYSDDE 1420

Query: 2112 RSGSGNKNSDTVESYNNNHLYKMTRSSDSEG 2142
               S    ++ +E YNNN++YK+  ++   G
Sbjct: 1421 EPNSFYLPNEVIEEYNNNNVYKIKHNTPETG 1451

>YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Mucin
            family member that functions as an osmosensor in the
            Sho1p-mediated HOG pathway with Msb2p; proposed to be a
            negative regulator of filamentous growth; mutant displays
            defects in beta-1,3 glucan synthesis and bud site
            selection
          Length = 1802

 Score =  209 bits (531), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 163/520 (31%), Positives = 240/520 (46%), Gaps = 69/520 (13%)

Query: 1641 PTESNTNWLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKR 1700
            P+ ++  WLP +II++S+ +  +  SFNP +T +LP+AI P   VSEP N + ITIGF  
Sbjct: 1203 PSPNSYAWLPTAIIVESSETGPTTASFNPSITGSLPNAIEPAVAVSEPINHTLITIGFTA 1262

Query: 1701 QIDYDFLVNNPLSSAQIFTFLPDVLIYPFN-----YDQNIDKGTHTNESSHYKRKTTTLQ 1755
             ++Y FLV NPLSSAQIF FLP VL YPF+      D +I + +    S      TTTL 
Sbjct: 1263 ALNYVFLVQNPLSSAQIFNFLPLVLKYPFSNTSSELDNSIGELSTFILSYRSGSSTTTLS 1322

Query: 1756 P----------------YRDVMVRTNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAE 1799
            P                 ++    T   H  Q + T++++V +I+PM+   K+Y+V+VAE
Sbjct: 1323 PKSISSLSVVKKKKNQQKKNATKSTEDLHPPQ-VDTSSIAVKKIVPMVDSSKAYIVSVAE 1381

Query: 1800 LYFPAQYVNKLKDYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGMVXXXX----XXXXX 1855
            +YFP + V  L+  + + NS LY+N    L +LA LID  IPL G+              
Sbjct: 1382 VYFPTEAVTYLQQLILDENSTLYSNPQTPLRSLAGLIDSGIPLGGLTLYGSGDGGYVPSL 1441

Query: 1856 XXXXXXXXXXXHASQSPHSFQNGNEDNGNLETANSTSHITGVITKRLAIFLNCFAFGVLL 1915
                       ++     +++ G  D+      +S S   G    ++ IFL     GVLL
Sbjct: 1442 TSSSVLDSSKGNSQNIDGTYKYGALDDFINSFTDSAS--AGKYAVKIIIFLIVLTIGVLL 1499

Query: 1916 WILSFLFIFRK---IRKVQPPEEGESYAELDTSGDVLKLPSGSGEDNASGSSSGPQFFQE 1972
            W+    F FR    + K  P          +  G  L           S SSSG Q + E
Sbjct: 1500 WLFVAFFAFRHRNILLKRHP---------RNCIGKSLNNERELESTELSRSSSGNQVYNE 1550

Query: 1973 KATNNDSQNQETVDRNATPKLENSNEGIGGNAQSPISDDLIVTGENTVYSTLHGLEYFVD 2032
            K                    E+ NE +     S + D  IVTGENTVY+T+H L Y ++
Sbjct: 1551 KPP------------------ESENESV----YSAVDDHYIVTGENTVYNTIHRLHYTIN 1588

Query: 2033 EDGQFHYAGNRQISDESGTTKDEHDEIDDFDK-YMYAGSEEMSVHVSEAPEVDMSSLEVD 2091
            +DG   Y     + D   T  D+   ID   +  +Y  +++ +       E     L+VD
Sbjct: 1589 DDGDLLYRDAIPL-DFDQTNGDDGSGIDSIVRDCVYDKNQDATEAFLNDEESISGILDVD 1647

Query: 2092 EEGNFVLMNDEIYDNLQENSRSGSGNKNSDTVESYNNNHL 2131
            E G+  L     YD+  +N  S S +   + +E+YN NHL
Sbjct: 1648 ENGDIRL-----YDSYSDNEESNSFHLPDEVIENYNKNHL 1682

>KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] {ON}
            some similarities with uniprot|P41809 Saccharomyces
            cerevisiae YDR420W HKR1 Serine/threonine rich cell
            surface protein that contains an EF hand motif involved
            in the regulation of cell wall beta-1 3 glucan synthesis
            and bud site selection overexpression confers resistance
            to Hansenula mrakii killer toxin HM-1
          Length = 1464

 Score =  174 bits (440), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 148/497 (29%), Positives = 229/497 (46%), Gaps = 99/497 (19%)

Query: 1644 SNTNWLPYSIIMQSTPSPSSAPSFNPEV--TATLPHAIAPQTPVSEPPNSSTITIGFKRQ 1701
            SN NWLP +++++ T + +++ + + ++  T+TLP AI P + V  P   + IT+GFK  
Sbjct: 718  SNNNWLPTTLVIEPTAAHATSAATSADLGATSTLPQAINPASDVPLPDGYTVITVGFKEP 777

Query: 1702 IDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKTTTLQPYRDVM 1761
            ++Y FL+ NPL+SAQIF FLP VL+ PF         T T  +  Y+R     +      
Sbjct: 778  LNYPFLIANPLASAQIFNFLPKVLVRPFQL-------TTTGAAPVYRRSWNIFK------ 824

Query: 1762 VRTNKKHKVQMISTA-----NVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKN 1816
                K     ++S++     +V V  I+P++ ++ SY+V++AE+YFP + V+ L++ + +
Sbjct: 825  ----KGINTHLLSSSLPTYDDVQVKSIVPLVIQNVSYIVSIAEVYFPTESVHTLQELVLD 880

Query: 1817 SNSMLYNNTNPTLFALADLIDPSIPLTGMVXXXXXXXXXXXXXXXXXXXXHASQSPHSFQ 1876
            S+S+LY+N    L  LA LI+P+IPLTG+                            +  
Sbjct: 881  SSSILYSNPVSYLADLASLINPAIPLTGLTYSGSSGSSSGNGSGGDSDGNGNGSGEGTGG 940

Query: 1877 NGNE-DN--------GNLE---TANSTSHITGVITKRLAIFLNCFAFGVLLWILSFLF-I 1923
            NG E DN        G+L+   T+   +H T +    +   L  F   ++  IL FL  +
Sbjct: 941  NGAEKDNSSNNAALWGSLDAGLTSGFPNHDTVIRFVCMVTVLTAFILCLVGLILVFLKNL 1000

Query: 1924 FRKIRKVQPPEEGE-SYAELDTSGDVLKLPSGSGEDNASGSS-------SGPQFFQEKAT 1975
            +++    Q     E ++ E+ T          S   N S  S       SG QF     T
Sbjct: 1001 YKRTNCAQRMHLTEKNWPEIPT--------FYSHHMNGSTDSPMRNMFYSGSQFSDSDTT 1052

Query: 1976 NNDSQNQETVDRNATPKLENSNEGIGGNAQSPISDDLIVTGENTVYSTLHGLEYFVDEDG 2035
              DS + E +D                       DDLI+TGENTVYS   G+ Y+VDEDG
Sbjct: 1053 EEDSHSAEYID-----------------------DDLIITGENTVYSISQGITYYVDEDG 1089

Query: 2036 QFHYAGNRQISDESGTTKDEH-DEIDDFDKYMYAGSEEMSVH-------------VSEAP 2081
             F +A         G  KD H  E +  +K ++  +E ++V                E  
Sbjct: 1090 NFFFA---------GVGKDVHTSEPEKLEKIIHDKTETVTVEPILPYYNEKDDDLTDETE 1140

Query: 2082 EVDMSSLEVDEEGNFVL 2098
              DM  LEVDE+GN  L
Sbjct: 1141 PFDMGELEVDEDGNIAL 1157

>Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] {ON}
            YDR420W (HKR1) - Type 1 membrane protein with EF hand
            motif [contig 191] FULL
          Length = 2159

 Score =  161 bits (408), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 109/318 (34%), Positives = 154/318 (48%), Gaps = 36/318 (11%)

Query: 1633 SVPSATSAPTESNTNWLPYSIIMQS-TPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNS 1691
            S PS + A + ++++WLP  ++  S T S ++  SF+   TATLP  I P TPVS P N 
Sbjct: 1289 SKPSQSVAGSRTSSDWLPTLLVTASATESVNTQSSFDTAATATLPQFIVPSTPVSIPANY 1348

Query: 1692 STITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYK--- 1748
            S ITIGF++ ++Y FL+ NPL+SAQIF FLPDVL YPF      D+ T+ +ES  ++   
Sbjct: 1349 SQITIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPFV--SRFDRTTNVSESQPWRYFK 1406

