Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D11308g5.477ON86886843430.0
TDEL0A034105.477ON83780328040.0
YOR141C (ARP8)5.477ON88176225060.0
Smik_15.3205.477ON87376324950.0
Suva_8.1925.477ON87976024780.0
Skud_15.3045.477ON88375924770.0
Kpol_543.105.477ON87677624350.0
NCAS0H022905.477ON86380823610.0
TBLA0A025305.477ON85475723500.0
TPHA0J027905.477ON88276422220.0
CAGL0I07161g5.477ON83777522120.0
NDAI0C013705.477ON97483522180.0
KAFR0E025305.477ON84278021140.0
SAKL0G03608g5.477ON79475520290.0
KNAG0B040205.477ON93480519940.0
Kwal_55.212505.477ON77576619650.0
KLTH0F14960g5.477ON77575818930.0
AFR135W5.477ON79177818710.0
Ecym_23115.477ON77578418620.0
KLLA0E03213g5.477ON78879116100.0
Ecym_23062.593ON40799900.043
TBLA0B010702.117ON383105890.047
Ecym_52373.161ON391119870.085
KNAG0H036502.117ON387123850.14
KAFR0L010807.266ON62634860.14
ZYRO0F01122g2.593ON46299840.20
Ecym_15208.23ON37655830.24
NDAI0A013007.448ON56586840.25
Kpol_181.22.593ON463135810.46
NCAS0B071302.117ON381130810.47
NCAS0A147207.448ON48590810.55
TDEL0C031207.448ON43869790.83
ZYRO0F02772g8.23ON37557790.83
NDAI0G030408.23ON37557790.84
Skud_6.318.23ON36057790.86
SAKL0B11220g2.593ON46683790.86
TDEL0C004708.23ON37557790.87
CAGL0K12694g8.23ON37557790.87
Suva_6.188.23ON37557790.87
Smik_6.398.23ON37557790.87
YFL039C (ACT1)8.23ON37557790.87
KNAG0L002508.23ON37557790.88
KAFR0D009408.23ON37557790.88
Kpol_1058.158.23ON37557780.89
TBLA0C004408.23ON37557780.89
TPHA0D002508.23ON37557780.90
NCAS0C037008.23ON37557780.90
SAKL0B00968g8.23ON37557780.96
ABR222W8.23ON37657780.97
TBLA0H028002.593ON48494771.3
ABR084W2.593ON464172771.4
TDEL0B068602.593ON46182771.5
CAGL0K05335g7.448ON52986771.6
TDEL0D015501.287ON48046771.7
KLLA0D05357g8.23ON37557752.1
KLLA0E22925g2.117ON380147752.1
Kwal_14.11098.23ON36057752.2
KLTH0G18832g8.23ON37557752.3
TDEL0B048102.117ON373173734.1
KLLA0B14839gna 1ON42165734.1
Kpol_1043.172.347ON72349734.5
NCAS0H030602.593ON47232725.8
Kwal_33.133921.82ON1968231735.8
TPHA0F019402.129ON506156726.2
Kpol_520.117.448ON488131726.3
Suva_15.3262.117ON38472716.9
NCAS0A094501.273ON69963718.1
KLTH0F02376g1.82ON19761637110.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D11308g
         (868 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {...  1677   0.0  
TDEL0A03410 Chr1 complement(608343..610856) [2514 bp, 837 aa] {O...  1084   0.0  
YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON} ...   969   0.0  
Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {...   965   0.0  
Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON...   959   0.0  
Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {...   958   0.0  
Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}...   942   0.0  
NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {O...   914   0.0  
TBLA0A02530 Chr1 (610524..613088) [2565 bp, 854 aa] {ON} Anc_5.4...   909   0.0  
TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {...   860   0.0  
CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} simila...   856   0.0  
NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.4...   858   0.0  
KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.4...   818   0.0  
SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {...   786   0.0  
KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.4...   772   0.0  
Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141...   761   0.0  
KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} simi...   733   0.0  
AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic ho...   725   0.0  
Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar t...   721   0.0  
KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {...   624   0.0  
Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}...    39   0.043
TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.1...    39   0.047
Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}...    38   0.085
KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {O...    37   0.14 
KAFR0L01080 Chr12 complement(202561..204441) [1881 bp, 626 aa] {...    38   0.14 
ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp...    37   0.20 
Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376...    37   0.24 
NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {O...    37   0.25 
Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON} co...    36   0.46 
NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa] ...    36   0.47 
NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON} Anc_7...    36   0.55 
TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.4...    35   0.83 
ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [112...    35   0.83 
NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128...    35   0.84 
Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON} Y...    35   0.86 
SAKL0B11220g Chr2 (978268..978297,978363..979733) [1401 bp, 466 ...    35   0.86 
TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,...    35   0.87 
CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,...    35   0.87 
Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 3...    35   0.87 
Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 3...    35   0.87 
YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375...    35   0.87 
KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp...    35   0.88 
KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128...    35   0.88 
Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 b...    35   0.89 
TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,...    35   0.89 
TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,...    35   0.90 
NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128...    35   0.90 
SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp...    35   0.96 
ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {...    35   0.97 
TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.5...    34   1.3  
ABR084W Chr2 (540620..540649,540708..542072) [1395 bp, 464 aa] {...    34   1.4  
TDEL0B06860 Chr2 (1214531..1214560,1214657..1216012) [1386 bp, 4...    34   1.5  
CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} simil...    34   1.6  
TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {O...    34   1.7  
KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 ...    33   2.1  
KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]...    33   2.1  
Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {O...    33   2.2  
KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, ...    33   2.3  
TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.1...    33   4.1  
KLLA0B14839g Chr2 complement(1304089..1305354) [1266 bp, 421 aa]...    33   4.1  
Kpol_1043.17 s1043 complement(29682..31853) [2172 bp, 723 aa] {O...    33   4.5  
NCAS0H03060 Chr8 (588900..590318) [1419 bp, 472 aa] {ON} Anc_2.5...    32   5.8  
Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] ...    33   5.8  
TPHA0F01940 Chr6 (437533..439053) [1521 bp, 506 aa] {ON} Anc_2.1...    32   6.2  
Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}...    32   6.3  
Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {...    32   6.9  
NCAS0A09450 Chr1 (1877793..1879892) [2100 bp, 699 aa] {ON} Anc_1...    32   8.1  
KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] ...    32   10.0 

>ZYRO0D11308g Chr4 complement(955212..957818) [2607 bp, 868 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 868

 Score = 1677 bits (4343), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 815/868 (93%), Positives = 815/868 (93%)

Query: 1   MSQEAESEPVYXXXXXXXXXXXXXXXXXXXXXXVGESHTPSTTQQKLRXXXXXXXXXXXX 60
           MSQEAESEPVY                      VGESHTPSTTQQKLR            
Sbjct: 1   MSQEAESEPVYEEPIDIPLEEEDDDDEDDEADEVGESHTPSTTQQKLRAEAEAHGDADED 60

Query: 61  XXMDTMHANASRSGTSTPLGNANTAAGXXXXXXXXXXXXXXXXXNNKKRDSQGKFKKYPK 120
             MDTMHANASRSGTSTPLGNANTAAG                 NNKKRDSQGKFKKYPK
Sbjct: 61  EDMDTMHANASRSGTSTPLGNANTAAGDDDEMDDDELDDDDGDENNKKRDSQGKFKKYPK 120

Query: 121 LDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQPMILI 180
           LDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQPMILI
Sbjct: 121 LDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQPMILI 180

Query: 181 NQKNYSSDYLKKDEQVFALRDRKVLRNNTQVPSMANTPDVADLKRENGNTTELNEAAGDE 240
           NQKNYSSDYLKKDEQVFALRDRKVLRNNTQVPSMANTPDVADLKRENGNTTELNEAAGDE
Sbjct: 181 NQKNYSSDYLKKDEQVFALRDRKVLRNNTQVPSMANTPDVADLKRENGNTTELNEAAGDE 240

Query: 241 DIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQIPMDQKNQTCYTR 300
           DIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQIPMDQKNQTCYTR
Sbjct: 241 DIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQIPMDQKNQTCYTR 300

Query: 301 DQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIEDKNDYNRINWI 360
           DQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIEDKNDYNRINWI
Sbjct: 301 DQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIEDKNDYNRINWI 360

Query: 361 TTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDFTGLLEHVLRSP 420
           TTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDFTGLLEHVLRSP
Sbjct: 361 TTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDFTGLLEHVLRSP 420

Query: 421 RFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGIST 480
           RFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGIST
Sbjct: 421 RFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGIST 480

Query: 481 STCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFPYQDWDIETA 540
           STCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFPYQDWDIETA
Sbjct: 481 STCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFPYQDWDIETA 540

Query: 541 HGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQQAEKFDFKVFDEVILAPLSLFYPGI 600
           HGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQQAEKFDFKVFDEVILAPLSLFYPGI
Sbjct: 541 HGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQQAEKFDFKVFDEVILAPLSLFYPGI 600

Query: 601 VAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLYCGNQDEFQMLC 660
           VAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLYCGNQDEFQMLC
Sbjct: 601 VAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLYCGNQDEFQMLC 660

Query: 661 KLLDAPSRLDELQAENRLEPDIRQNYAPLEKAIVQSITNACLSFDVSKMSSFYSNILVCG 720
           KLLDAPSRLDELQAENRLEPDIRQNYAPLEKAIVQSITNACLSFDVSKMSSFYSNILVCG
Sbjct: 661 KLLDAPSRLDELQAENRLEPDIRQNYAPLEKAIVQSITNACLSFDVSKMSSFYSNILVCG 720

Query: 721 GGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVKNGEGKSNGPQED 780
           GGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVKNGEGKSNGPQED
Sbjct: 721 GGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVKNGEGKSNGPQED 780

Query: 781 EQLKEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPAILIWKGASVLAQIK 840
           EQLKEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPAILIWKGASVLAQIK
Sbjct: 781 EQLKEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPAILIWKGASVLAQIK 840

Query: 841 LVEELYLTGADWDIHGSRILQYKCIFTY 868
           LVEELYLTGADWDIHGSRILQYKCIFTY
Sbjct: 841 LVEELYLTGADWDIHGSRILQYKCIFTY 868

>TDEL0A03410 Chr1 complement(608343..610856) [2514 bp, 837 aa] {ON}
           Anc_5.477 YOR141C
          Length = 837

 Score = 1084 bits (2804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/803 (65%), Positives = 630/803 (78%), Gaps = 26/803 (3%)

Query: 68  ANASRSGTSTPLGNANTAAGXXXXXXXXXXXXXXXXXNNKKRDSQGKFKKYPKLDPAKAP 127
           A  SRS T+TP+G  N                           SQ + KK+P+LDPAKAP
Sbjct: 59  AEISRSATATPIGQRNHVEDEEDEDYNDEDAK-----------SQERAKKHPRLDPAKAP 107

Query: 128 PGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQPMILINQKNYSS 187
           PGKKVPLHLLEKRRLGRIKAAEEFA+KLK+IGIEK+E+ TLP TGLFQP++LINQKNYSS
Sbjct: 108 PGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKIESTTLPATGLFQPVLLINQKNYSS 167

Query: 188 DYLKKDEQVFALRDRKVLRNNTQVPSMANTPDVADLKRENGNTTELNE--AAGDEDIDLS 245
           DYLKKDEQ+FALR+RK LRNNTQ  S+ NTPDV D+K  N   TE+ +  AA DEDIDLS
Sbjct: 168 DYLKKDEQIFALRERKTLRNNTQTSSINNTPDVIDIKNTN---TEVPDYIAAADEDIDLS 224

Query: 246 DANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQIPMDQKNQTCYTRDQPTE 305
           DANTTLVIHPGS  L++GFAKDE P V+PSCVAIPK+EL+     D+  +    R+QP E
Sbjct: 225 DANTTLVIHPGSRHLRIGFAKDEVPLVVPSCVAIPKTELN-----DEFQEAPLKREQPEE 279

Query: 306 FEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIEDKNDYNRINWITTPDR 365
           FEE+K+ +QHSFRERMR+YKRKV  NAHEQV+++NK SKP++IED+ND   INWI    +
Sbjct: 280 FEELKSTIQHSFRERMRYYKRKVPFNAHEQVVSYNKNSKPQMIEDQNDPGAINWIKKSSK 339

Query: 366 RYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDFTGLLEHVLRSPRFQLK 425
           RYYG++AL+CSK+ F IR P  KGGSFN++SPDY SLQDL+ D   LLEH L +    L+
Sbjct: 340 RYYGSEALKCSKETFRIRCPFTKGGSFNVSSPDYASLQDLINDVISLLEHALSAEGLNLE 399