Query: 1749 -----------------RKTT---TLQPYRDVMVRTNKKHKVQMISTAN---VSVIQIMP 1785
                             RK     T   + D      + H      +AN   V V  I+P
Sbjct: 1407 EFPRDGHLENTNLSEDERKLKNGLTNHIFEDGQALQYRMHNRTGAFSANFSEVVVSSIIP 1466

Query: 1786 MLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGM 1845
            ++     Y+ +VA +YFP   VN L+  + NS SMLY+N + T  +LA LIDP IP+TG+
Sbjct: 1467 LIISGNDYIASVAIVYFPTSAVNVLQKMILNSASMLYSNPDSTQESLALLIDPKIPITGL 1526

Query: 1846 VXXXXXXXXXXXXXXXXXXXXHASQSPHSFQ-----NGNEDNGNLETANSTS--HITGVI 1898
            V                           S       N + D+ NL T       H++  +
Sbjct: 1527 VDSDGSSGSGDGSGGSGSSGDGGDSGSSSSGSGSSTNASTDDRNLGTLGGFDFFHMSFSV 1586

Query: 1899 TKRLAIFLNCFAFGVLLW 1916
             K+L IFL  F   + LW
Sbjct: 1587 AKKLIIFLPVFLVSIALW 1604

 Score = 60.5 bits (145), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 103/239 (43%), Gaps = 49/239 (20%)

Query: 2010 DDLIVTGENTVYSTLHGLEYFVDEDGQFHYAG-------NRQISDESGTTKDEHDEIDDF 2062
            +DL+  G    +S   GL Y V  DG F+YAG         Q + ++  T D+   ++  
Sbjct: 1672 EDLLAVGNGLFFSRSTGLTYQVGPDGNFYYAGRTDDVYPKNQGAFQATNTGDQDKNLNAV 1731

Query: 2063 DKYMYAGS-EEMSVHVSEAPEVDMSSLEVDEEGNFVL-MNDEIYDNLQENSRSGSGNKNS 2120
                  G     ++H+S+  + D+  + VDE+GN  L + D    + +EN        N+
Sbjct: 1732 TTLFKEGEVNNEALHLSQVGQ-DLDEIIVDEDGNVELPLADLEQLSFEEN--------NT 1782

Query: 2121 DTVESYNNNHLYKMTR--SSDSEGVTKDAFLSS-----DEGSPEIYGYGTEA-------- 2165
            DT+ESYNN   YKM +  S+ +    +DA  SS      EG P  Y    +A        
Sbjct: 1783 DTIESYNNQQYYKMNQLLSAITGADIQDALTSSGHETTGEGIPSNYNEVKDAPLSSESSN 1842

Query: 2166 -------GDEYMIPSSVHDYGNLEPATDYDQYYSPPYMIGSSTDDTNNNGLTDLPLDFD 2217
                   GDE +     + Y  +EP  D ++ +     I  S D  ++N + D  +D D
Sbjct: 1843 LVAQLSGGDENL---EDYFYSEIEPLEDPEEAH-----IAQS-DSEDSNDVEDFNVDSD 1892

>KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1190

 Score =  155 bits (393), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 108/331 (32%), Positives = 161/331 (48%), Gaps = 43/331 (12%)

Query: 1642 TESNTNWLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQ 1701
            T++  +WLP S+I  S  S S+  S NPE+TATLP  IA  T   +PPN++ +TIGFK++
Sbjct: 586  TQNTNDWLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPNTTLVTIGFKKE 645

Query: 1702 IDYDFLVNNPLSSAQIFTFLPDVLIYPF---NYDQNIDKGTHTNESSHY----------K 1748
            ++Y FL++NPL+SAQIF FLP  L YPF    Y+ + ++ T    SS Y           
Sbjct: 646  LNYIFLIDNPLASAQIFEFLPLTLSYPFLLTQYNASSEEITSLCSSSLYYEDDGRTILTT 705

Query: 1749 RKTTTL---QPYRDVMVRTNKKHKVQMIST----------------------ANVSVIQI 1783
             ++TT+   Q  + +M   +     Q+ S+                      +NV V  I
Sbjct: 706  HESTTVDSTQFVKKIMGPASNLLTAQLASSPSSSPTQRPHPRESSPPPFFNSSNVVVKHI 765

Query: 1784 MPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTNPTLFALADLIDPSIPLT 1843
            +PM+S  + Y+V+VAE+YFP   +  L+ ++   NS LY+N +     L  LIDP I LT
Sbjct: 766  LPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTPYSTLVHLIDPWISLT 825

Query: 1844 GMVXXXXXXXXXXX---XXXXXXXXXHASQSPHSFQNGN-EDNGNLET-ANSTSHITGVI 1898
             +                        +   +P +  +   E +G+L+  +  TS  +  I
Sbjct: 826  DLFQQNGMNNQGNNQDGSLSSNDSSFNTKTNPSNLTSTETERSGSLDLNSGYTSKFSSKI 885

Query: 1899 TKRLAIFLNCFAFGVLLWILSFLFIFRKIRK 1929
              RLAIF   F F V  WI  FL  F+   K
Sbjct: 886  KDRLAIFTTVFLFVVFFWIWLFLVAFKHWNK 916

>KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1530

 Score =  155 bits (392), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 144/519 (27%), Positives = 216/519 (41%), Gaps = 91/519 (17%)

Query: 1596 LSTPIPDASASSTEISTSDTNDVSSLVSPSTITNI-----GSSV---PSATSAPTESNTN 1647
            +S  +P A+   + +S +DT  VSS+     +        GSS+    S TS    ++T 
Sbjct: 829  ISNVVPQATLQQSSVSVTDTM-VSSITGSVGVVQTPNPLGGSSILNPASPTSGSDSTDTV 887

Query: 1648 WLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQIDYDFL 1707
            WLP +II+ S  +  S  +   E TA+LP AIAP   +  PP+   ITIGF   ++Y FL
Sbjct: 888  WLPTNIIIAS--NADSTHTARAESTASLPAAIAPAEELQSPPDFELITIGFLSGLNYAFL 945

Query: 1708 VNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKTTTLQPYRD------VM 1761
            V NPLSSAQ+F FLP VL +P        K      S      TT + P R        M
Sbjct: 946  VGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSS---DITTTLVAPLRKNRKTVTDM 1002

Query: 1762 VRTNKKHK---------------------VQMISTANVSVIQIMPMLSRDKSYLVAVAEL 1800
             R N  ++                     V++I   N+ V QI+P++     Y+ +VAE+
Sbjct: 1003 TRANVVNQNEATSSSLNLAVSSEATGSNDVELIF-KNIRVKQIIPLVIEGNDYITSVAEV 1061

Query: 1801 YFPAQYVNKLKDYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGMVXXXXXXXXXXXXXX 1860
            YFP  Y++ L   + + NS LY+N       LA LID +IPLT +               
Sbjct: 1062 YFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSL--RKNDGQSNTSTDS 1119

Query: 1861 XXXXXXHASQSPHSFQNGNE---DNGNLETAN-STSHITGVITKRLAIFLNCFAFGVLLW 1916
                  + S    +FQN  E    +G ++ +N   S +   I  R+ +FL     GV LW
Sbjct: 1120 SSDVNSNESTGDDAFQNAEEYLRVSGAMDLSNIKVSKVNHTIRNRIIVFLFTLTTGVFLW 1179

Query: 1917 ILSFLFIFRKIRKVQPPEEGESYAELDTSGDVLKLPSGSGEDNASGSSSGPQFFQEKATN 1976
            I +FL IFR   K                       S   +D+     S P + Q     
Sbjct: 1180 ISTFLIIFRITNK-----------------------SRKLKDSNLKKGSLPLYQQNPYRE 1216

Query: 1977 NDSQNQETVDRNATPKLENSNEGIGGNAQSPISDDLIVTGENTVYSTLHGLEYFVDEDGQ 2036
            N   + E+ +                 +  PI +++IV        +  G++Y VD +G 
Sbjct: 1217 NKQFSAESSESYIDIHYTTEKYSDYSASSPPIGENIIV-------DSAQGIQYKVDNEGN 1269

Query: 2037 FHYAGNR-------------QISDESGTTKDEHDEIDDF 2062
            ++Y GN              +   E+ +T+ + D ID F
Sbjct: 1270 YYYNGNHLAEGMPEEDEESARYKQENQSTELQSDSIDHF 1308

>KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2085

 Score =  152 bits (384), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 129/448 (28%), Positives = 188/448 (41%), Gaps = 73/448 (16%)