Query: 426 RSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGISTSTCVV 485
           R+QF+QYKVVLVIPDLF KSHVET IR L+TEMQFQAVAI+QESLA CYGAG S+STCVV
Sbjct: 400 RAQFSQYKVVLVIPDLFHKSHVETFIRFLLTEMQFQAVAIIQESLAGCYGAGQSSSTCVV 459

Query: 486 NIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFPYQDWDIETAHGWHL 545
           NIGAT T IAC+DEGTVL++S ++LDYG DD+TKLFALFLLQSEFPYQDWDI ++HGW L
Sbjct: 460 NIGATHTSIACIDEGTVLENSLVSLDYGGDDLTKLFALFLLQSEFPYQDWDINSSHGWIL 519

Query: 546 AEELKKNYTTFQDANVTVQLYNFIKRIPGQQAEKFDFKVFDEVILAPLSLFYPGIVAQLR 605
           AEELKK YTTFQDANV VQLYNFIKR+P QQ+E+++FKVFDEV LAPL+LFYP I++ L 
Sbjct: 520 AEELKKKYTTFQDANVAVQLYNFIKRVPDQQSEQYEFKVFDEVSLAPLALFYPEIISYLH 579

Query: 606 NELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLYCGNQDEFQMLCKLLDA 665
           ++    S N  +ES+LP SRDIFT+ ++DWRSLSQ+ECLD  LY GN +   ++ KLLD 
Sbjct: 580 SKSSQHSGNSNVESQLPASRDIFTNTVNDWRSLSQSECLDGDLYSGNNNNQLIMSKLLDL 639

Query: 666 PSRLDELQAENRLEPDIRQNYAPLEKAIVQSITNACLSFDVSKMSSFYSNILVCGGGSNV 725
            +  D+ Q++  +E D R+NY PLEKAI+QSITNA    DV+KMSSFYSNILV GGGS +
Sbjct: 640 QTSFDDFQSKPPMEADSRKNYTPLEKAIIQSITNASTPIDVAKMSSFYSNILVVGGGSKI 699

Query: 726 PAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVKNGEGKSNGPQEDEQLKE 785
           PA DFILTDRINIWRPR+LS TSFP+ YKKL+KQ KDIK + K GE      +E++Q  +
Sbjct: 700 PALDFILTDRINIWRPRLLSLTSFPNFYKKLAKQAKDIKTAGKTGES-----EEEDQSSK 754

Query: 786 KVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEEL 845
           K+ E+I  EL+ Y + IE+QN ++H LPV+VLPPPRD+D A L WKGA VLAQIKLVEEL
Sbjct: 755 KINEMISAELQAYWDSIEAQNGSEHLLPVNVLPPPRDMDAAELAWKGACVLAQIKLVEEL 814

Query: 846 YLTGADWDIHGSRILQYKCIFTY 868
           YLT  DWDIHGSRILQYKC+FTY
Sbjct: 815 YLTSTDWDIHGSRILQYKCLFTY 837

>YOR141C Chr15 complement(589942..592587) [2646 bp, 881 aa] {ON}
           ARP8Nuclear actin-related protein involved in chromatin
           remodeling, component of chromatin-remodeling enzyme
           complexes; has mRNA binding activity
          Length = 881

 Score =  969 bits (2506), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 476/762 (62%), Positives = 591/762 (77%), Gaps = 20/762 (2%)

Query: 114 KFKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGL 173
           ++KKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFA+ LKKIGIEKVET TLP TGL
Sbjct: 133 RYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVETTTLPATGL 192

Query: 174 FQPMILINQKNYSSDYLKKDEQVFALRDRKVLRNN-TQVPSMANTPDVADLKRENGNTTE 232
           FQP++LINQKNYSSDYLKKD+Q+FALRDRK LRNN T   S  NTPDV DLK  +   +E
Sbjct: 193 FQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTSQISSTNTPDVIDLK--SLPHSE 250

Query: 233 LNEAAGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKS--ELHNQIPM 290
            + A  +++IDL+D   T+VIHPGSNS+K+GF KD+ P V+P+CVA+PK   +L N    
Sbjct: 251 ASAAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDDHPVVVPNCVAVPKKWLDLENS--- 307

Query: 291 DQKNQTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIED 350
           +     C  R+Q  EF  IK+EM+ +FRERMR+YKRKV  NAHEQV++FN+ SKPE+I +
Sbjct: 308 EHVENVCLQREQSEEFNNIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEIISE 367

Query: 351 KNDYNRINWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDFT 410
           KND + I WI    + YYG+DALRC  + FVIR P  +GGSFN+ SP Y+SL +L+ D T
Sbjct: 368 KNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPF-RGGSFNVKSPYYKSLAELISDVT 426

Query: 411 GLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESL 470
            LLEH L S    +K ++F QYKVVLVIPD+F+KSHVET IR L+TE+QFQAVAI+QESL
Sbjct: 427 KLLEHALNSETLNVKPTKFNQYKVVLVIPDIFKKSHVETFIRVLLTELQFQAVAIIQESL 486

Query: 471 ATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEF 530
           ATCYGAGISTSTCVVNIGA +TRIACVDEGTVL+ S ITLDYG DDIT+LFALFLLQS+F
Sbjct: 487 ATCYGAGISTSTCVVNIGAAETRIACVDEGTVLEHSAITLDYGGDDITRLFALFLLQSDF 546

Query: 531 PYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQQAEKFDFKVFDEVIL 590
           P QDW I++ HGW LAE LKKN+TTFQDA+V VQLYNF+ R P Q  EK++FK+FDEV+L
Sbjct: 547 PLQDWKIDSKHGWLLAERLKKNFTTFQDADVAVQLYNFMNRSPNQPTEKYEFKLFDEVML 606

Query: 591 APLSLFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLYC 650
           APL+LF+P I   +R       +N  LE +LP SRD+FT+ L+DW SLSQ E  +  LYC
Sbjct: 607 APLALFFPQIFKLIRTS---SHKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGNLYC 663

Query: 651 GNQDEFQMLCKLLDAPSRLDELQAE-NRLEPDIRQNYAPLEKAIVQSITNACLSFDVSKM 709
              D+ ++L ++LDA + +D+LQ +       +++N+APLEKAIVQSI NA ++ DV++M
Sbjct: 664 DLNDDLKILNRILDAHNIIDQLQDKPENYGNTLKENFAPLEKAIVQSIANASITADVTRM 723

Query: 710 SSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVKN 769
           +SFYSNIL+ GG S +PA DFILTDRINIWRP +LS  SFP  YKKL+K+IKD++    N
Sbjct: 724 NSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLEGHYVN 783

Query: 770 GEGKSNGPQEDEQ---LKEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPA 826
              K+    EDE    L+ +++E I +ELE  H+ IE QN  +H  PVS++PPPRD++PA
Sbjct: 784 APDKT----EDENKQILQAQIKEKIVEELEEQHQNIEHQNGNEHIFPVSIIPPPRDMNPA 839

Query: 827 ILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868
           ++IWKGASVLAQIKLVEEL++T +DWD+HGSRILQYKCIFTY
Sbjct: 840 LIIWKGASVLAQIKLVEELFITNSDWDVHGSRILQYKCIFTY 881

>Smik_15.320 Chr15 complement(551333..553954) [2622 bp, 873 aa] {ON}
           YOR141C (REAL)
          Length = 873

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 473/763 (61%), Positives = 598/763 (78%), Gaps = 22/763 (2%)

Query: 114 KFKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGL 173
           ++KKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFA+ LKKIGIEKVE  TLP TGL
Sbjct: 125 RYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTLPATGL 184

Query: 174 FQPMILINQKNYSSDYLKKDEQVFALRDRKVLRNN--TQVPSMANTPDVADLKRENGNTT 231
           FQP++LINQKNYSSDYLKKD+Q+FALRDRK LRNN  TQV S  NTPDV DLK  N   +
Sbjct: 185 FQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSS-TNTPDVIDLK--NLPHS 241

Query: 232 ELNEAAGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQIPMD 291
           E N A+ +E+IDL+D+  T+VIHPGSNS+K+GF KDE P ++P+CVA+PK  L+ +    
Sbjct: 242 EANTASLNEEIDLNDSTATIVIHPGSNSVKIGFPKDEHPVLVPNCVAVPKKWLNLE---S 298

Query: 292 QKNQTCYT--RDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIE 349
            +N   ++  R+Q  +F  IK++M+ +FRERMR+YKRKV  NAHEQVI+FN+ SKPE+I 
Sbjct: 299 SENDEIFSLQREQSEKFHSIKSDMEKNFRERMRYYKRKVPGNAHEQVISFNENSKPEIIS 358

Query: 350 DKNDYNRINWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDF 409
           +KND + I WI    + YYG+DALRC  + F+IR P  KGGSFNI SP Y+SL +L+ D 
Sbjct: 359 EKNDPSPIKWIFDDSKLYYGSDALRCVDEKFIIRKPF-KGGSFNINSPYYKSLAELISDV 417

Query: 410 TGLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQES 469
           T LLE+ L+S    +K ++F QYKVVLVIPD+F+KSH+ET IR L+TE+QFQAVAI+QES
Sbjct: 418 TKLLEYALKSETLNVKPAKFNQYKVVLVIPDIFKKSHIETFIRVLLTELQFQAVAIIQES 477

Query: 470 LATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSE 529
           LATCYGAGISTSTCVVNIGA++TRIACVDEGTVL+ S ITLDYG DDIT+LF LFLLQS+
Sbjct: 478 LATCYGAGISTSTCVVNIGASETRIACVDEGTVLEHSAITLDYGGDDITRLFGLFLLQSD 537

Query: 530 FPYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQQAEKFDFKVFDEVI 589
           FP QDW I + HGW LAE+LKKN+TTFQDA+V VQLYNFI R P Q  EK++FK+FDEV+
Sbjct: 538 FPLQDWKINSEHGWLLAEQLKKNFTTFQDADVAVQLYNFINRSPNQPTEKYEFKLFDEVM 597

Query: 590 LAPLSLFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLY 649
           LAPL+LF+P I   +R       +N  LE +LP SRD+FT+ L+DW SLSQ E  +  LY
Sbjct: 598 LAPLALFFPQIFKLIRTS---SDKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGNLY 654

Query: 650 CGNQDEFQMLCKLLDAPSRLDELQAENRLEPDI-RQNYAPLEKAIVQSITNACLSFDVSK 708
           C   D+ ++L K+L A + +D+LQ +     +I ++N+APLEKAI+QSI NA ++ DV++
Sbjct: 655 CNLDDDLEILKKILQAHNMIDQLQDKPENYGNISKENFAPLEKAIIQSIANASITADVTR 714

Query: 709 MSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVK 768
           M+SFYSNIL+ GG S +PA DFILTDRINIWRP +LS  SFP  YKKL+K+IKD+++   
Sbjct: 715 MNSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLESHFV 774

Query: 769 NGEGKSNGPQEDEQ---LKEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDP 825
           N   K+    E+E    L+ +++E + +EL+  H+ IE+QN  +H  P+S++PPPRD++P
Sbjct: 775 NAPDKT----EEENKLVLQRQIKEKVVEELDEQHQNIENQNGNEHVFPISIIPPPRDMNP 830

Query: 826 AILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868
           A++IWKGASVLAQIKLVEEL++T  DWD+HGSRILQYKCIFTY
Sbjct: 831 ALIIWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 873

>Suva_8.192 Chr8 complement(345067..347706) [2640 bp, 879 aa] {ON}
           YOR141C (REAL)
          Length = 879

 Score =  959 bits (2478), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 472/760 (62%), Positives = 591/760 (77%), Gaps = 16/760 (2%)

Query: 114 KFKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGL 173
           ++KKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFA+ LKKIGIEKVE  TLP TGL
Sbjct: 131 RYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTLPATGL 190

Query: 174 FQPMILINQKNYSSDYLKKDEQVFALRDRKVLRNN--TQVPSMANTPDVADLKRENGNTT 231
           FQP++LINQKNYSSDYLKKD+Q+FALRDRK LRNN  TQV S  NTPDV D+K  +   +
Sbjct: 191 FQPLLLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQV-SSTNTPDVVDMK--SLPNS 247

Query: 232 ELNEAAGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQIPMD 291
           E + A  +++IDL+D   T+VIHPGSNS+K+GF KDE P V+P+CVA+PK  L+  +  D
Sbjct: 248 EPSTAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIVVPNCVAVPKKWLN--LAND 305

Query: 292 Q-KNQTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIED 350
           Q +      R Q  EFE IK+EM+ +FRERMR+YKRKV  NAHEQV++FN+ SKPE++  
Sbjct: 306 QNEGNISLQRKQSEEFESIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNESSKPEVVSV 365