Query: 1634 VPSATSAPTESNTNWLPYSIIMQS-TPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNSS 1692
             PS+T++   ++ +WLP +I+  S T S  +  SF+ + TATLP AI P TPV+ PPN S
Sbjct: 1214 APSSTNSEGSTSMDWLPSNIVTASYTGSAHTQSSFDADATATLPQAIMPPTPVTMPPNYS 1273

Query: 1693 TITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQN------------------ 1734
             ITIGFK  ++Y FL+ NPL+SAQIF FLP++L YPF+   +                  
Sbjct: 1274 QITIGFKESLNYPFLIENPLASAQIFGFLPEILRYPFSVRASRSNSSTSSVKRDLVGDSG 1333

Query: 1735 ---IDKGTHTNESSHYKRKTTTLQPYRDVMVRTNKKHKVQMISTANVSVIQIMPMLSRDK 1791
               +D  T   +  ++K            + R N  H     + + V+V  I+P++    
Sbjct: 1334 NLLLDNSTLILDKLNWKTSIMNSLSSNVSVSR-NGSHNAFRANFSGVAVSSIVPLIVSGN 1392

Query: 1792 SYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGMV----- 1846
             Y+ +VA +YFP + V  L+  + N  S +Y N + +L  +A LID  IP+TG++     
Sbjct: 1393 DYITSVAVVYFPTEAVEVLQKMIINGASRIYKNPDQSLRDMALLIDSKIPITGIISSDGS 1452

Query: 1847 -XXXXXXXXXXXXXXXXXXXXHASQSPHSFQNGNEDNGNLETANSTSHITGVITKRLAIF 1905
                                   S S   +++   DN           +    TKRL IF
Sbjct: 1453 GQGSGSSGGSGSSSGSDGTGSSGSSSESDYEDVKNDNSGTLDGYKNFQVKFFTTKRLVIF 1512

Query: 1906 LNCFAFGVLLWI-LSFLFIFRKIRKVQPPEEGESYAELDTSGDVLKLPSGSGEDNASGSS 1964
            L  F   V +WI L  LF     RK                                GS 
Sbjct: 1513 LPVFIVAVTMWISLGLLFFGSLFRK--------------------------------GSL 1540

Query: 1965 SGPQFFQEKATNNDSQN-------QETVDRNATPKLENSNEGIGGN----AQSPISDDLI 2013
             G     EK  N D +         E + +  +  LE +  G   N    + +   DDL+
Sbjct: 1541 QGMAGNLEKKWNTDQKTLDNYFGITEFIGKRQSADLEKNLAGSFHNDESSSDAFDDDDLL 1600

Query: 2014 VTGENTVYSTLHGLEYFVDEDGQFHYAG 2041
              G    +S   GL Y VD +G F YAG
Sbjct: 1601 AVGNGMFFSKSTGLTYHVDREGNFFYAG 1628

>Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR420W
            (REAL)
          Length = 1504

 Score =  145 bits (367), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 93/247 (37%), Positives = 137/247 (55%), Gaps = 29/247 (11%)

Query: 1626 TITNIGSSVPSATSAPTESNTN-----WLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIA 1680
            TIT   S +P + + PT   T      WLP +II++ + + SS   FNP +T +LP  I 
Sbjct: 891  TITGSDSVIPVSFTHPTTPYTYSNDYAWLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIE 950

Query: 1681 PQTPVSEPPNSSTITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTH 1740
            P   VSEP N + IT+GF   ++Y+FLV NPLSSAQIF FLP VL YPF+ +  ++  + 
Sbjct: 951  PAVAVSEPANHTLITVGFTAGLNYEFLVQNPLSSAQIFNFLPLVLGYPFS-NTRLEVQSS 1009

Query: 1741 TNESSHYKR------KTTTLQP----------------YRDVMVRTNKKHKVQMISTANV 1778
            T   S +         TTTL P                 R+    T   + +  I T+++
Sbjct: 1010 TQGLSSFVLSYQSGTSTTTLSPKSVSSLSIVKKKKKGEKRNATASTADLY-LPSIETSSI 1068

Query: 1779 SVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTNPTLFALADLIDP 1838
             V QI+PM++  K+Y++AVAE+YFP + ++ L+  + +++S +YNN    L  LA LID 
Sbjct: 1069 VVKQIVPMVNSSKAYVIAVAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLIDS 1128

Query: 1839 SIPLTGM 1845
             IPL G+
Sbjct: 1129 RIPLGGL 1135

 Score = 67.0 bits (162), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 50/174 (28%), Positives = 83/174 (47%), Gaps = 13/174 (7%)

Query: 1967 PQFFQEKATNNDSQNQETVDRNATPKLENSNEGI----GGNAQSPISDDLIVTGENTVYS 2022
            P+   EK+  N+S+ Q      ++   +  NE        +  S + D  IVTGENT+YS
Sbjct: 1226 PRNCIEKSFGNESKLQNVAISRSSSDNQTYNEKTSKTENKSIHSIVGDHYIVTGENTIYS 1285

Query: 2023 TLHGLEYFVDEDGQFHY--AGNRQISDESGTTKDEHDEIDDFDKYMYAGSEEMSVHVSEA 2080
            T HGL Y +++DG   Y  A    ++  +G    E D I    + +Y   ++ +      
Sbjct: 1286 TTHGLHYTMNDDGDLFYREAVPNDLNQLNGGEDLEIDVI--VRECVYDKDQDTTEAYLND 1343

Query: 2081 PEVDMSSLEVDEEGNFVLMNDEIYDNLQENSRSGSGNKNSDTVESYNNNHLYKM 2134
             E   S L+VDE GN       ++D+  ++  S   +   + ++ YNN+HLYK+
Sbjct: 1344 GESVSSILDVDENGNI-----RLHDSYSDDGESNRYHLQDEVIDDYNNSHLYKI 1392

>CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 or uniprot|P41809 Saccharomyces cerevisiae
            YDR420w HKR1
          Length = 1185

 Score =  142 bits (357), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 90/234 (38%), Positives = 126/234 (53%), Gaps = 37/234 (15%)

Query: 1626 TITNIGSSVPSATSAP---------TESNTNWLPYSIIMQSTPSPSSAPSFNPEVTATLP 1676
            TITN    +PS+ S P           S+ NWLP  II QS  + + + SFNP  T +LP
Sbjct: 689  TITN---QIPSSASPPPATPTGPKTLSSDENWLPSGIIFQSDFATTVSSSFNPTATKSLP 745

Query: 1677 HAIAPQTPVSEPPNSSTITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNID 1736
              IAP     + PN++ +TIG K+ ++Y FL++NPLSSAQIF FLP VL YPF       
Sbjct: 746  QFIAPPKMTVKSPNTTLVTIGLKQGLNYQFLIDNPLSSAQIFNFLPSVLTYPF------- 798

Query: 1737 KGTHTNESSHYKRKTTTLQPYRD----VMVRTNKKHKVQMISTANVSVIQIMPMLSRDKS 1792
                    S Y      +    D      + +N      + + + +SV  I+P+L     
Sbjct: 799  --------SSYAPNDFPINSLIDDNALAFLDSN------LFNASTISVHGIVPLLIPGHE 844

Query: 1793 YLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGMV 1846
            + V+V E+YFP   ++ L   +K+ NS LY+N N +L ALA LIDPSIPLTG++
Sbjct: 845  FFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLSALARLIDPSIPLTGLI 898

>Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar to
            Ashbya gossypii ADR200C
          Length = 2201

 Score =  141 bits (355), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 105/321 (32%), Positives = 160/321 (49%), Gaps = 37/321 (11%)

Query: 1635 PSATSAPTESNTNWLPYSII---MQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNS 1691
            PS+TS   +  T WLP +I+   MQ++P  S+  +     T TLP AI P TPV++P N 
Sbjct: 1316 PSSTS--IDEKTGWLPTTIVTASMQTSPKEST--TVGSAATYTLPRAITPATPVAKPDNY 1371

Query: 1692 STITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNES------- 1744
              ITIGF + ++Y FLV+NP++SAQIF+FLP +L YP+  ++      H NES       
Sbjct: 1372 DLITIGFVQGLNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLRHINESNNNILGN 1431

Query: 1745 ---------------SHYKRKTTTLQPYRDVMVRTNKKHKVQMISTANVSVIQIMPMLSR 1789
                           S   + T + +P +    + N++        + + V QI+P L +
Sbjct: 1432 RGSVSGSYFNIYGNLSLEHKHTNSTEPVK--RRQNNEEDTSDEHGYSQIVVKQIVPFLLQ 1489