Query: 351 KNDYNRINWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDFT 410
           KND + I WI    + YYG+DALRC  + FVIR P  KGG FNI SP Y+SL +L+ D  
Sbjct: 366 KNDPSPIEWIFDDSKLYYGSDALRCVDEKFVIRKPF-KGGCFNIDSPYYKSLAELISDVI 424

Query: 411 GLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESL 470
            LLE+ L S    +K ++F QYKVVLVIPD+F+KSHVET IR L+TE+QFQAVAI+QESL
Sbjct: 425 KLLEYALDSETLNVKPTKFNQYKVVLVIPDVFKKSHVETFIRVLLTELQFQAVAIIQESL 484

Query: 471 ATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEF 530
           ATCYGAGISTSTCVVNIGAT+TRIACVDEGTVL++S +TLDYG DDIT+LFAL LLQS+F
Sbjct: 485 ATCYGAGISTSTCVVNIGATETRIACVDEGTVLENSAVTLDYGGDDITRLFALLLLQSDF 544

Query: 531 PYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQQAEKFDFKVFDEVIL 590
           P QDW I + HGW LAE+LKKN+TTFQDA++ VQLYNFI R P +  EK++FK+FDEV+L
Sbjct: 545 PLQDWKINSEHGWLLAEQLKKNFTTFQDADIAVQLYNFINRSPNKPTEKYEFKLFDEVML 604

Query: 591 APLSLFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLYC 650
           APL+LF+P I   +R    P  +N  LE +LP SRD+FT+ L+DW SLSQ E  +  LYC
Sbjct: 605 APLALFFPQIFKLIR---APSGKNSSLEFQLPESRDLFTNELNDWNSLSQFESKEGDLYC 661

Query: 651 GNQDEFQMLCKLLDAPSRLDELQAE-NRLEPDIRQNYAPLEKAIVQSITNACLSFDVSKM 709
              D+ ++L K LDA + +D+LQ +  +     ++N  PLEKAI+QSITNA ++ DV++M
Sbjct: 662 NLNDDLKILNKTLDAHTMIDQLQDKPEKYGSTSKENLTPLEKAIIQSITNASVTADVTRM 721

Query: 710 SSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVKN 769
           SSFYSNIL+ GG S +PA DFILTDRINIWRP +LS TSFP  YKKL+K+IKD+++   +
Sbjct: 722 SSFYSNILIVGGSSKIPALDFILTDRINIWRPSLLSSTSFPQFYKKLTKEIKDLESHFVS 781

Query: 770 GEGKSNGPQEDEQ-LKEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPAIL 828
              K+   +E++Q L+ ++ E +  EL+  H+ IE QN  +H  P+S++PPPRD++PA++
Sbjct: 782 APEKTE--EENKQVLQLQINEKVVAELDEQHQSIEHQNGNEHLFPISIIPPPRDMNPALI 839

Query: 829 IWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868
           IWKGASVLAQIKLVEEL++T  DWD+HGSRILQYKCIFTY
Sbjct: 840 IWKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 879

>Skud_15.304 Chr15 complement(543860..546511) [2652 bp, 883 aa] {ON}
           YOR141C (REAL)
          Length = 883

 Score =  958 bits (2477), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/759 (61%), Positives = 597/759 (78%), Gaps = 14/759 (1%)

Query: 114 KFKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGL 173
           ++KKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFA+ LKKIGIEKVE  TLP TGL
Sbjct: 135 RYKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFAKTLKKIGIEKVEATTLPATGL 194

Query: 174 FQPMILINQKNYSSDYLKKDEQVFALRDRKVLRNN--TQVPSMANTPDVADLKRENGNTT 231
           FQP++LINQKNYSSDYLKKD+Q+FALRDRK LRNN  TQV S  NTPDV DLK  N + T
Sbjct: 195 FQPLMLINQKNYSSDYLKKDDQIFALRDRKFLRNNNTTQVSS-TNTPDVVDLK--NLSHT 251

Query: 232 ELNEAAGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQIPMD 291
           E + A  +++IDL+D   T+VIHPGSNS+K+GF KDE P ++P+CVA+PK  L+     +
Sbjct: 252 EPSTAPLNDEIDLNDPTATIVIHPGSNSIKIGFPKDEHPIIVPNCVAVPKKWLNLGNGPN 311

Query: 292 QKNQTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIEDK 351
           + N     R+Q  EFE IK+EM+ +FRERMR+YKRKV  NAHEQV++FN+ SKPE+I +K
Sbjct: 312 EDN-ISLQREQSDEFENIKSEMEKNFRERMRYYKRKVPGNAHEQVVSFNENSKPEIISEK 370

Query: 352 NDYNRINWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDFTG 411
           ND + I WI    + YYG+DALRC  + FV+R P  +GGSFNI SP Y SL +L+ D T 
Sbjct: 371 NDPSPIEWIFDDSKLYYGSDALRCVDEKFVVRKPF-QGGSFNINSPYYESLAELISDVTK 429

Query: 412 LLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLA 471
           LLE+ L S    +K ++F QYKVVLVIPD+F+K+HVET IR L+TE+QFQAVA++QESLA
Sbjct: 430 LLEYALASETLNVKSTKFNQYKVVLVIPDVFKKNHVETFIRVLLTELQFQAVAVIQESLA 489

Query: 472 TCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFP 531
           TCYGAGISTSTCVVNIGAT+TRIACVDEGTVL+ S +TL+YG DDIT+LFAL LLQS+FP
Sbjct: 490 TCYGAGISTSTCVVNIGATETRIACVDEGTVLEHSAVTLNYGGDDITRLFALLLLQSDFP 549

Query: 532 YQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQQAEKFDFKVFDEVILA 591
            QDW I+T HGW LAE+LKKN+TTFQDA++ VQLYNFI R P Q +EK++FK+FDEV+LA
Sbjct: 550 LQDWKIDTKHGWLLAEQLKKNFTTFQDADIAVQLYNFINRSPNQPSEKYEFKLFDEVMLA 609

Query: 592 PLSLFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLYCG 651
           PL+LF+P I   +R+      +N  LE +LP SRD+FT+ L+DW SLSQ E  +  LY  
Sbjct: 610 PLALFFPQIFKLIRSS---SGKNSNLEFQLPESRDLFTNELNDWNSLSQFESKEGDLYSN 666

Query: 652 NQDEFQMLCKLLDAPSRLDELQAENRLEPDI-RQNYAPLEKAIVQSITNACLSFDVSKMS 710
             D+ ++L K+L+A + +D++Q +     D  ++N+APLEKAI+QSI NA ++ DV++M+
Sbjct: 667 LNDDLKILNKILEAHTIIDQIQDKPENYGDTSKENFAPLEKAIIQSIANASITADVTRMN 726

Query: 711 SFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVKNG 770
           SFYSNIL+ GG S +PA DFILTDRINIWRP +LS  SFP  YKKL+K+IKD+++   N 
Sbjct: 727 SFYSNILIVGGTSKIPALDFILTDRINIWRPSLLSSASFPQFYKKLTKEIKDLESHFVNA 786

Query: 771 EGKSNGPQEDEQ-LKEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPAILI 829
             K+   +E++Q ++ ++++ +  EL+  H+ IE+QN  +H  PVS++PPPRD++PA++I
Sbjct: 787 PDKTE--EENKQVMQSQIKDKVVAELDEQHQNIENQNGNEHLFPVSIIPPPRDMNPALII 844

Query: 830 WKGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868
           WKGASVLAQIKLVEEL++T  DWD+HGSRILQYKCIFTY
Sbjct: 845 WKGASVLAQIKLVEELFITNNDWDVHGSRILQYKCIFTY 883

>Kpol_543.10 s543 complement(25137..27767) [2631 bp, 876 aa] {ON}
           complement(25137..27767) [2631 nt, 877 aa]
          Length = 876

 Score =  942 bits (2435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/776 (58%), Positives = 591/776 (76%), Gaps = 25/776 (3%)

Query: 105 NNKKRDSQGKFKKYPKLDPAKAPPG----KKVPLHLLEKRRLGRIKAAEEFARKLKKIGI 160
           ++KK+D     +K    D   A P     KKVP HLLEKRRLGR+KAAE FA KLKK GI
Sbjct: 114 DSKKQDKAESPEKGNNTDSGNATPSTTENKKVPRHLLEKRRLGRLKAAEAFAAKLKKTGI 173

Query: 161 EKVETNTLPPTGLFQPMILINQKNYSSDYLKKDEQVFALRDRKVLRNNTQVPSMANTPDV 220
           E+V+ + L  TGLF  M+L+NQKN SSDYLKKD+QVFALR+RK LRNNT V + ANTPDV
Sbjct: 174 ERVDNSHLQQTGLFGQMLLVNQKNCSSDYLKKDDQVFALRERKTLRNNTTVSTTANTPDV 233

Query: 221 ADLKR-ENGNTTELNEAA---GDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSC 276
            DLK   NG++  L +      D+DID +D  TT+VIHPGS  LK+GFAKDE+P V+PSC
Sbjct: 234 VDLKALNNGSSASLVDEVLNKNDDDIDFNDPTTTIVIHPGSRYLKIGFAKDETPLVVPSC 293

Query: 277 VAIPKSELHNQIPMDQKNQTCYTRDQPTEFEEI---KAEMQHSFRERMRFYKRKVQPNAH 333
           VAIPK+ L+++      N    + D+  + E +   KA++Q SFRERMR+YKRK+QPN+H
Sbjct: 294 VAIPKNSLYSE------NVRELSIDKIEDSERLVGMKAQLQQSFRERMRYYKRKIQPNSH 347

Query: 334 EQVINFNKVSKPELIEDKNDYNRINWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFN 393
           E+V  FN+ +KPE++EDKND+ RI WI   D+ Y+G +A RC+K++F+IRYP  KGGS N
Sbjct: 348 ERVRTFNEQAKPEIVEDKNDHGRIEWINNSDKIYFGEEAERCNKENFIIRYPFNKGGSLN 407

Query: 394 IASPDYRSLQDLMGDFTGLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRC 453
           + SP Y SL +L+ D T L E+ L      + ++Q  Q KV+LVIPDLFEKSH+ETL R 
Sbjct: 408 LDSPYYSSLPELLSDVTRLFEYALTKRDESITQAQIQQCKVILVIPDLFEKSHIETLYRI 467

Query: 454 LITEMQFQAVAIMQESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYG 513
           L+ EMQFQAVAIMQESLA CYGAGIST++C+VNIGATQT IACVDEGTVL++S I LDYG
Sbjct: 468 LLKEMQFQAVAIMQESLAACYGAGISTASCIVNIGATQTTIACVDEGTVLENSLIKLDYG 527

Query: 514 SDDITKLFALFLLQSEFPYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIP 573
            DDIT+LF LFLL++ FP+QD D+++ HGW LAE+LKKNY TF+DAN+TVQLYNF+KRIP
Sbjct: 528 GDDITRLFTLFLLENNFPFQDLDLDSTHGWTLAEQLKKNYATFEDANMTVQLYNFVKRIP 587

Query: 574 GQQAEKFDFKVFDEVILAPLSLFYPGIVAQLRNELKPRSQNE-KLESELPISRDIFTDNL 632
           G+ +EK++FKVFDEVILAPL+LFYP I  +L+   K  S+N+  LE +LP+SRD++TD++
Sbjct: 588 GKVSEKYEFKVFDEVILAPLALFYPDIFQELK---KLDSKNKFNLEDQLPVSRDLYTDSI 644

Query: 633 DDWRSLSQTECLDNQLYCGNQDEFQMLCKLLDAPSRLDELQAENRLEPDIRQNYAPLEKA 692
           +DWRS+SQ +CLD  LY GN +E  ++ K+L+  S  +E +     E D R+NY PLEKA
Sbjct: 645 NDWRSVSQLQCLDGDLYAGNTNELDIITKVLNINSSTEEYEGLETTEVDGRENYVPLEKA 704

Query: 693 IVQSITNACLSFDVSKMSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDL 752
           I+QSITNAC+S DVSKM+ FY+NI+V GG SN+P  DF+LTDRINIWRP+ L +T+FP  
Sbjct: 705 IIQSITNACVSMDVSKMNQFYANIMVVGGTSNIPQLDFVLTDRINIWRPKALCNTTFPHF 764

Query: 753 YKKLSKQIKDIKNSVKNGEGKSNGPQEDEQLKEKVQEVIKKELERYHELIESQNNADHTL 812
           +K +SKQ+K+I+++ K     S  P+E+E++K+ ++E+I+ EL +Y   IESQ N DH+ 
Sbjct: 765 FKNISKQVKEIQSTSK----ASTTPEEEEKIKQSIKELIETELRKYLNSIESQGNGDHSY 820