Query: 1790 DKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGMVXXX 1849
               Y  +VAE+YFP++ V  L+  + + NS LY N   TL  LA L+DP IP+  +    
Sbjct: 1490 GADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPVLTITSGS 1549

Query: 1850 XXXXXXXXXXXXXXXXXHASQSPHSFQNGNEDNGNLETANSTSHITGVITKRLAIFLNCF 1909
                              ++ +    + G  D G      +  H++    KR+ IF   F
Sbjct: 1550 SPSFSNTDPDHSGDTSGSSNNNSSDHKGGTLDLG------AHRHMSPATRKRILIFSLAF 1603

Query: 1910 AFGVLLWILSFLFIFRKIRKV 1930
            +FGVLLWIL FLF+ +++ KV
Sbjct: 1604 SFGVLLWILIFLFLLKRLYKV 1624

>SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} some
            similarities with uniprot|P08640 Saccharomyces cerevisiae
            YIR019C MUC1 GPI-anchored cell surface glycoprotein
            required for diploid pseudohyphal formation and haploid
            invasive growth transcriptionally regulated by the MAPK
            pathway (via Ste12p and Tec1p) and the cAMP pathway (via
            Flo8p)
          Length = 1262

 Score =  137 bits (345), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/207 (36%), Positives = 115/207 (55%), Gaps = 49/207 (23%)

Query: 1647 NWLPYSIIMQSTPSPS-------SAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFK 1699
            NWLP +++++ST + +       S    +   T TLP AIA  T VS+P   + ITIGFK
Sbjct: 901  NWLPTAMLVESTATDNGQANAGGSGTGISTLATQTLPQAIAAATQVSQPDGYTLITIGFK 960

Query: 1700 RQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKTTTLQPYRD 1759
            + ++Y F+V++P+SSAQ+F++LP+VL YPFNY                         + D
Sbjct: 961  KSLNYPFVVSHPVSSAQLFSYLPNVLNYPFNYT------------------------FSD 996

Query: 1760 VMVRTNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNS 1819
            V V                   Q++P+ S  + YL+ VA++YFP++ V  L+  + N+ +
Sbjct: 997  VQVY------------------QLVPLKSSSRDYLITVAKVYFPSEQVEVLQKLISNTAA 1038

Query: 1820 MLYNNTNPTLFALADLIDPSIPLTGMV 1846
             LY N+NPT  +LA LIDP+IPLTG++
Sbjct: 1039 NLYFNSNPTEKSLASLIDPTIPLTGII 1065

>ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1487

 Score =  131 bits (330), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 81/215 (37%), Positives = 113/215 (52%), Gaps = 46/215 (21%)

Query: 1635 PSATSAPTESNTN---WLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNS 1691
            P+ T AP+ S TN   W+P  II Q  P+ ++A S + + TATLP AIA  T    P   
Sbjct: 1143 PTTTLAPSSSTTNDNWWVPTKIITQPAPN-TTASSTSSQATATLPQAIAAATQQVRPKGY 1201

Query: 1692 STITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKT 1751
            S +TIGFK  ++Y+FL+++PLSSAQIF FLP +L  PF    N                 
Sbjct: 1202 SLLTIGFKSALNYNFLISSPLSSAQIFAFLPSILNDPFQNQFN----------------- 1244

Query: 1752 TTLQPYRDVMVRTNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLK 1811
                                     NVS+ QI+P+ S    YL  VAE+YFP ++++ L 
Sbjct: 1245 -------------------------NVSIYQIVPLKSESLDYLATVAEVYFPTKHISDLN 1279

Query: 1812 DYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGMV 1846
              + N+ S LY + + +   LA+LIDP+IPLTG+V
Sbjct: 1280 SLITNNASSLYTDAHGSAKYLAELIDPTIPLTGLV 1314

>AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YGR014W
            (MSB2)
          Length = 1105

 Score =  121 bits (303), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 66/214 (30%), Positives = 105/214 (49%), Gaps = 62/214 (28%)

Query: 1647 NWLPYSIIM---------------QSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNS 1691
            NWLP  II                QS P P++ P+       TLP  IA    V+   + 
Sbjct: 756  NWLPTVIITATEQEVVSTESPQNTQSKPKPTATPNIQ-----TLPQVIAAPDRVTPKKDY 810

Query: 1692 STITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKT 1751
            + ITIGFK+Q++Y F+  NP ++AQIF +LP +L YPFN++                   
Sbjct: 811  TLITIGFKKQLNYPFIAMNPFANAQIFDYLPGILNYPFNFEY------------------ 852

Query: 1752 TTLQPYRDVMVRTNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLK 1811
                                    A++SVIQ++P+ +  K Y+  +A++YFP++ V++L 
Sbjct: 853  ------------------------ADISVIQLVPLKANSKDYIATIAQVYFPSEKVDELA 888

Query: 1812 DYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGM 1845
              + ++NS LY++ +  +   A LIDP +PLTG+
Sbjct: 889  KLVVDTNSELYSSYDANMKVFASLIDPQLPLTGL 922

>KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa] {ON}
            some similarities with uniprot|P32334 Saccharomyces
            cerevisiae YGR014W MSB2 Mucin family member at the head
            of the Cdc42p- and MAP kinase-dependent filamentous
            growth signaling pathway also functions as an osmosensor
            in parallel to the Sho1p-mediated pathway potential
            Cdc28p substrate
          Length = 908

 Score =  119 bits (299), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 85/256 (33%), Positives = 133/256 (51%), Gaps = 55/256 (21%)

Query: 1596 LSTPIPDASASSTEI-STSDTNDVSSLVSPSTITNIGSSVPSATSAPTESNTN--WLPYS 1652
            ++ PI + S+S++++ STS  + V  +VS          +PS T+    S T   WLP +
Sbjct: 490  VTKPIEEPSSSTSQVGSTSVVSTVEPVVS----------LPSTTTEQPVSTTQQVWLPTT 539

Query: 1653 II--MQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQIDYDFLVNN 1710
            ++   +++ + S++ + +   T TLP AI   T + +P   + IT+GFK++++Y F VNN
Sbjct: 540  MVAEFETSGTQSTSTTSSKIATETLPQAITAATEIVQPAGYTLITVGFKKELNYPFTVNN 599

Query: 1711 PLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKTTTLQPYRDVMVRTNKKHKV 1770
            P+S+AQIF FLP VL YPFN  Q  D                                  
Sbjct: 600  PVSNAQIFEFLPKVLNYPFNGAQKFD---------------------------------- 625

Query: 1771 QMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTNPTLF 1830
                  N SV++++P+      YLV VA++YFP   V+ L+  + NS+S++YNN    L 
Sbjct: 626  ------NTSVLELVPLKVTSLDYLVTVAKVYFPEDSVSTLQAQILNSSSVIYNNDVTALK 679

Query: 1831 ALADLIDPSIPLTGMV 1846
             L+  ID SIPLTG+V
Sbjct: 680  QLSSYIDASIPLTGLV 695

>TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {ON}
            Anc_4.150 YGR014W
          Length = 1123

 Score =  119 bits (298), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 74/205 (36%), Positives = 109/205 (53%), Gaps = 44/205 (21%)

Query: 1642 TESNTNWLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQ 1701
            T +N  W+P  I+ Q++ + SS      + TATLP AIA  T V+ P   + IT+GFKR 
Sbjct: 790  TTANNWWVPTQIVTQTSQTTSSGTV--GQATATLPQAIAAATQVARPDGYTLITLGFKRA 847

Query: 1702 IDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKTTTLQPYRDVM 1761
            ++Y+F+V+NP+SSAQIF FLP++L  PF             E+S+               
Sbjct: 848  LNYNFVVSNPISSAQIFAFLPEMLRTPF-------------ENSY--------------- 879

Query: 1762 VRTNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSML 1821
                           N++V Q++P+ S+  SYL  VAE+YFP   ++ L   + N++S L
Sbjct: 880  --------------ENITVQQLVPLQSKAVSYLATVAEVYFPTSEISALSKLISNTSSNL 925

Query: 1822 YNNTNPTLFALADLIDPSIPLTGMV 1846
            Y +       LA LID SIPLTG++
Sbjct: 926  YTDVEGPAKYLAYLIDASIPLTGLL 950

>Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W
            (REAL)
          Length = 1135

 Score =  119 bits (297), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 73/203 (35%), Positives = 105/203 (51%), Gaps = 43/203 (21%)

Query: 1645 NTNWLPYSIIMQSTPSPSSA-PSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQID 1703
            N  W+P  +I Q T + SSA  +     T TLPHAIA  T ++EP   S ITIGFK+ ++
Sbjct: 787  NNWWIPTQLITQETEAASSASTTTGGTQTMTLPHAIAAATQIAEPDGYSLITIGFKKALN 846

Query: 1704 YDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKTTTLQPYRDVMVR 1763
            Y+F+V+ P SSAQIF +LP+ L  PF                            +DV   
Sbjct: 847  YEFVVSEPKSSAQIFAYLPEALNTPF----------------------------KDVFT- 877

Query: 1764 TNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYN 1823
                         N+SV+QI+P+     SYLV+VAE+YFP   +  L   + N++S  Y 
Sbjct: 878  -------------NISVLQIVPLQDDLFSYLVSVAEVYFPTAEIETLSSLITNTSSSFYT 924

Query: 1824 NTNPTLFALADLIDPSIPLTGMV 1846
            +   T  ++A ++D SIPLTG++
Sbjct: 925  DGMGTAKSMAAMVDASIPLTGLL 947

>YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin
            family member involved in the Cdc42p- and MAP
            kinase-dependent filamentous growth signaling pathway;
            also functions as an osmosensor in parallel to the
            Sho1p-mediated pathway; potential Cdc28p substrate
          Length = 1306

 Score =  119 bits (297), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 106/203 (52%), Gaps = 43/203 (21%)

Query: 1645 NTNWLPYSIIMQSTPSPSSAPS-FNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQID 1703
            N  W+P  +I Q+  + S+A S      T TLPHAIA  T V EP   + ITIGFK+ ++
Sbjct: 958  NNWWIPTELITQAPEAASTASSTVGGTQTMTLPHAIAAATQVPEPEGYTLITIGFKKALN 1017

Query: 1704 YDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKTTTLQPYRDVMVR 1763
            Y+F+V+ P SSAQIF +LP+ L  PF                            ++V   
Sbjct: 1018 YEFVVSEPKSSAQIFGYLPEALNTPF----------------------------KNVFT- 1048

Query: 1764 TNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYN 1823
                         N++V+QI+P+     +YLV+VAE+YFP   + +L + + NS+S  Y 
Sbjct: 1049 -------------NITVLQIVPLQDDSLNYLVSVAEVYFPTAEIEELSNLITNSSSAFYT 1095

Query: 1824 NTNPTLFALADLIDPSIPLTGMV 1846
            +   T  ++A ++D SIPLTG++
Sbjct: 1096 DGMGTAKSMAAMVDSSIPLTGLL 1118

>Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W
            (REAL)
          Length = 1169

 Score =  114 bits (285), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 115/436 (26%), Positives = 189/436 (43%), Gaps = 108/436 (24%)

Query: 1597 STPIPDASASS----------------TEISTSDTNDVSSLVSPSTITNIGSSVPSATSA 1640
            STPIP +  SS                T + TS T + ++++ P+T  N       ++S 
Sbjct: 760  STPIPSSKTSSLLLTSPTSSVIQVPANTNVQTSLTTESTTVLQPTTTDNTSV----SSSI 815

Query: 1641 PTESNTNWLPYSIIMQSTPSPSSAPSFNPEV----TATLPHAIAPQTPVSEPPNSSTITI 1696
             +  N  W+P  +I Q+   P +A + +  +    T TLP A+A  T + E    S IT+
Sbjct: 816  TSSDNNWWIPTELITQA---PETASTISSAIGGTQTMTLPQAVAAATQIPESEGYSLITV 872

Query: 1697 GFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKTTTLQP 1756
            GFK+ ++Y+F+V+ P SSAQIF +LP  L  PF                           
Sbjct: 873  GFKKPLNYEFVVSEPKSSAQIFGYLPAALNTPF--------------------------- 905

Query: 1757 YRDVMVRTNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKN 1816
             ++V                N++V+QI+P+     +YL++VAE+YFP   V +L + + N
Sbjct: 906  -KNVF--------------TNITVLQIVPLQDDSLNYLISVAEVYFPTAEVEELSNLIMN 950

Query: 1817 SNSMLYNNTNPTLFALADLIDPSIPLTGMVXXXXXXXXXXXXXXXXXXXXHASQSPHSFQ 1876
            ++S  Y +   T  ++A ++DPSIPLTG++                      S +  S  
Sbjct: 951  TSSTFYTDGTGTAKSMAAMVDPSIPLTGLLRNSNSNSSGSSDGSSSSDSNSGSSNSGSTS 1010

Query: 1877 NGN----------EDNGNLE---TANSTSHITGVITKRLAIFLNCFAFGVLLWILSFLFI 1923
            N            +D G LE    +NS    +G   K++   +     G  L+IL  +F 
Sbjct: 1011 NSGDSSSSSADSYQDAGTLEYSSKSNSNVSGSGKSKKKIIGLVVGLIVGGCLYILFMIFA 1070

Query: 1924 FRKI--RKVQPPEEGESYAELDTSGDVLKLPSGSGEDNASGSSSGPQFFQEKATNNDSQN 1981
            FR I  R+++             S  ++K P  S       S S  +F  EK  NN+ + 
Sbjct: 1071 FRYIARRRIK-------------SQQIIKNPETS-------SVSSSEFGWEKHHNNEKRM 1110

Query: 1982 --QETVDRNATPKLEN 1995
              QE+V ++   +++N
Sbjct: 1111 SVQESVTQSM--RIQN 1124

>Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W
            (REAL)
          Length = 1189

 Score =  113 bits (283), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 125/240 (52%), Gaps = 47/240 (19%)

Query: 1608 TEISTSDTNDVSSLVSPSTITNIGSSVPSATSAPTESNTNWLPYSIIMQSTPSPSSAPSF 1667
            T + TS T + ++++ PST TN   +  S TS+    N  W+P  +I Q+  + S+A S 
Sbjct: 806  TNVQTSLTAESTTVLQPST-TNGTDNYSSVTSS---DNNWWIPTELITQAPEAASTASST 861

Query: 1668 NPEV-TATLPHAIAPQTPVSEPPNSSTITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLI 1726
                 T TLPHAIA  T +      S IT+GFKR ++Y+F+V+ P SSAQIF +LP+ L 
Sbjct: 862  ASGTQTMTLPHAIAAATQIPASEGYSLITVGFKRALNYEFVVSEPKSSAQIFGYLPEALN 921

Query: 1727 YPFNYDQNIDKGTHTNESSHYKRKTTTLQPYRDVMVRTNKKHKVQMISTANVSVIQIMPM 1786
             PF                            ++V                N+SV+QI+P+
Sbjct: 922  TPF----------------------------KNVFT--------------NISVLQIVPL 939

Query: 1787 LSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGMV 1846
                 SYLV+VAE+YFP   + +L + + N++S  Y +   T  ++A ++DPSIPLTG++
Sbjct: 940  QDDSLSYLVSVAEVYFPTAELEELSNLITNTSSTFYTSGTGTAKSMAAMVDPSIPLTGLL 999

>KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1520

 Score =  113 bits (283), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 85/307 (27%), Positives = 137/307 (44%), Gaps = 58/307 (18%)

Query: 1636 SATSAPTESNTNWLPYSIIMQS-----TPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPN 1690
            S+T  PT S +NWLP +++  S     T S S+  + +   T TLP AI   T VS+P  
Sbjct: 1168 SSTFVPT-STSNWLPTALVTASSDTNDTQSGSTDSNGSQLATQTLPQAIGAPTEVSQPEG 1226

Query: 1691 SSTITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRK 1750
             + ITIGFK+ ++Y F+V N ++SAQIF +LP+ L +PF+                    
Sbjct: 1227 YTLITIGFKQALNYPFVVTNAVTSAQIFAYLPETLNFPFD-------------------- 1266

Query: 1751 TTTLQPYRDVMVRTNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKL 1810
                    D                ++++V ++ P+   ++ YL+ +AE+YFP+  V  L
Sbjct: 1267 --------DAF--------------SDITVARLGPLKVSNRDYLLTIAEVYFPSAQVENL 1304

Query: 1811 KDYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGMVXXXXXXXXXXXXXXXXXXXXHASQ 1870
            +  ++N  S  Y   N T   LA  +D +IPLTG+V                      S 
Sbjct: 1305 QTLIQNDESKFYAK-NATKNLLAAFVDATIPLTGLVEEEGSTSSGSSQSSGASSNVSTSS 1363

Query: 1871 SPHSFQNGNEDNGNLETANSTSHITGVITKR--------LAIFLNCFAFG-VLLWILSFL 1921
               S   G     N  T  S+ + +   TK+        L + + C A   + L +++F 
Sbjct: 1364 EGESEDGGKSGYRNSGTLGSSYYKSSTFTKQGGRSKLVGLIVGVVCGALVYIALMVITFR 1423