Query: 813 PVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868
           PV+VLPPPRD++P +L WKGASVLAQIKL+EEL++T  DWD+ GSRILQYKC+FTY
Sbjct: 821 PVAVLPPPRDMNPEVLNWKGASVLAQIKLIEELFVTNTDWDMLGSRILQYKCLFTY 876

>NCAS0H02290 Chr8 complement(450017..452608) [2592 bp, 863 aa] {ON}
           Anc_5.477 YOR141C
          Length = 863

 Score =  914 bits (2361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/808 (56%), Positives = 592/808 (73%), Gaps = 33/808 (4%)

Query: 65  TMHANASRSGTSTPLGNANTAAGXXXXXXXXXXXXXXXXXNNKKRDSQGKFKKYPKLDPA 124
           T    A+ + T TP+G+AN                       K    +G  KK  K++P 
Sbjct: 85  TTSGTATPTRTLTPMGSAN----------------------GKTTKEEGPQKKVQKVEPN 122

Query: 125 KAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQPMILINQKN 184
           K P GKKVPLHLLEKRRLGRIKAA+EFA+KLK+IGIEKVE+  +P TG+FQP++LINQKN
Sbjct: 123 KVPLGKKVPLHLLEKRRLGRIKAAKEFAKKLKEIGIEKVESVPVPMTGMFQPLLLINQKN 182

Query: 185 YSSDYLKKDEQVFALRDRKVLRNNT-QVPSMANTPDVADLK--RENGNTTELNEAAGDED 241
           YSSDYL+KDEQ+FALR+RK LR+NT Q  S +NTP+V DL+  RE  N T  N    +++
Sbjct: 183 YSSDYLRKDEQIFALRERKTLRSNTTQNISSSNTPEVTDLQSVRETSNFTTAN--GNNDE 240

Query: 242 IDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQIPMDQKNQTCYTRD 301
           I L+D NTT+VIHPGS+ LKVGFA DE P +IP+CVA+PK++ +N   +  K QT    +
Sbjct: 241 ILLNDPNTTIVIHPGSSFLKVGFALDEVPELIPNCVALPKTDFNNTNIIKSK-QTSVNIE 299

Query: 302 QPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIEDKNDYNRINWIT 361
              +FE +KAEM+ SF ERMR+YKR++QPN H+QV++FN++SKPE +  +ND   I+WIT
Sbjct: 300 DNEKFESLKAEMEESFEERMRYYKRRIQPNGHDQVVSFNRLSKPESLPVQNDPAHIDWIT 359

Query: 362 TPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDFTGLLEHVLRSPR 421
              +R+YG DALRC+ ++F+ RYP  KGGSFN +S  Y+SLQDL+ D  GL+E  L S +
Sbjct: 360 DGTKRFYGDDALRCTDENFIKRYPFKKGGSFNTSSNSYKSLQDLLSDVVGLIEGTLSSDK 419

Query: 422 FQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGISTS 481
           F +K SQF+QYKVVLVIPD FEKSHVE  IR L+TE+QFQAVAI+QESL+ CYG+G+  S
Sbjct: 420 FNIKSSQFSQYKVVLVIPDSFEKSHVELFIRLLVTELQFQAVAIIQESLSVCYGSGLGGS 479

Query: 482 TCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFPYQDWDIETAH 541
           TCVVN+G+ +T +ACVDEG VL +S ITLDYGS+D+TKLFA FLL  +FPY++WD+ +  
Sbjct: 480 TCVVNVGSKETTVACVDEGIVLDNSLITLDYGSNDVTKLFAKFLLDCDFPYKNWDLNSTE 539

Query: 542 GWHLAEELKKNYTTFQDANVTVQLYNFIKRIP-GQQAEKFDFKVFDEVILAPLSLFYPGI 600
           GW LAEEL K   TFQDA++TVQL NFIKR P G   EK DFKVF+EV+LAPL+LFYP I
Sbjct: 540 GWRLAEELMKQCVTFQDADITVQLSNFIKRTPRGNTVEKLDFKVFEEVMLAPLALFYPEI 599

Query: 601 VAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLYCGNQDEFQMLC 660
              LR++ +   QN +LE +LP SRDIFTD ++DWRSLSQ +C+++Q +C   DE+++L 
Sbjct: 600 FKLLRSK-ESEEQNAELEYQLPPSRDIFTDKINDWRSLSQNDCINHQTFCDIHDEYELLK 658

Query: 661 KLLDAPSRLDELQAENRLEPDIRQNYAPLEKAIVQSITNACLSFDVSKMSSFYSNILVCG 720
           K +D P+ L+        E     N+ PL+KAIV+SIT A L  DVSKM++FYSNILV G
Sbjct: 659 KAVDCPNTLETFMDNPPEEKKSTFNFTPLDKAIVESITTASLGLDVSKMATFYSNILVVG 718

Query: 721 GGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVKNGEGKSNGPQED 780
           GGS +P FD +L DR+NIWRPR+LS  +F   Y++L+KQ+K+++ S+K G+G+    +ED
Sbjct: 719 GGSKIPGFDLMLMDRVNIWRPRLLSLRAFTHFYRELTKQLKELQ-SLKTGDGEEE-IKED 776

Query: 781 EQLKEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPAILIWKGASVLAQIK 840
           E L EK+ E+IK EL +Y E+IE Q+  +H LPV V+P P ++DP  + WKGASVLAQIK
Sbjct: 777 E-LNEKISELIKTELTKYLEVIEQQSGNEHFLPVEVIPSPNEIDPGSIAWKGASVLAQIK 835

Query: 841 LVEELYLTGADWDIHGSRILQYKCIFTY 868
           LVEEL++T  DWD+HG+RILQYK I TY
Sbjct: 836 LVEELFITNGDWDVHGNRILQYKSILTY 863

>TBLA0A02530 Chr1 (610524..613088) [2565 bp, 854 aa] {ON} Anc_5.477
           YOR141C
          Length = 854

 Score =  909 bits (2350), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 439/757 (57%), Positives = 575/757 (75%), Gaps = 19/757 (2%)

Query: 116 KKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQ 175
           KK PK+D +K    KK  LHLLEKRRLGR+KAAEEFA+KLK+ GIEK+ET T+ PTGLFQ
Sbjct: 113 KKNPKIDSSK---NKKFHLHLLEKRRLGRLKAAEEFAKKLKQSGIEKIETLTVNPTGLFQ 169

Query: 176 PMILINQKNYSSDYLKKDEQVFALRDRKVLRNNTQVP-SMANTPDVADLKRENGNTTELN 234
           P +LINQKNYSSDYLKKD Q+FA+R+RK +R N Q   S+ NTPD  + +       E N
Sbjct: 170 PAMLINQKNYSSDYLKKDSQIFAMRNRKEIRENAQTTTSLNNTPDFQEGR------GEAN 223

Query: 235 EAAGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQIPMDQKN 294
           +AA DEDI+L D +TT+VIHPGS  LK+G+A+D +P +IPSCVA+PK++  + +  +  +
Sbjct: 224 QAAQDEDINLGDPSTTIVIHPGSKFLKIGYAQDPNPILIPSCVAVPKNQFLDTVS-ELND 282

Query: 295 QTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIEDKNDY 354
              Y++DQ  +F+E K E+  SF+ERMRFYKRKVQ N HEQV++FNK SKPE + +KND 
Sbjct: 283 NFNYSKDQSEKFDEYKNELLKSFKERMRFYKRKVQTNGHEQVLSFNKNSKPEDVTEKNDI 342

Query: 355 NRIN-WITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDFTGLL 413
             +N WI  P ++Y+G+DA+RCSK++F+IRYP + GGSFNI +P YR+L +L+ +    L
Sbjct: 343 EDVNRWINDPQKKYFGSDAIRCSKENFIIRYPFINGGSFNIEAPYYRTLSELLSEVCEFL 402

Query: 414 EHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATC 473
            H+L S  FQLK S F+ YK+VLVI D+FEKSH+E + R L+ EMQF AVAI+QESLATC
Sbjct: 403 VHILTSDTFQLKTSDFSSYKIVLVISDIFEKSHLEVMFRLLLNEMQFNAVAIIQESLATC 462

Query: 474 YGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFPYQ 533
           YGAG+ +STCVVN+GATQTRIACVDEG++++DS ++LDYG DDITKLF++ LLQS FPY 
Sbjct: 463 YGAGVGSSTCVVNVGATQTRIACVDEGSIVEDSIVSLDYGGDDITKLFSILLLQSGFPYT 522

Query: 534 DWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQQAEKFDFKVFDEVILAPL 593
           D +I  AH W LAE+LKK++ TF DANVTVQLYNFIKR+PGQ  +K++F+ F+EV+LAPL
Sbjct: 523 DLNINAAHDWILAEKLKKDFVTFHDANVTVQLYNFIKRVPGQIPQKYEFETFEEVMLAPL 582

Query: 594 SLFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLYCGNQ 653
           SLFYP ++  L++E   + +NE+++ +LP SRDIFT  L+DW+S++Q +CL+  LY    
Sbjct: 583 SLFYPQVLKLLKSEQLAKYKNEQVKKQLPASRDIFTSELNDWKSIAQADCLNKNLYSETS 642

Query: 654 DEFQMLCKLLDAPSRLDELQAENRLEPDI-RQNYAPLEKAIVQSITNACLSFDVSKMSSF 712
           DE  ML + L+    L+E++ E   E +I   NY  LEKAI+QSI NA  S D+SK++SF
Sbjct: 643 DEISMLKRTLNIHLNLEEIRDEIDKEHEIPNSNYTSLEKAIIQSIANASASLDISKINSF 702

Query: 713 YSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVKNGEG 772
           YSNIL+ GGG+ +P+ DFIL DRI IWRPR+LS  SFP  YKKL+K IK++ N      G
Sbjct: 703 YSNILLVGGGAKIPSLDFILEDRIKIWRPRLLSVNSFPTFYKKLTKLIKELPNY-----G 757

Query: 773 KSN-GPQEDEQLKEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPAILIWK 831
           K+N   +E+E LK+ + E+IK E E Y  ++E Q + D   PVS+LP PR++DPA LIWK
Sbjct: 758 KTNKTSEEEESLKKAIDELIKTEFEAYGPILEQQASNDSFFPVSILPSPRNMDPAELIWK 817

Query: 832 GASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868
           GASVLAQIKLVEEL++T ADWD+HGSRILQ+KCIFTY
Sbjct: 818 GASVLAQIKLVEELFVTTADWDMHGSRILQHKCIFTY 854

>TPHA0J02790 Chr10 complement(621474..624122) [2649 bp, 882 aa] {ON}
           Anc_5.477 YOR141C
          Length = 882

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/764 (55%), Positives = 558/764 (73%), Gaps = 27/764 (3%)

Query: 124 AKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQPMILINQK 183
           +  P   K+   +LE+RRLGR +AA  +A KL+K GIEK E + +  TGLF+P+ L+NQK
Sbjct: 127 SNKPVSTKMSTSVLERRRLGRQRAAAAYAIKLQKTGIEKKENDNIQSTGLFRPIPLVNQK 186

Query: 184 NYSSDYLKKDEQVFALRDRKVLRNNTQVPSM-------------ANTPDVADLKRENG-- 228
           N SSDYLK + Q+FALR+RKVLRNNT + ++             ANTP+V+DLK  N   
Sbjct: 187 NCSSDYLKTNSQIFALRERKVLRNNTNIININSGNNSNSTSGTTANTPEVSDLKNVNSES 246

Query: 229 NTTELNEAA---GDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELH 285
           N + ++E       ++I   D  TT+VIHPGS  LK+GFAKD+SP VIP+CVA PK+ L+
Sbjct: 247 NVSLIDETILKNNPDNIVFDDPTTTIVIHPGSRYLKIGFAKDDSPLVIPNCVAFPKNSLY 306

Query: 286 NQIPMDQKNQTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKP 345
           ++       +T  ++++   F+  K ++Q SFR+RMR+YKRK+Q N+HE+V +FN  SKP
Sbjct: 307 SE----NVEETIVSKEESDNFKTKKNQIQQSFRDRMRYYKRKIQNNSHERVRSFNIQSKP 362

Query: 346 ELIEDKNDYNRINWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDL 405
           E +EDK +YNR+ WIT PD+ YYG +A RCSKD F+IRYP VKGGSFNI SP Y SL ++
Sbjct: 363 EKVEDKTEYNRVEWITNPDKIYYGEEASRCSKDAFIIRYPFVKGGSFNITSPYYNSLPEI 422