Query: 1922 FIFRKIR 1928
            FI +K++
Sbjct: 1424 FIIKKMQ 1430

>Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR044W
            (AGA1) - anchorage subunit of a-agglutinin [contig 206]
            FULL
          Length = 1568

 Score =  112 bits (280), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 82/311 (26%), Positives = 139/311 (44%), Gaps = 60/311 (19%)

Query: 1633 SVPSATSAPTESNTNWLPYSIIMQ------STPSPSSAPSFNPEVTATLPHAIAPQTPVS 1686
            S P+A+SA   +++NWLP ++I        ++P+ SS P    + T TLP AI   T V 
Sbjct: 1212 STPTASSA---TSSNWLPTAMITANANTESASPTDSSDPKDAQQATKTLPQAIGAPTEVV 1268

Query: 1687 EPPNSSTITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSH 1746
            +P   + IT+GFK+ ++Y F+V NP++SAQIF FLPD L  PF+                
Sbjct: 1269 QPEGYTLITVGFKKALNYPFVVGNPVTSAQIFAFLPDTLNSPFDN--------------- 1313

Query: 1747 YKRKTTTLQPYRDVMVRTNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQY 1806
                                       +  N++V ++ P+    + YL+ VAE+YFP+  
Sbjct: 1314 ---------------------------AFTNITVARLGPLKVSSRDYLLTVAEVYFPSAQ 1346

Query: 1807 VNKLKDYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGMVXXXXXXXXXXXXXXXXXXXX 1866
            V  L+  ++N  S  Y     +   +A L+D +IPLTG++                    
Sbjct: 1347 VENLQKLIQNDASKFYFVNGTSRNVVASLVDATIPLTGLLQDDGSTTSETGSESGSPSNT 1406

Query: 1867 HASQSPHSFQNGNEDNGNLETANSTSHI--------TGVITKRLAIFLNCFAFGVLLWIL 1918
             +S +  +  +    +GNL T  S+ +         +G   K + + +     G L+++ 
Sbjct: 1407 GSSSNEGTDSSEQSSHGNLGTLGSSQYSSSASGFFKSGGKGKLIGLVVGVVC-GALVYVA 1465

Query: 1919 SFLFIFRKIRK 1929
              + +FR + K
Sbjct: 1466 IMVIVFRFVVK 1476

>KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.150
            YGR014W
          Length = 949

 Score =  110 bits (276), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 103/375 (27%), Positives = 162/375 (43%), Gaps = 71/375 (18%)

Query: 1622 VSPSTITNIGSSVPSATSAPTESNTN---WLPYSIIMQSTPSPSSAPSFNPEVTATLPHA 1678
            V P++   + SS+   TSA T S++N   W+   ++  S  + ++  +     T +LP A
Sbjct: 562  VLPASNVPVSSSITLVTSATTTSHSNPNWWVASDLMTASEEASTTTRASATTATGSLPQA 621

Query: 1679 IAPQTPVSEPPNSSTITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKG 1738
            IA  T V+ P + S ITIGFK+ ++Y+F+VN P SSAQ+F++LP  L  PFN        
Sbjct: 622  IAAPTEVTAPDDYSLITIGFKKALNYEFVVNTPESSAQLFSYLPIALNTPFNN------- 674

Query: 1739 THTNESSHYKRKTTTLQPYRDVMVRTNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVA 1798
                                               S  N+SV QI+P++    +Y + VA
Sbjct: 675  -----------------------------------SFTNISVYQIVPLVESSLNYYITVA 699

Query: 1799 ELYFPAQYVNKLKDYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGMVXXXXXXXXXXXX 1858
            E+YFP Q +  L+  +K+++S L+         L  LIDPSIPL G++            
Sbjct: 700  EVYFPEQEIASLQQMIKDNSSALFTENVGAPKTLVSLIDPSIPLVGLLSSTTSNSSTSAT 759

Query: 1859 ----------XXXXXXXXHASQSPHSFQNGNEDNGNLE-TANSTSHITGVIT--KRLAIF 1905
                               +  S       + D G+L+ +  STS   G  T  ++L I 
Sbjct: 760  GSSASTTNSGQVNSGSNSDSDSSSGKGSVSSNDIGSLDYSEKSTSAAAGKTTSNRKLIIL 819

Query: 1906 LNCFAFGVLLWILSFLFIFRKIRKVQPPEEGESYAELDTSGDVLKLPSGSGEDNASGSSS 1965
            + C   G LL+I    +I   +R     ++    A +  S DVL          ++  SS
Sbjct: 820  IVCVVIGGLLFITLTAYILH-VRITVFKDQKRKAANM--SFDVL----------STTDSS 866

Query: 1966 GPQFFQEKATNNDSQ 1980
            G   + EK   ND++
Sbjct: 867  GGSVYNEKEKLNDNE 881

>NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4.150
          Length = 785

 Score =  110 bits (274), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 93/299 (31%), Positives = 130/299 (43%), Gaps = 74/299 (24%)

Query: 1648 WLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQIDYDFL 1707
            W+P  +I  ST    SA   +   T TLP  I   T V  P   + ITIGFK  ++Y+F+
Sbjct: 452  WIPTQLITASTQVTGSA-MVSSAATKTLPQVIGAATSVPTPEGYTVITIGFKEALNYEFI 510

Query: 1708 VNNPLSSAQIFTFLPDVLIYPFN--YDQNIDKGTHTNESSHYKRKTTTLQPYRDVMVRTN 1765
            V++P SSAQIF+FLP VL  PF+  YD                                 
Sbjct: 511  VSSPKSSAQIFSFLPYVLNTPFDDIYD--------------------------------- 537

Query: 1766 KKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNT 1825
                       N++V +++P+  +D  Y + VAE+ FP   +  L  Y+K++NS LY   
Sbjct: 538  -----------NITVSRLVPLQKKDIGYFITVAEVLFPESAIANLSVYIKDTNSSLYTKN 586

Query: 1826 NPTLFALADLIDPSIPLTGMVXXXXXXXXXXXXXXXXXXXXHASQSPHSFQNGNEDN--- 1882
            +  L +LA LIDPSIPLTG+V                     ++ S  S   GN D+   
Sbjct: 587  DDALRSLALLIDPSIPLTGLV--------TSANSADTSSSSSSTDSSSSSSKGNSDHKSG 638

Query: 1883 -------------GNLE-TANSTSHITGVI--TKRLAIFLNCFAFGVLLWILSFLFIFR 1925
                         G LE +  S+S+ TG I   K L   + C   G +L+I    FI R
Sbjct: 639  STSEDDDSSSEDMGTLEYSGKSSSNPTGSIKNKKTLVPLVVCTVGGGILYICLMTFIVR 697

>Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {ON}
            (25673..27781,27783..27959) [2286 nt, 762 aa]
          Length = 761

 Score =  109 bits (272), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 85/256 (33%), Positives = 138/256 (53%), Gaps = 41/256 (16%)

Query: 1619 SSLVSPSTITNIGSSVPSATSAPTESNTNWLPYSIIMQSTPSP-SSAPSFNPEVTATLPH 1677
            ++L  P+T T +   VP  +S  T  +  WLP +I++QS+ +  +++P  N   T+ LP 
Sbjct: 494  TALAVPTTSTAVA--VP-LSSEQTRDSFAWLPTNIVVQSSNTDMTNSPETNTN-TSGLPV 549

Query: 1678 AIAPQTPVSEPPNSSTITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPF-----NY- 1731
             IAP T V++P +S  I+IGFK +++Y FL+    +SAQIF FLP +L YPF     NY 
Sbjct: 550  RIAP-TAVTQPADSILISIGFKIELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQ 608

Query: 1732 ---------DQNIDKGTHTNESSHYKRKTT------TLQPYRD----------VMVRTNK 1766
                     D ++    + + SS +  +TT      TL    D           +   NK
Sbjct: 609  LDPSISLQSDTSVISTEYQDYSSIFSYETTLSNLGLTLYDLSDGETSVLEASPTVASMNK 668

Query: 1767 KHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTN 1826
              +     T+++SV QI+P+L     Y+ ++AE  FP + V++L++Y+ N  S++Y N +
Sbjct: 669  YQR----DTSSISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPD 724

Query: 1827 PTLFALADLIDPSIPL 1842
            P L  +A LID +IP+
Sbjct: 725  PRLKDMAALIDSTIPI 740

>NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {ON}
            Anc_4.150
          Length = 985

 Score =  107 bits (268), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 80/221 (36%), Positives = 115/221 (52%), Gaps = 52/221 (23%)