Query: 406 MGDFTGLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAI 465
           +GD + L E+ L   RF LK S++++YK++LVIPD+FEKSH+ET+ R L+ EM+FQAVAI
Sbjct: 423 IGDISNLFEYALSQDRFNLKPSEYSKYKIILVIPDIFEKSHLETMFRVLLKEMKFQAVAI 482

Query: 466 MQESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFL 525
           MQESLA  YGAGI  +TC+VNIGATQTR+AC+DEGTV + S ITLDYG DDITKLF   L
Sbjct: 483 MQESLAASYGAGIGGATCIVNIGATQTRVACIDEGTVSEHSLITLDYGGDDITKLFLHLL 542

Query: 526 LQSEFPYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQQAEKFDFKVF 585
           LQ+EFPYQD DI ++HGW   E LKK + TF+DAN+TVQLYNFIK  PG QAEK +FKVF
Sbjct: 543 LQNEFPYQDLDINSSHGWRQIENLKKQFVTFEDANITVQLYNFIKNKPGAQAEKLEFKVF 602

Query: 586 DEVILAPLSLFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLD 645
           DEVI APL LFYP I   +  E + R  N+KL+ +LP S D++T+  DDWRSLSQ +CLD
Sbjct: 603 DEVINAPLGLFYPEIFRIMAEENEKRRVNKKLQDQLPPSTDLYTEERDDWRSLSQVQCLD 662

Query: 646 NQLYCGNQDEFQMLCKLLDAPSRLDELQAENRLEPDIRQNYAPLEKAIVQSITNACLSFD 705
           N  Y GN ++  ++ KLL+A   LD++   N  + +  +NY  L+KAI+QSITNA ++ D
Sbjct: 663 NDTYSGNDNDLDVITKLLNANLNLDDMDLINNDQNENEKNYTSLDKAIIQSITNAVVTMD 722

Query: 706 VSKMSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKN 765
            SKM+ FY+NI+V GG S++P+ DFILTDRINIWRPRILS   FP  ++ L KQ+KD   
Sbjct: 723 TSKMTQFYNNIMVVGGSSSIPSLDFILTDRINIWRPRILSSREFPSFFRNLVKQVKDFNT 782

Query: 766 SVKNGEGKSNGPQEDEQLKEK-VQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLD 824
           + K+    +N P+E E+ ++K + E+IK EL++Y + +ESQN  +H LPVSVLPPP D+D
Sbjct: 783 ANKS----NNRPEEGEEEQKKGIAELIKTELKKYKDNLESQNANEHLLPVSVLPPPADMD 838

Query: 825 PAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868
           P++L WKGASVL Q+KL+EELY+T ADWD+ GSRILQYKC+F Y
Sbjct: 839 PSVLNWKGASVLGQLKLIEELYVTNADWDMLGSRILQYKCLFPY 882

>CAGL0I07161g Chr9 (686948..689461) [2514 bp, 837 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141c ARP8
           Actin-related protein
          Length = 837

 Score =  856 bits (2212), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 406/775 (52%), Positives = 562/775 (72%), Gaps = 23/775 (2%)

Query: 109 RDSQGKFKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTL 168
           R  + K++KYP LDP KAPPGKKVPLHLLEKRRLGR+KAAEEFARKLK +GIE+VE   L
Sbjct: 71  RRGKKKYQKYPDLDPLKAPPGKKVPLHLLEKRRLGRLKAAEEFARKLKVVGIERVENLNL 130

Query: 169 PPTGLFQPMILINQKNYSSDYLKKDEQVFALRDRKVLRN-NTQVPSMANTPDVADLKREN 227
           P +GLF P+ LINQKNYSSDYL+KDE  FA+R+RK +RN N    + A T ++    +  
Sbjct: 131 PQSGLFSPVPLINQKNYSSDYLRKDENAFAVRERKQMRNSNANNSAHAKTSELGSGAQSA 190

Query: 228 ------------GNTTELNEAAGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPS 275
                          T+L      EDID +D   T+VIHPGS+S+K+G A DE P  IP+
Sbjct: 191 SMASSASLDALVDTDTKLQSV---EDIDFNDPRLTIVIHPGSDSIKIGLATDEEPVSIPN 247

Query: 276 CVAIPKSELHNQIPMDQKNQTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQ 335
            VA+P+S++ N  P+D+        +   +F E+  +++++F+ERM++YKRK+Q NAHEQ
Sbjct: 248 LVAVPRSQVVN--PVDETPVNVLNIELDDQFHELTNQLKYNFKERMKYYKRKMQSNAHEQ 305

Query: 336 VINFNKVSKPELIEDKNDYNRINWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIA 395
           V +FN  SKPE + DKND  +I+WI   D++YYG DA RC  D F++R P  K G FN+ 
Sbjct: 306 VTSFNSNSKPEEVSDKNDQGKIDWIYNADKKYYGEDAQRCIGDEFILRRPFCKSGIFNLE 365

Query: 396 SPDYRSLQDLMGDFTGLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLI 455
           S +Y S+QDL+GD + L++  L S +F + +S++  YK V+VIPDLF+KSH+ET IR L+
Sbjct: 366 SNNYSSIQDLLGDVSELVDSALSSDKFNITKSEYKHYKAVIVIPDLFKKSHLETFIRLLL 425

Query: 456 TEMQFQAVAIMQESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSD 515
            EM F++VA+MQESLATCYGAGIST TCVVNIGA Q RIACVD+GT++QDS +TLDYG +
Sbjct: 426 NEMDFRSVALMQESLATCYGAGISTPTCVVNIGAEQIRIACVDDGTIIQDSAVTLDYGGN 485

Query: 516 DITKLFALFLLQSEFPYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQ 575
           D+T L A+ L QS+FPY++W++ T +GW  AE+ KK + TFQDA++ VQL+NFIKR+PG 
Sbjct: 486 DVTNLLAILLQQSKFPYKNWNLSTLYGWKTAEDFKKKFVTFQDADIAVQLFNFIKRVPGI 545

Query: 576 QAEKFDFKVFDEVILAPLSLFYPGIVAQLRNELKPRSQNEK--LESELPISRDIFTDNLD 633
            +EK+DFKVFDEVILAPL LFYP I   ++   +P ++  +  L  ++  SRDI+T++L+
Sbjct: 546 PSEKYDFKVFDEVILAPLGLFYPEIFKYIQERQRPTAKEYETTLLKQIEPSRDIYTNSLN 605

Query: 634 DWRSLSQTECLDNQLYCGNQDEFQMLCKLLDAPSRLDELQAENRLEPDIRQNYAPLEKAI 693
           DWRS++Q +C +N +YC  +D+ +++   LD  + +++LQ+++  E   ++ + PL+KAI
Sbjct: 606 DWRSITQRDCEENMIYCDAKDDLEIIQHALDLNTHIEDLQSKHIEENTDKKCFVPLDKAI 665

Query: 694 VQSITNACLSFDVSKMSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLY 753
           VQSITNA ++ D+SK+S FYSNI++ GGG+N+PA DFIL+DRINIWRP +L  +SFP+ Y
Sbjct: 666 VQSITNAAINVDISKISQFYSNIIIVGGGANIPALDFILSDRINIWRPAVLGISSFPNFY 725

Query: 754 KKLSKQIKDIKNSVKNGEGKSNGPQEDEQLKEKVQEVIKKELERYHELIESQNNADHTLP 813
           K L+KQ+KDI+ S K+  G  +  QE   + E+   ++K EL++    +E  N+ DH   
Sbjct: 726 KSLTKQLKDIQTSNKSNTGDKSQEQE---VAERSIALVKVELDKLVASLEIPNSGDHFFT 782

Query: 814 VSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868
           V VLP PR+LDP++L WKGASVLAQIKL+EELY++  DWD+HG+R+LQYKCIF Y
Sbjct: 783 VGVLPAPRNLDPSLLDWKGASVLAQIKLIEELYISRNDWDVHGNRVLQYKCIFAY 837

>NDAI0C01370 Chr3 (283773..286697) [2925 bp, 974 aa] {ON} Anc_5.477
           YOR141C
          Length = 974

 Score =  858 bits (2218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/835 (52%), Positives = 581/835 (69%), Gaps = 76/835 (9%)

Query: 105 NNKKRDSQGKFKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVE 164
           N K +  +  +KKYPK+DP K PPGKKVPLHLLEKRRLGRIKAAEEFA+KLK+ GIEKVE
Sbjct: 145 NKKLKSKEEAYKKYPKMDPKKVPPGKKVPLHLLEKRRLGRIKAAEEFAKKLKEAGIEKVE 204

Query: 165 TNTLPPTGLFQPMILINQKNYSSDYLKKDEQVFALRDRKVLRNNTQVPSMANTPDVADLK 224
           + T+PPTGLFQP+ LINQKNYSS YLK D+Q+F LRD K L+N +   +   TPD     
Sbjct: 205 SVTVPPTGLFQPLNLINQKNYSSIYLKNDDQIFCLRDDKSLKNTSPNQTSTATPDNI--- 261

Query: 225 RENGNTTELNEAAGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSEL 284
            E+  T   N++ GD+ ++L+D   T++IH GS+SLK+G A DE+P ++P+CVAIPK E 
Sbjct: 262 VESVATGINNKSTGDQ-LNLNDPTKTIIIHTGSHSLKIGKALDENPIIVPNCVAIPKQEY 320

Query: 285 H---------NQIPMDQKNQTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQ 335
                     + IP   +N    +  Q  EF ++K E++ +F+ERM++YKR++QPN+ EQ
Sbjct: 321 EGMTRNINTKDSIPTPPENNIFDSIAQSDEFNDLKLEIETNFKERMKYYKRRIQPNSCEQ 380

Query: 336 VINFNKVSKPELIEDKNDYNRINWIT-TPDRRYYGADALRCSKDHFVIRYPIVKGGSFNI 394
           V +FNK+SKPE++   ND  RI WI  + ++RYYG++A RC+  HF  R P    GSFNI
Sbjct: 381 VKSFNKISKPEILPISNDPQRIQWINESTNKRYYGSNAERCTDLHFKTRKPFSNNGSFNI 440

Query: 395 ASPDYRSLQDLMGDFTGLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCL 454
           AS DY SLQDL+ D T L+EH L S  F LK SQF ++KVVL+IPD F KSHVE  I  L
Sbjct: 441 ASTDYISLQDLLSDVTNLIEHSLTSSPFDLKPSQFKEHKVVLIIPDSFGKSHVELFITLL 500

Query: 455 ITEMQFQAVAIMQESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGS 514
           +T ++FQAVAI+QESLATCYGAG S  TCVVN+GA+QT +ACVDEGTVL++S ++L+YG 
Sbjct: 501 LTHLKFQAVAIIQESLATCYGAGNSVPTCVVNLGASQTTVACVDEGTVLENSMVSLNYGG 560

Query: 515 DDITKLFALFLLQSEFPYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPG 574
           +DIT +FA FLLQ++FPY +W++ +  GW LAEELK+ Y TFQD +VTVQL+NFIKR+PG
Sbjct: 561 NDITNIFATFLLQNDFPYHNWNLNSIEGWKLAEELKEKYITFQDMDVTVQLFNFIKRLPG 620

Query: 575 QQA-EKFDFKVFDEVILAPLSLFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLD 633
               EK+DFKVFD+V+LAPL+LF+P I+ +L  E +P+++N+ L+S+LP SRDI+T  ++
Sbjct: 621 MDTIEKYDFKVFDDVMLAPLTLFFPKIL-KLMKEQQPQNRNKFLQSQLPDSRDIYTTKIN 679

Query: 634 DWRSLSQTECLDNQLYCGNQDEFQMLCKLLDAPSRLDELQAENRLEPDIRQNYAPLEKAI 693
           DWRS++Q ECL+++L+    +E ++L + L+ P  L+  Q  +    + + NY PL+ AI
Sbjct: 680 DWRSITQEECLESKLFSYIDNELELLKRTLEVPILLENFQNNSPDNKNDKLNYTPLDVAI 739

Query: 694 VQSITNACLSFDVSKMSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLY 753
           +QSI NA  + D+SKMSSFYSNILV GGGS +PA DFILTDRINIWRPR+LS TSFP+ Y
Sbjct: 740 IQSIMNASTNIDMSKMSSFYSNILVVGGGSKIPALDFILTDRINIWRPRLLSLTSFPNFY 799

Query: 754 KKLSKQIKDIKN--------------------------------------SVKNGEGKSN 775
           K+LSK IKD++N                                       V +G   SN
Sbjct: 800 KELSKDIKDLQNHYLKLISTATAATTQTTATATTNNNTTNSTSNSTPAITQVPSGTNISN 859