Query: 1635 PSATSAPTE----SNTNW-LPYSIIMQS-TPSPS-SAPSFNPEVTATLPHAIAPQTPVSE 1687
            PS T+ PT+    S+TNW +P  +I QS  PS S S P+ N   T TLP  IA  T + E
Sbjct: 588  PSVTTTPTQTRASSDTNWWIPTVLITQSNQPSESASVPTSN-TATKTLPQVIAVGTTIPE 646

Query: 1688 PPNSSTITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHY 1747
            P   S ITIGFK+ ++Y+F+V NP SSAQIF+FLPDVL  PFN   N             
Sbjct: 647  PEGYSLITIGFKKPLNYEFIVANPKSSAQIFSFLPDVLNAPFNNTFN------------- 693

Query: 1748 KRKTTTLQPYRDVMVRTNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYV 1807
                                         N++V+Q++P+ +   +YLV VA++YFP   +
Sbjct: 694  -----------------------------NITVLQLVPLQNPSLNYLVTVAKVYFPTDMI 724

Query: 1808 NKLKDYMKN--SNSMLYNNTNPTLFALADLIDPSIPLTGMV 1846
            + L   +++  + S++Y        +LA+LI   IPLTG++
Sbjct: 725  DTLSSLIEDYTTPSLIYTINQGAKGSLANLISSDIPLTGLL 765

>TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {ON}
            Anc_4.150 YGR014W
          Length = 826

 Score =  106 bits (264), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 103/200 (51%), Gaps = 42/200 (21%)

Query: 1648 WLPYSIIMQSTPSPSSAPSFNPEVTATL-PHAIAPQTPVSEPPNSSTITIGFKRQIDYDF 1706
            W+P  II +S  + +S  S     T  + P AIA  T +  P   + ITIGFK  ++YDF
Sbjct: 488  WVPTRIITESDKTQNSVSSTQTVSTTRIKPKAIAAPTTIPVPSGYTLITIGFKEALNYDF 547

Query: 1707 LVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKTTTLQPYRDVMVRTNK 1766
            +++NP+SSAQIF FLP+ L  PF +          N+SS                     
Sbjct: 548  VLDNPVSSAQIFAFLPEALDLPFQF---------ANDSS--------------------- 577

Query: 1767 KHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTN 1826
                       VS+++++P    + +Y V VAE+YFP+  +++L   +K+S+S LY    
Sbjct: 578  -----------VSILKLVPYSLSNYNYTVLVAEVYFPSDSIDELSSLIKDSDSPLYTLNT 626

Query: 1827 PTLFALADLIDPSIPLTGMV 1846
             +  AL +LID +IPLTG+V
Sbjct: 627  GSRLALVNLIDQNIPLTGLV 646

>KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.150
            YGR014W
          Length = 994

 Score =  105 bits (262), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 101/202 (50%), Gaps = 45/202 (22%)

Query: 1648 WLPYSIIMQSTP---SPSSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQIDY 1704
            W+P  ++ ++     + ++  + +P  T  +P  I     V+     + ITIGFK+ + Y
Sbjct: 646  WIPTRLLTETAAVETASNTVSTLSPSATKYMPQVIMAPGDVTVAEGYTLITIGFKKPLHY 705

Query: 1705 DFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKTTTLQPYRDVMVRT 1764
            +F+V  P SSAQI +FLP++L                             QPY ++    
Sbjct: 706  EFVVTQPKSSAQIISFLPNLL----------------------------NQPYGNIF--- 734

Query: 1765 NKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNN 1824
                       +N+SV+Q++P+     SY V VAE+YFP   +  L   +K+++S+LY  
Sbjct: 735  -----------SNISVLQLVPLQDSSISYYVTVAEVYFPTAEITNLSQLVKDTSSILYTE 783

Query: 1825 TNPTLFALADLIDPSIPLTGMV 1846
             + +L  LAD+IDPSIP+TG+V
Sbjct: 784  VSESLKTLADMIDPSIPITGLV 805

>Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON}
            similar to Ashbya gossypii AGR019C
          Length = 1129

 Score =  104 bits (260), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 83/321 (25%), Positives = 133/321 (41%), Gaps = 72/321 (22%)

Query: 1635 PSATSAPTESNTNWLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPP----- 1689
            P+ +  P    + WLP +I+ +S     S P+     T T P      T +   P     
Sbjct: 763  PNYSWGPHTPTSTWLPTAILTES--DADSEPTVTVTDTETKPTTSMASTAIQTLPKFISS 820

Query: 1690 --------NSSTITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHT 1741
                    N + IT+GFKR+++Y F+V+NP+SSAQIF FLP+VL YP+ +          
Sbjct: 821  ANGKIPEGNYTLITVGFKRRLNYPFVVSNPVSSAQIFDFLPNVLNYPYGF---------- 870

Query: 1742 NESSHYKRKTTTLQPYRDVMVRTNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELY 1801
                                              ANVSV +++P+ S  + YLV VA ++
Sbjct: 871  --------------------------------RCANVSVWRLLPLKSGSRDYLVTVAAVF 898

Query: 1802 FPAQYVNKLKDYMKNSNSMLYNNTNPTLFALADLIDPSIPLTGMVXXXXXXXXXXXXXXX 1861
            FP +++++L   + ++ S LY++ + T   +A LIDP IPLTG++               
Sbjct: 899  FPTEHLDELARLVADNTSSLYSSYDETGKTMASLIDPMIPLTGIINSISSDPASGESSAT 958

Query: 1862 XXXXXHASQSPHSFQNGNEDNGNLETANSTS-----------HITGVITKRLAIFLNCFA 1910
                  +   P  F  G   NG     N+ S            ITG++   +       A
Sbjct: 959  GTNTPKSGSVPVGFA-GTLANGGGRLGNAGSKSLDSSPMSKLKITGIVVGSVCGVATYIA 1017

Query: 1911 FGVLLWILSFLFIFRKIRKVQ 1931
              +L       ++ R+  K+Q
Sbjct: 1018 LTLL---CVRYYLLRRGNKIQ 1035

>TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4.150
            YGR014W
          Length = 1825

 Score = 97.1 bits (240), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 60/203 (29%), Positives = 95/203 (46%), Gaps = 55/203 (27%)

Query: 1648 WLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQT--PVSEPP---NSSTITIGFKRQI 1702
            W+P S+ + ST         N   T+TLP    PQ    V +PP   N S ITIGFK+++
Sbjct: 1498 WIPTSLAVAST--------MNSTDTSTLPTQAIPQAIGSVEQPPAPENHSLITIGFKKEL 1549

Query: 1703 DYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKTTTLQPYRDVMV 1762
            +Y+F+V++P+S AQI  +LP+ L+  F                           + +V  
Sbjct: 1550 NYEFVVSHPMSGAQIINYLPNTLVNAF---------------------------FGNV-- 1580

Query: 1763 RTNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLY 1822
                          N+SV  ++P       YL+ +A +YFP   +  L++ + + +S  Y
Sbjct: 1581 -------------TNISVNNLVPYNDTKSDYLITIATVYFPTDEIKHLRELIHDKSSSFY 1627

Query: 1823 NNTNPTLFALADLIDPSIPLTGM 1845
              +      LA+L+DPSIPLTG+
Sbjct: 1628 TASQDVARQLANLVDPSIPLTGL 1650

>Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {ON}
            complement(78801..81722) [2922 nt, 974 aa]
          Length = 973

 Score = 92.4 bits (228), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/198 (30%), Positives = 98/198 (49%), Gaps = 42/198 (21%)

Query: 1648 WLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAPQTPVSEPPNSSTITIGFKRQIDYDFL 1707
            W+P S+I +S  + S+  +     T ++P AIA  T  + P   S +TIGFK  ++Y F+
Sbjct: 643  WVPTSLITESDVTDSAVTTRTLSATKSVPLAIAASTQTATPEGCSLVTIGFKEALNYQFV 702

Query: 1708 VNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESSHYKRKTTTLQPYRDVMVRTNKK 1767
            +++ ++ AQIF FLP  LI PF                                      
Sbjct: 703  LSSSVTVAQIFAFLPGGLIAPF-------------------------------------- 724

Query: 1768 HKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTNP 1827
             + Q+   ANV+V ++ P+   + +Y + VAE+YFP   +++L  ++ +S S LY N + 
Sbjct: 725  -EEQL---ANVTVYRLSPLNYGNFNYTLTVAEVYFPTSKIDELAAFVADSESALYVNASG 780

Query: 1828 TLFALADLIDPSIPLTGM 1845
            T   L  LIDP IP+TG+
Sbjct: 781  TEEELVSLIDPRIPITGL 798

>CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014w MSB2 multicopy suppressor of a CDC24 bud
            emergence defect
          Length = 936

 Score = 75.1 bits (183), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 68/250 (27%), Positives = 113/250 (45%), Gaps = 53/250 (21%)