Query: 776 G----------PQEDEQLKEKVQEV-----------IKKELERYHELIE-SQNNADHTLP 813
                        E  +++E V ++           +K++LE Y E +E +QN  DH LP
Sbjct: 860 NLNSTKIDNTPGAETNEVEEAVNKLKREMDDKINELLKEKLEEYLETVEKAQNGNDHYLP 919

Query: 814 VSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868
           VSV+P PRD+DPA+++WKGASVLAQ+K++EELY+T ADWD+HGSRILQYK IF Y
Sbjct: 920 VSVVPAPRDIDPALILWKGASVLAQLKIIEELYMTNADWDVHGSRILQYKSIFPY 974

>KAFR0E02530 Chr5 (516623..519151) [2529 bp, 842 aa] {ON} Anc_5.477
           YOR141C
          Length = 842

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/780 (52%), Positives = 541/780 (69%), Gaps = 49/780 (6%)

Query: 120 KLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQPMIL 179
           +L   K   G KVP HLLE+RR+GRIKAAE FA+KLKKIGIEK+E  TLP TGLFQP+ L
Sbjct: 81  QLSYGKTMAGTKVPKHLLERRRIGRIKAAEAFAKKLKKIGIEKIENITLPQTGLFQPLNL 140

Query: 180 INQKNYSSDYLKKDEQVFALRDRKVLRNNTQVPSMANTPDVADLKRENGNTTELNEAAGD 239
           INQKNYSSDY++KD+Q+FALR+RK LR++T   +   +   A          +L     D
Sbjct: 141 INQKNYSSDYIRKDDQIFALRERKTLRSSTNANNNNTSTPKA--------VVDLKTGVMD 192

Query: 240 EDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQIPMDQKNQTCYT 299
           ++IDL+D N+T++I PGS ++K+GFA DE+P +IP+ VAIPK +       + K  T   
Sbjct: 193 DEIDLNDPNSTIIIQPGSETMKIGFALDETPLLIPNLVAIPKKDDSKGPSTESKLNT--- 249

Query: 300 RDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIEDKNDYNRINW 359
            +Q  EFE++K E+  +F+ERMR+YKR++QPN+HEQV +FN+ ++PE I D ND  RI W
Sbjct: 250 -EQSEEFEDLKNELHSTFKERMRYYKRRIQPNSHEQVKSFNRNAQPETILDNNDPARIRW 308

Query: 360 ITTPDRRYYGADALRCSKDHFVIRYPI---VKGGSFNIASPDYRSLQDLMGDFTGLLEHV 416
           IT  D+ YYG DAL C +  F  R P      G  FN+    Y S+Q+L+GD   L+E  
Sbjct: 309 ITQNDKVYYGNDALLCPESFFSHRKPFGTCRNGALFNLMGSSYSSVQELLGDVIKLIEFG 368

Query: 417 LRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYGA 476
           L      L+     +YK +LVIPDLFEKSHVE +IR L+TE+ F AVAI+QESLATCYGA
Sbjct: 369 LNK---LLEAKNKDKYKAILVIPDLFEKSHVEEMIRLLLTELPFNAVAIIQESLATCYGA 425

Query: 477 GISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFPYQDWD 536
           GISTSTCVVN+GA++T ++C+DEG VL++S I L+YG DDIT+LF++ L  + FPYQDW+
Sbjct: 426 GISTSTCVVNVGASETSVSCIDEGVVLENSLINLNYGGDDITRLFSVLLKMNNFPYQDWN 485

Query: 537 IETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQQAEKFDFKVFDEVILAPLSLF 596
           +E+  GW++AE LKK   T QDA+VTVQL NF+KR+  +  EK++FK FDEV+LAPL+LF
Sbjct: 486 VESIAGWNIAETLKKQIVTLQDADVTVQLSNFMKRVFNEPTEKYEFKTFDEVMLAPLALF 545

Query: 597 YPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLYCGNQDEF 656
            P I + LRNE    S+N  L+ +LP S+D+FT  L+DWRS++Q  C +N  YC   DE 
Sbjct: 546 APRIFSYLRNE---ESKNSTLQYQLPESKDLFTHELNDWRSMTQEACKNNGSYCDISDEL 602

Query: 657 QMLCKLLDAPSRLDELQAENRLEPDIRQNYAPLEKAIVQSITNACLSFDVSKMSSFYSNI 716
           Q+L  LL+  S+L+  Q+E     D ++N  PL+KAI+QSIT+ACLS D SKM SFYSNI
Sbjct: 603 QLLTALLEVDSKLEAFQSEATTTLDNKRNMLPLDKAIIQSITDACLSLDPSKMDSFYSNI 662

Query: 717 LVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIK------------ 764
           LV GG SN+PAFDF+LTDRINIWRPR+LS +SFP  YK LSK+IKD++            
Sbjct: 663 LVVGGSSNIPAFDFMLTDRINIWRPRLLSLSSFPQFYKNLSKEIKDLEMESQSTAKLQAQ 722

Query: 765 ----------------NSVKNGEGKSNGPQEDEQLKEKVQEVIKKELERYHELIESQNNA 808
                           N+  +GE  ++  +  ++L   + ++IK +L+ Y   +ESQN+ 
Sbjct: 723 TGSVVPTTGSSTPLATNAGNDGETMADLNEVSKKLSSNINDLIKTKLQDYISNVESQNSN 782

Query: 809 DHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868
           +H  PV V+PPPRD+  AIL WKGASVLAQIKLVEEL++T  DWD+HGSRILQ+KCIFTY
Sbjct: 783 EHYFPVGVVPPPRDMSAAILSWKGASVLAQIKLVEELFITNLDWDMHGSRILQHKCIFTY 842

>SAKL0G03608g Chr7 complement(299907..302291) [2385 bp, 794 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 794

 Score =  786 bits (2029), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/755 (53%), Positives = 541/755 (71%), Gaps = 36/755 (4%)

Query: 127 PPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQPMILINQKNYS 186
           PPGKKVP+HLLEKRRLGRIKAAEEFA+KLK IGIEK + + L  TGLF+P++LINQKNYS
Sbjct: 63  PPGKKVPMHLLEKRRLGRIKAAEEFAKKLKTIGIEKRDNSALQQTGLFKPLLLINQKNYS 122

Query: 187 SDYLKKDEQVFALRDRKVLRNNTQVP--------SMAN-TPDVADLKRENGNTTELNEAA 237
           SDYLKKD+Q+FA+R+RK LRN             +++N TP+V   + +     + ++A 
Sbjct: 123 SDYLKKDDQIFAMRERKSLRNPNSGNGNGNTGNNAVSNATPEVIPEEED---NDDNDDAE 179

Query: 238 GDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQIPMDQKNQTC 297
           G +D++      T+VIHPGS  LK+GFA D  P  +PSC+AIP++   N +   Q  +  
Sbjct: 180 GTDDLN------TIVIHPGSKFLKIGFATDVLPQSVPSCIAIPRAT-KNSVRSPQIRE-- 230

Query: 298 YTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIEDKNDYNRI 357
                P+EF+ +K+ +Q  F+ERMR+YKRKV PNAH+ VINFN   +PELI + ND +R+
Sbjct: 231 -----PSEFDGLKSAIQQDFKERMRYYKRKVIPNAHDAVINFNSKVEPELIHEHNDLHRV 285

Query: 358 NWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDFTGLLEHVL 417
            WI     ++YG +A RC   HF +RYP  +G SFN+ SP Y S Q+L+GD   LLE+ L
Sbjct: 286 EWIQNGSNQFYGEEATRCLPSHFTLRYPFARG-SFNVESPYYMSFQELLGDVQSLLEYCL 344

Query: 418 RSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAG 477
           +  +  + + QFA YK+VLVIPDL++K++VET I  L+ +M FQAVAI+QESLAT YGAG
Sbjct: 345 KQEKIDVTKQQFANYKIVLVIPDLYDKNYVETFIHLLLVQMGFQAVAIIQESLATTYGAG 404

Query: 478 ISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFPYQDWDI 537
           IS STCVV+IGAT T+IACVDEGTVL +S +TLDYG DDIT+LF+ FLLQS+FPY DWD+
Sbjct: 405 ISNSTCVVDIGATSTKIACVDEGTVLGNSAVTLDYGGDDITRLFSQFLLQSKFPYDDWDL 464

Query: 538 ETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQ-QAEKFDFKVFDEVILAPLSLF 596
            T HGW LAE LKK +TTFQDANV VQLYNFIKR PG+  A+K++FKVFDEV+LAP+++F
Sbjct: 465 STPHGWMLAESLKKEFTTFQDANVAVQLYNFIKRTPGEANAQKYEFKVFDEVMLAPMAMF 524

Query: 597 YPGIVAQLRNELKPRSQNEK-LESELPISRDIFTDNLDDWRSLSQTECLDNQLYCGNQDE 655
           +P I++ L  +   ++Q E  + ++ P S+DI+T   ++ RS+SQ EC +N+ YC    +
Sbjct: 525 FPKILSLLNPQ---KTQQEHYVTNQFPRSKDIYTLRDNNPRSISQRECHENKTYCDMTRD 581

Query: 656 FQMLCKLLDAPSRLDELQAENRLEPDIRQNYAPLEKAIVQSITNACLSFD--VSKMSSFY 713
             +L K+L+ P  +DE    N  +     N  PLEKAIV+SITNA +S D  +S++ +FY
Sbjct: 582 LDILQKILNLPDEIDEYSNSNLSKKHHHDNITPLEKAIVESITNASISLDNNMSRLGNFY 641

Query: 714 SNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVKNGEGK 773
           SN+LV GGGS  P+ DFILTDRINIWRPR+LS  +    YKK+++QIKD +   +N   +
Sbjct: 642 SNLLVVGGGSKFPSLDFILTDRINIWRPRLLSVNTISTFYKKVTQQIKDFEQ--ENKVSE 699

Query: 774 SNGPQEDEQLKEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPAILIWKGA 833
              P++   LK+K+ +++K EL+ Y E +++    ++  P++VLPPPRD+DPA+L WKG 
Sbjct: 700 VTDPEQLATLKKKLLKMVKLELQSYWESVDALGGNENVFPINVLPPPRDMDPAVLTWKGG 759

Query: 834 SVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868
           SVLA+IKLVEELY+T  DWD+ GSRILQYKCIF Y
Sbjct: 760 SVLARIKLVEELYITAKDWDVLGSRILQYKCIFDY 794

>KNAG0B04020 Chr2 (770325..773129) [2805 bp, 934 aa] {ON} Anc_5.477
           YOR141C
          Length = 934

 Score =  772 bits (1994), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/805 (49%), Positives = 541/805 (67%), Gaps = 75/805 (9%)

Query: 124 AKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQPMILINQK 183
           +K+  GKKVPLHLLEKRRLGRIKAAEEFA+KLK+IGIEKV++ TLP TG  +P+I+INQK
Sbjct: 145 SKSAAGKKVPLHLLEKRRLGRIKAAEEFAKKLKQIGIEKVDSTTLPSTGGLKPLIVINQK 204

Query: 184 NYSSDYLKKDEQVFALRDRKVLRN----------------NTQVPSMANTPDVADLKREN 227
           NYSSDY++KD+Q+FALR+RK LR+                   V S ++TP+VA     N
Sbjct: 205 NYSSDYIRKDDQIFALRERKFLRSAGTSNTTTTTTNNGSNTNGVGSASHTPEVATSTIPN 264

Query: 228 GNTTELNEAAGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQ 287
             T +       +DID +DA TT+VI PGS S+K+GFA DE+P VIP+CVA+P S    +
Sbjct: 265 EFTLK------SDDIDFTDATTTIVIQPGSESIKIGFATDETPLVIPNCVAVPHS---GE 315

Query: 288 IPMDQKNQTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPEL 347
            P+   N    TRDQP +F + K E+Q SF+ERMR YKR+VQ ++++QV  FN+ +KPE+
Sbjct: 316 TPIG--NAANLTRDQPDQFLQFKEELQTSFKERMRHYKRRVQLSSYDQVNTFNETTKPEI 373

Query: 348 IEDKNDYNRINWITTPDRR-----YYGADALRCSKDHFVIRYPIVKGGS-----FNIASP 397
           IED+ND  +I W   PD +     Y G +AL C ++H++ R P   G S     FN+   
Sbjct: 374 IEDQNDPAKIAWRGQPDPQEGKTIYVGDEALLCLREHYMHRRPF--GCSEGKYLFNLDEK 431

Query: 398 DYRSLQDLMGDFTGLLEHVLRSPRFQLKRSQFAQ----YKVVLVIPDLFEKSHVETLIRC 453
            Y SL  L+ D + LLEH +   +   KR +  +    YK VLVIPDLFEKSHVET+IR 
Sbjct: 432 RYTSLAALLCDVSRLLEHAID--KLLKKRDKDTEKDIKYKAVLVIPDLFEKSHVETMIRL 489

Query: 454 LITEMQFQAVAIMQESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYG 513
           L++E+ F AVAI+QESLATCYG+GISTSTCVVN+GAT T++ACVDEG V+++S I L+YG
Sbjct: 490 LLSELPFNAVAIVQESLATCYGSGISTSTCVVNVGATGTKVACVDEGIVVENSIINLNYG 549

Query: 514 SDDITKLFALFLLQSEFPYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIP 573
            DDI+KLFA+ LL S FPYQ+WDI++  G  +AE LKK   TFQDA++T QL+NFIKR+P
Sbjct: 550 GDDISKLFAVLLLMSNFPYQEWDIDSIPGRMIAEHLKKECLTFQDADITTQLFNFIKRVP 609

Query: 574 GQQAEKFDFKVFDEVILAPLSLFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLD 633
           G   EK +FK FDEVILAPL+LFYP I + L+        N KL+ +LP SRD+FT+  +
Sbjct: 610 GLPTEKIEFKTFDEVILAPLALFYPKIFSLLKPNKGKNLTNPKLKYQLPDSRDLFTNKAN 669

Query: 634 DWRSLSQTECLDNQLYCGNQDEFQMLCKLLDAPSRLDELQAENRLEPDIRQ-NYAPLEKA 692
           +W+SLS+ +C  N LY     E  +L  LL   SR +    ++ +  +  + N   L+K+
Sbjct: 670 NWKSLSEMDCATNTLYSDMVQESVLLDNLLGINSRREGPPKDSGVGSETTELNLTALDKS 729

Query: 693 IVQSITNACLSFDVSKMSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDL 752
           ++QSITNA LS +  KM+SFYSNIL+ GG SN+P FD IL DRIN+WRP++++  SFP+ 
Sbjct: 730 VIQSITNATLSLEPGKMASFYSNILIVGGSSNIPGFDTILKDRINMWRPKLIALASFPNF 789

Query: 753 YKKLSKQIKDIKNSVKNGEGK-----------------SNGPQE------------DEQL 783
           Y +L K+IKD++ S K                       + P+E            + +L
Sbjct: 790 YNELVKEIKDLETSAKTSSAAIVTGGTATATPAPVLNDDDAPKEVPEVKETSSDAKEYEL 849

Query: 784 KEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVE 843
            EK+Q++I++ LE+Y   IE QN  +H +PVSV P P +++P++L W+GA VLAQIKL+E
Sbjct: 850 NEKIQKLIEERLEKYLSAIERQNGNEHFMPVSVTPAPHNMNPSLLPWRGAGVLAQIKLIE 909

Query: 844 ELYLTGADWDIHGSRILQYKCIFTY 868
           EL++T  DWD+HGSR+LQ+KCIFTY
Sbjct: 910 ELFVTNIDWDVHGSRVLQHKCIFTY 934

>Kwal_55.21250 s55 (749673..752000) [2328 bp, 775 aa] {ON} YOR141C
           (ARP8) - actin-related protein [contig 130] FULL
          Length = 775

 Score =  761 bits (1965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/766 (51%), Positives = 522/766 (68%), Gaps = 44/766 (5%)

Query: 111 SQGKFKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPP 170
           S     K  K DP +     KVP HLLEKRRLGR KAAE++A+K+K IGIEK +   L  
Sbjct: 46  SHSNASKVKKPDP-QVKQNTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQ 104

Query: 171 TGLFQPMILINQKNYSSDYLKKDEQVFALRDRKVLRNNTQVPSMANTPDVADLKRENGNT 230
            GLF+P+ LINQKNYSSDYLK+D+Q+FA+R+RK LRN T   S  + PD  D +  +G++
Sbjct: 105 LGLFKPLSLINQKNYSSDYLKRDDQIFAMRERKSLRNATASQSTPDMPDDDDQESVDGDS 164

Query: 231 TELNEAAGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQIPM 290
            ELN               T+VIHPGS SLK+GFA D  P  IPSCVA+PK     Q   
Sbjct: 165 -ELN---------------TIVIHPGSKSLKIGFATDVLPQSIPSCVAVPKRSQSLQGET 208

Query: 291 DQKNQTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIED 350
            Q + T        E++E K  +Q  F+ERMR+YKRK+ PN+H+ V+NFN    PE+I +
Sbjct: 209 KQPHDT-------EEYQETKDSIQQDFKERMRYYKRKIIPNSHDIVVNFNSRVSPEIIPE 261

Query: 351 KNDYNRINWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDFT 410
            ND +RI+WI  P R YYG +A RC   HF +R+P  KG  FNI SPDY SLQ+L+ D  
Sbjct: 262 HNDLHRIDWIDQPSRPYYGKEATRCLPSHFTVRHPFWKG-RFNIESPDYSSLQELLNDVC 320

Query: 411 GLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESL 470
            LL+  L  P+  +K SQ + YKVV+V+PDL++K++VET IR L+ ++ FQAVAI+QESL
Sbjct: 321 ELLKFALSQPKIDVKPSQISNYKVVIVVPDLYDKAYVETFIRLLLVDLNFQAVAIIQESL 380

Query: 471 ATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEF 530
           A+CYGAGI  STCVV+IGAT T+IACVDEG V ++S I LDYG DDIT+LFA FLL+S F
Sbjct: 381 ASCYGAGIGESTCVVDIGATTTKIACVDEGLVNENSIINLDYGGDDITRLFARFLLESNF 440

Query: 531 PYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQ-QAEKFDFKVFDEVI 589
           PYQD D+++  GW L E+LK+ YTTFQDA+VT+QLYNFIKRIPG+  AEKF+FKVFDEV+
Sbjct: 441 PYQDLDLDSPQGWSLVEQLKEKYTTFQDADVTIQLYNFIKRIPGKPGAEKFEFKVFDEVM 500

Query: 590 LAPLSLFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLY 649
            AP+ LF+P +   L+ +  P   NE ++S+LP S+D+FT   ++ +S+SQ  C     Y
Sbjct: 501 TAPMGLFFPHVFPLLKEQNNP--TNEYVKSQLPRSKDMFTCKDNNLKSVSQLACQKKNTY 558

Query: 650 CGNQDEFQMLCKLLDAPSRLDELQ--AENRLEPDIRQNYAPLEKAIVQSITNACLSFD-- 705
           C    +  +L KLL+ PS ++E Q  A   +EP     Y  LEKAI++SITNAC+S D  
Sbjct: 559 CDMGRDLDILQKLLNLPSEIEEYQSAASANVEP----AYTALEKAIIESITNACVSLDNN 614

Query: 706 VSKMSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKN 765
            +K + FYSNILV GG S  P+ DFILTDRINIWRPR+LS  + P  + ++SKQ+K+ + 
Sbjct: 615 HAKAAQFYSNILVVGGSSKFPSLDFILTDRINIWRPRLLSVNTLPTFHNQVSKQVKEFEQ 674

Query: 766 SVKNGEGKSNGPQEDEQL---KEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRD 822
           + K  E K     E+E+L   K+K+ + IK EL+ Y E +++    +   P++VLP PR+
Sbjct: 675 TNKLSEIK-----EEEELLSQKKKLAKTIKMELQSYWEGVDALGGNESVFPINVLPAPRE 729

Query: 823 LDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868
           +DPA+L WKG SV A++KL+EELY++  DWD+  SRILQYKCIF Y
Sbjct: 730 MDPALLTWKGGSVFARLKLIEELYVSANDWDVLNSRILQYKCIFDY 775

>KLTH0F14960g Chr6 (1222278..1224605) [2328 bp, 775 aa] {ON} similar
           to uniprot|Q12386 Saccharomyces cerevisiae YOR141C ARP8
           Nuclear actin-related protein involved in chromatin
           remodeling component of chromatin- remodeling enzyme
           complexes
          Length = 775

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/758 (51%), Positives = 509/758 (67%), Gaps = 40/758 (5%)

Query: 117 KYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPPTGLFQP 176
           K  K DP  A    KVP HLLEKRRLGR KAAE++A+K+K IGIEK +   L   GLF+P
Sbjct: 52  KVKKPDP-HAKQQTKVPGHLLEKRRLGRQKAAEQYAQKMKTIGIEKRDNPLLHQLGLFKP 110

Query: 177 MILINQKNYSSDYLKKDEQVFALRDRKVLRNNTQVPSMANTPDVADLKRENGNTTELNEA 236
           + LINQKNYSSDYLK+D+Q+FA+R+RK LRN       AN          N  T ++ E 
Sbjct: 111 LSLINQKNYSSDYLKRDDQIFAMRERKSLRN-------ANA---------NQATPDMPED 154

Query: 237 AGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKS-ELHNQIPMDQKNQ 295
              E +D      T+VIHPGS +LK+G A +  P  IP CVA+PK     +  P  Q ++
Sbjct: 155 DDQESVDGESDAQTIVIHPGSRNLKIGLATEVLPQSIPCCVAVPKRPRTSDSTPEPQVDE 214

Query: 296 TCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIEDKNDYN 355
                    E+   K  +Q  F+ERMR+YKRKV PN+H+  +NFN    PE I + ND +
Sbjct: 215 E--------EYISAKESIQQDFKERMRYYKRKVIPNSHDIAVNFNARVTPEAIPEHNDLH 266

Query: 356 RINWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMGDFTGLLEH 415
           R++WI    + YYG DA RC   HF +R+P  KG  FNI SPDY SLQ+L+ D + LL+ 
Sbjct: 267 RVDWIQDASKCYYGKDATRCLPSHFTVRHPFWKG-RFNIESPDYGSLQELLVDVSELLKF 325

Query: 416 VLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYG 475
            L  P+  ++ SQ   YKVV+V+PD F+K++VET IR LIT+++FQAVA++QESLA+CYG
Sbjct: 326 ALSQPKIDVRPSQIPNYKVVIVVPDAFDKAYVETFIRLLITDLKFQAVAVIQESLASCYG 385

Query: 476 AGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFPYQDW 535
           AGI  STCVV+IGAT T+IACVDEG V+ +S ITLDYG DDITKLFA FLL+S FPYQD 
Sbjct: 386 AGIGDSTCVVDIGATTTKIACVDEGLVIDNSVITLDYGGDDITKLFAKFLLESNFPYQDL 445

Query: 536 DIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQ-QAEKFDFKVFDEVILAPLS 594
           D+ +  GW L E+LK+ Y TFQDA+VT+QLYNFIKRIP +  AEKF+FKVFDEV+ AP+ 
Sbjct: 446 DLNSPEGWSLMEQLKEKYATFQDADVTIQLYNFIKRIPNKPGAEKFEFKVFDEVMTAPMG 505

Query: 595 LFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECLDNQLYCGNQD 654
           LF+P I+  L+++  P   N+ + S+LP S+D+FT   ++ +S+SQ  C     YC    
Sbjct: 506 LFFPHILRLLKDKNVPV--NKYVTSQLPRSKDMFTCKDNNPKSVSQLACQKKTTYCDMHR 563

Query: 655 EFQMLCKLLDAPSRLDELQAEN--RLEPDIRQNYAPLEKAIVQSITNACLSFD--VSKMS 710
           +  +L KLL+ PS ++E Q+     LEP     Y PLEKAIV+SITNAC+S D   SK +
Sbjct: 564 DLDILQKLLNLPSEIEEYQSSTCANLEP----AYTPLEKAIVESITNACVSLDNNHSKAA 619

Query: 711 SFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVKNG 770
           +FYSNILV GG S   + DFILTDRINIWRPR+LS  + P    ++SKQ+K+ + + K  
Sbjct: 620 NFYSNILVVGGSSKFSSLDFILTDRINIWRPRLLSVNTLPTFQNQVSKQVKEFEQTQKLS 679

Query: 771 EGKSNGPQEDEQLKEKVQEVIKKELERYHELIESQNNADHTLPVSVLPPPRDLDPAILIW 830
           E K    +E    K+K+ + IK EL+ Y E +++    +   P +VLP PR++DPA+L W
Sbjct: 680 EIKDE--EELAAQKKKLAKTIKVELQSYWEGVDALGGNESVFPANVLPAPREMDPALLTW 737

Query: 831 KGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868
           KG SV A++KL+EELY++ +DWDI GSRILQYKCIF Y
Sbjct: 738 KGGSVFARLKLIEELYVSESDWDILGSRILQYKCIFDY 775

>AFR135W Chr6 (680340..682715) [2376 bp, 791 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR141C (ARP8)
          Length = 791