Query: 1686 SEPPNSSTITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPFNYDQNIDKGTHTNESS 1745
            S P   S ITIGFK+ ++Y F+V+   SSAQI  +LP +L              + N  S
Sbjct: 633  SVPEGYSVITIGFKKPLNYPFVVSESKSSAQIMYYLPKLL--------------NANFES 678

Query: 1746 HYKRKTTTLQPYRDVMVRTNKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQ 1805
             +                            +++  +Q+MP+  +D  YL  VA L+FP  
Sbjct: 679  IF----------------------------SDIKTVQLMPLEIQDSGYLSTVALLFFPTS 710

Query: 1806 YVNKLKDYMKNSNSMLYNNTNPTLF-ALADLIDPSIPLTGMVXXXXXXXXXXXXXXXXXX 1864
             +  L + +KN++S LY+    T+  +L+ LIDP IP+TG+                   
Sbjct: 711  EIQSLSNMVKNTSSSLYSTQYETITQSLSALIDPRIPVTGLTDTKTNNAGSSSSSSSNSN 770

Query: 1865 XXHAS---QSPHSFQNGNEDNGNLE----TANSTSHITGVITKR--LAIFLNCFAFGVLL 1915
               ++    + HS   GN ++G+L+    + +++S  T   TK+  + I +   A G+ +
Sbjct: 771  GRSSNSNQDTEHSSSFGNINSGSLDYIPSSKSASSDGTQSKTKKRIIPIIVGTIAGGMAV 830

Query: 1916 WILSFLFIFR 1925
             I+ FLF FR
Sbjct: 831  IIMLFLF-FR 839

>TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {ON} 
          Length = 1161

 Score = 74.7 bits (182), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 100/414 (24%), Positives = 168/414 (40%), Gaps = 99/414 (23%)

Query: 1766 KKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNT 1825
            +K ++ M    +++V +I+P + ++  Y++++AE+Y P + V  L++ + N  S  YN+ 
Sbjct: 692  QKQEISM----DITVARIIPYIVQNNKYIISIAEVYVPNEIVETLQELILNPASSFYNSE 747

Query: 1826 NPTLFALADLIDPSIPLTGMVXXXXXXXXXXXXXXXXXXXXHASQSPHSFQNGNED---- 1881
            + +L  LA LIDP+IPLTGM+                      S + HS  +G  D    
Sbjct: 748  SSSLKTLAFLIDPNIPLTGML--DSNGNLISGGLSSSNGNIQNSSTKHSHGSGISDISSQ 805

Query: 1882 NGNLETANSTSH--ITGVITKRLAIFLNCFAFGVLLWI-LSFL---FIFRKIRKVQPPEE 1935
               L T +S+++  ++  + KRL+IF+ CF  G +L+I LS     F+++K+     PE 
Sbjct: 806  TLKLGTLDSSAYKGLSTNLKKRLSIFIVCFTVGAVLYIQLSLFGLNFMYKKLSMKADPE- 864

Query: 1936 GESYAELDTSGDVLKLPSGSGEDNASGSSSGPQFFQEKATNNDSQNQETVDRNATPKLEN 1995
                                     S  SS PQ+               + R++T  +E 
Sbjct: 865  -------------------------SDKSSLPQYH--------------ITRDSTSNIEG 885

Query: 1996 SNEGIGGNAQSPISDDL----------IVTGENTVYSTLHGLEYFVDEDGQFHYAGNRQI 2045
             +        +P SD            I      VY+    + Y VDE G F+Y     +
Sbjct: 886  RSSKSFSTPSNPFSDKYQKSSSDSSKSITLPGKAVYNRSQDMTYLVDEQGNFYYTNLDNV 945

Query: 2046 S----------DESGTTKDEHDEIDDFDKYMYAGSEEMSVHVSEAPEVDMSSLEVDEEGN 2095
                       + S  +KD       ++KY+Y  +   S           + L+     N
Sbjct: 946  QGRTVHIMRTPEGSIYSKDV-----SYNKYVYDSNNSTS----------NTYLDDQYHEN 990

Query: 2096 FVLMNDEI---YDNLQENSRSGSGNKNSDTVESYNNNHLYKM-----TRSSDSE 2141
             V   D++   Y +   N    S     + V+ +NNN LYKM     T  +DSE
Sbjct: 991  TVNKGDDLEITYPDFLLNEVKESHTNIIENVKRFNNNGLYKMILPLGTSGTDSE 1044

>TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {ON}
            Anc_5.524 YDR420W
          Length = 2253

 Score = 70.5 bits (171), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 69/136 (50%), Gaps = 18/136 (13%)

Query: 1647 NWLPYSIIMQSTPSPSSAPSFNPEVTATLPHAIAP--QTPVSEPPNSSTITIGFKRQIDY 1704
            NWLP ++++++ PS S+   FNP  T   P AI P  Q     P +S  I +   R ++Y
Sbjct: 1555 NWLPSTLVVENNPSGSANMQFNPSETFKWPRAITPENQNEKPAPVDSQLILVALDRPLNY 1614

Query: 1705 DFLVNNPLSSAQIFTFLPDVLIY---------PFNYDQNIDKGTHTNESSHYKRKTTTLQ 1755
             FL+ N +SSAQ+  ++P +L Y         P +Y      GT  + SS     TTTL 
Sbjct: 1615 PFLIENLVSSAQVMNYIPFILSYSLIDFSPAAPSSYSL---SGTAYDISSEINSGTTTLS 1671

Query: 1756 PYRDVMVRTNKKHKVQ 1771
            P    ++ TNKK  V+
Sbjct: 1672 P----VIATNKKRDVK 1683

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 90/379 (23%), Positives = 145/379 (38%), Gaps = 87/379 (22%)

Query: 1778 VSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNNTNPTLFA--LADL 1835
            + V QI+P+L  D+ Y VA  ++Y P   V++L+ Y+ + +S+LY+N  P   A  L++ 
Sbjct: 1777 IEVKQIIPLLIEDRDYWVAGVQVYVPNNVVDQLQAYIYDLDSILYHN--PVYIARELSNF 1834

Query: 1836 IDPSIPLTGMVXXXXXXXXXXXXXXXXXXXXHASQ---------SPHSFQNGN----EDN 1882
            ID SIP+ G                      ++           S  + QN N    +D 
Sbjct: 1835 IDSSIPIVGSGKYWTAYDGNPNEENELNTSSNSEDTNGSDVEPNSDDASQNTNSLVYQDM 1894

Query: 1883 GNLETANSTSHITGVITKRLAIFLNCFAFGVLLWILSFLF---------IFRKIRKVQPP 1933
            G L+T    S  T + T +  I++    FG +  + S LF          F  I K+  P
Sbjct: 1895 GTLDTGTILSKKTTLETSKAWIYIVAMIFGFISLLFSILFSMTFMKFSYQFEFITKIIRP 1954

Query: 1934 EEGESYAELDTSGDVLKLPSGSGEDNASGSSSGPQFFQEKATNNDSQNQETVDRNATPKL 1993
             E                P+   +D + G+S               +N+  +    TP +
Sbjct: 1955 TEK-------------IWPT---KDASIGASHA------------LKNKNILPIVHTPIM 1986

Query: 1994 ENSNEGIGGNAQSPISDDLIVTGENTVYSTLHGLEYFVDEDGQFHYAGNRQISDESGTTK 2053
            E      G    SP  +D  +     VY   +GL Y VD++G ++Y  N        T K
Sbjct: 1987 EK-----GEIFPSPSINDCEI-----VYDNNNGLAYTVDKEGNYYYHHNL------TTGK 2030

Query: 2054 DEHDEIDDFDKYMYAGSEEMSVHVSEAPEVDMSSLEVDEEGNFVLMNDE-IYD-NLQENS 2111
            D          Y   G ++               + +D++GN  + +   IYD     + 
Sbjct: 2031 DFITFNTSLQDYRKEGHDD---------------IFIDQDGNIEIEDSHGIYDIPTSSSI 2075

Query: 2112 RSGSGNKNSDTVESYNNNH 2130
              GS  KN D +  YNN +
Sbjct: 2076 SHGSSIKNLDNIRKYNNQY 2094

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.303    0.119    0.323 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 183,151,648
Number of extensions: 7474896
Number of successful extensions: 59386
Number of sequences better than 10.0: 954
Number of HSP's gapped: 51395
Number of HSP's successfully gapped: 3415
Length of query: 2385
Length of database: 53,481,399
Length adjustment: 126
Effective length of query: 2259
Effective length of database: 39,033,483
Effective search space: 88176638097
Effective search space used: 88176638097
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 74 (33.1 bits)