 Score =  725 bits (1871), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/778 (48%), Positives = 531/778 (68%), Gaps = 46/778 (5%)

Query: 111 SQGKFKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPP 170
           ++GK  K P+   A A  GKKVP HLLEKRRLGRIKAAEEFARKLKKIGIEK +   +  
Sbjct: 40  TEGKVSK-PETAGAAAGQGKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNLHISQ 98

Query: 171 TGLFQPMILINQKNYSSDYLKKDEQVFALRDRKVLRNNTQVPSMANTPDVADLKRENGNT 230
           TGLF+P+ LINQKNYSSDYL+KD+Q+F++R+RK LR+    P  ++ P    L     + 
Sbjct: 99  TGLFRPLPLINQKNYSSDYLRKDDQIFSMRERKSLRSGNVNPVNSSQPPTL-LAEAGEDD 157

Query: 231 TELNEAAGDED-IDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKSELHNQIP 289
            +LN   GDED ID ++   T+VIHPGS SLK+G + D  P  +PSCVA+ +       P
Sbjct: 158 LKLN---GDEDGIDDTEDANTIVIHPGSRSLKIGLSTDVFPLSVPSCVAVARRASQRLEP 214

Query: 290 MDQKNQTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKVSKPELIE 349
                Q  Y +D+  +F E   ++Q  F+ERMR+YKRK+ PN+HEQV+++N  ++PE I 
Sbjct: 215 -----QQRYDKDE--DFMEHLQQIQSDFKERMRYYKRKIIPNSHEQVLSYNSRAQPEKIP 267

Query: 350 DKNDYNRINWIT-TPDRR-YYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLMG 407
           + ND +RI WI   P+   YYG  A RC  ++FVIRYP    G+FN+  PDY SLQ+L+ 
Sbjct: 268 EHNDLHRIEWIKDAPEGTIYYGEGAERCLPENFVIRYPF-SNGAFNVECPDYSSLQELLN 326

Query: 408 DFTGLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQ 467
           D T L+   L   +  + RSQF  YKV+L+IPDLFEK++VE +IR L++EM FQAVA++Q
Sbjct: 327 DVTKLITFALSETKLGISRSQFPNYKVILIIPDLFEKNYVEQMIRLLLSEMNFQAVALIQ 386

Query: 468 ESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQ 527
           ESLATCYGAG+S STCV++IGA++T+I+CVDEG V+Q+SCI L YG DDIT+LF   LLQ
Sbjct: 387 ESLATCYGAGLSNSTCVIDIGASETKISCVDEGQVIQNSCIRLSYGGDDITRLFVELLLQ 446

Query: 528 SEFPYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKR---IPGQQAEKFDFKV 584
           S FPY DW++ T  GW LAE+LKK + TFQDA+V VQL+NF KR   +PG  AEKF+FK+
Sbjct: 447 SNFPYPDWNLNTRQGWILAEQLKKTHITFQDADVAVQLFNFFKREPSVPG--AEKFEFKL 504

Query: 585 FDEVILAPLSLFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSLSQTECL 644
           F+EV+++P++ FYP I++ L+      S N+ +  +LP SRD +T   D+ +S++Q    
Sbjct: 505 FNEVMISPMAYFYPQILSFLK---PATSYNKYMAQQLPESRDPYTYKPDNPKSIAQESAF 561

Query: 645 DNQLYCGNQDEFQMLCKLLDAPSRLDEL-------QAENRLEPDIRQ--NYAPLEKAIVQ 695
             ++Y     +  ++ KL+     ++ L        + + ++ + R+  NY PL+KAI++
Sbjct: 562 TGKVYTDINKDLDIIRKLVSVNDEVEALTSGPSERTSGDTIKTNTRRASNYTPLDKAIIE 621

Query: 696 SITNAC--LSFDVSKMSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLY 753
           S+T A   L  ++SK+ +FYSN+LV GG S VP  D ILTDRINIWRPR+LS ++ P +Y
Sbjct: 622 SVTTASVLLGDNMSKLVNFYSNLLVIGGSSKVPGLDLILTDRINIWRPRLLSVSTLPVVY 681

Query: 754 KKLSKQIKDIKNSVKNGEGKSNGPQEDEQL---KEKVQEVIKKELERYHELIESQNNADH 810
           KK+S+ +K ++N +K      N P+ +E++   ++K+ + IK ELE Y    ES +  +H
Sbjct: 682 KKVSEMVKQVENEIKK-----NNPESEEEIAQSRKKLIKSIKIELENYW---ESVDPYEH 733

Query: 811 TLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKCIFTY 868
             P++VLPPPR++DP++L WKG SV  +IKL EELY+T  DW++ GSRIL+YKCIF Y
Sbjct: 734 VYPIAVLPPPREMDPSMLTWKGGSVFGRIKLCEELYITAMDWEMLGSRILKYKCIFDY 791

>Ecym_2311 Chr2 (604942..607269) [2328 bp, 775 aa] {ON} similar to
           Ashbya gossypii AFR135W
          Length = 775

 Score =  721 bits (1862), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/784 (49%), Positives = 529/784 (67%), Gaps = 56/784 (7%)

Query: 111 SQGKFKKYPKLDPAKAPPGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVETNTLPP 170
           ++GK  K P+     +   KKVP HLLEKRRLGRIKAAEEFARKLKKIGIEK +   +  
Sbjct: 22  TEGKVTK-PETGGVASTQSKKVPQHLLEKRRLGRIKAAEEFARKLKKIGIEKQDNIHISQ 80

Query: 171 TGLFQPMILINQKNYSSDYLKKDEQVFALRDRKVLRNNTQVPSMANT-------PDVADL 223
           TGLF+   LINQKNYSSDYL+KD+Q+F++R+RK LR+   V S+ N+       PDV D 
Sbjct: 81  TGLFRVHSLINQKNYSSDYLRKDDQIFSMRERKNLRSGN-VNSITNSSQPLIALPDVQDD 139

Query: 224 K-RENGNTTELNEAAGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKS 282
           + + NG+   L++ A        D NT +VIHPGS SLK+G + D  P  IPSCVAI +S
Sbjct: 140 EVKTNGDEDGLDDTA--------DTNT-IVIHPGSRSLKIGLSTDVFPLSIPSCVAIARS 190

Query: 283 ELHNQIPMDQKNQTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKV 342
           E   ++P    +Q  Y  D+  EF     ++Q  F+ERMR+YKRK+ PN+HEQV+++N  
Sbjct: 191 E-QVEVP----SQPRYDNDE--EFMGNLQQIQSDFKERMRYYKRKIIPNSHEQVLSYNSK 243

Query: 343 SKPELIEDKNDYNRINWITTPD---RRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDY 399
            +PE I + ND +RI WI   D   + YYG  A RC  + F++RYP    GSFN+ SP+Y
Sbjct: 244 CQPEKIPEHNDLHRIEWIKKSDASTKVYYGEYAERCLPEGFLLRYPFA-NGSFNVKSPNY 302

Query: 400 RSLQDLMGDFTGLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQ 459
            SLQ+L+ D   L+   L   +  + +SQF+ Y VVL+IPDLFEKS+VE +IR LI+EM 
Sbjct: 303 NSLQELLNDVVNLITFALSETKLNISKSQFSSYNVVLIIPDLFEKSYVEQMIRLLISEMD 362

Query: 460 FQAVAIMQESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITK 519
           FQAVA++QESLA+CYGAG+S STCV++IG ++T+I+CVDEG V+Q+SCI L YG DDITK
Sbjct: 363 FQAVALIQESLASCYGAGLSNSTCVIDIGGSETKISCVDEGQVIQNSCIKLSYGGDDITK 422

Query: 520 LFALFLLQSEFPYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPG-QQAE 578
           LFA  LLQS FPY+DW++ T  GW LAE+LKKN+ TFQDA+V VQL+NF KR P    AE
Sbjct: 423 LFAELLLQSNFPYEDWNLNTRQGWLLAEQLKKNHITFQDADVAVQLFNFFKRNPNISGAE 482

Query: 579 KFDFKVFDEVILAPLSLFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSL 638
           K++FK+F+EV+++P++ FYP I+A L+    P   N+ ++ +LP SRD +T   DD +S+
Sbjct: 483 KYEFKLFNEVMVSPMAYFYPQILALLK---PPVEVNKYVQQQLPPSRDPYTCKPDDPQSV 539

Query: 639 SQTECLDNQLYCGNQDEFQMLCKLLDAPSRLDELQA------------ENRLEPDIRQNY 686
           S    L  + Y     +  ++ KL+    +++ L A            EN  E     NY
Sbjct: 540 SNLGSLSGKWYTEMSKDLDIVRKLISITDKVEALSANSSDGTASDTIVENTEE---VSNY 596

Query: 687 APLEKAIVQSITNAC--LSFDVSKMSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRIL 744
            PL+KAI++S+TNA   L  ++SK+++FYSN+L+ GG S VP  D ILTDRINIWRPR+L
Sbjct: 597 MPLDKAIIESVTNAAVLLGDNMSKLTNFYSNLLIVGGSSKVPGLDLILTDRINIWRPRLL 656

Query: 745 SHTSFPDLYKKLSKQIKDIKNSVKNGEGKSNGPQEDEQLKEKVQEVIKKELERYHELIES 804
           S ++ P +YKK+S  +K +++ +K    +S   +E +Q ++K+ + IK ELE Y    ES
Sbjct: 657 SVSTLPVIYKKISDMVKQVESEIKKNNVESE--EEIQQSRKKLIKSIKIELENYW---ES 711

Query: 805 QNNADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
            +  +H  P++VLPPPR++DP++L WKG SV  +IKL EELY+T  DW++ GSRIL+YKC
Sbjct: 712 VDPYEHVYPITVLPPPREMDPSMLTWKGGSVFGRIKLCEELYITEMDWEMLGSRILKYKC 771

Query: 865 IFTY 868
           IF Y
Sbjct: 772 IFDY 775

>KLLA0E03213g Chr5 complement(299014..301380) [2367 bp, 788 aa] {ON}
           similar to uniprot|Q12386 Saccharomyces cerevisiae
           YOR141C ARP8 Nuclear actin-related protein involved in
           chromatin remodeling component of chromatin-remodeling
           enzyme complexes
          Length = 788

 Score =  624 bits (1610), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 337/791 (42%), Positives = 504/791 (63%), Gaps = 57/791 (7%)

Query: 117 KYPKLDPAKAP------------PGKKVPLHLLEKRRLGRIKAAEEFARKLKKIGIEKVE 164
           K P  +P+K P            P KKVP HLLEKRRLGRIKAAEEFA+KLK IGIE+ E
Sbjct: 13  KEPSKEPSKEPLLGSDGKISKDIPSKKVPQHLLEKRRLGRIKAAEEFAKKLKIIGIERQE 72

Query: 165 TNTLPPTGLFQPMILINQKNYSSDYLKKDEQVFALRDRKVLRNNTQVPSMANTP--DVAD 222
              +      +P+ +INQKNYSS+YLK D+Q+F +R+RK LR   Q    ++ P   +  
Sbjct: 73  NEHIAQPITLKPVSVINQKNYSSNYLKNDDQIFYMRERKHLRQQGQTGGSSSAPAAGIGT 132

Query: 223 LKRENGNTTELNEAAGDEDIDLSDANTTLVIHPGSNSLKVGFAKDESPFVIPSCVAIPKS 282
              ++ N  + N A  D+++D      +++IHPGS+ +K+G   D  P  +P+ VA+P  
Sbjct: 133 PALDDDNMADSN-AIEDDELD------SIIIHPGSSFIKIGPNYDIFPQQVPNLVAVPTH 185

Query: 283 ELHNQIPMDQKNQTCYTRDQPTEFEEIKAEMQHSFRERMRFYKRKVQPNAHEQVINFNKV 342
                +P  Q++ +         F+++K ++Q  F+ERMR+YKR++ PN+ EQ   FN  
Sbjct: 186 --GGTVPSPQEDIS-----NNEIFQQLKDDIQFDFKERMRYYKRRIMPNSTEQAAAFNAK 238

Query: 343 SKPELIEDKNDYNRINWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSL 402
           S PEL+ D ND+ RI WI    + YYG DA +C    F +R P +  GSFN+  P+Y S 
Sbjct: 239 SDPELVPDLNDFGRIEWIKDRSKSYYGHDATQCLPSDFKLRSPFL-NGSFNLNEPNYNSF 297

Query: 403 QDLMGDFTGLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQA 462
           Q+++ D   L+   L   +  ++R+QF+ Y+VVL++PDLF+K+ VE++I  L+ E+ FQ+
Sbjct: 298 QEILFDVEQLIVQSLAMEKIGIERNQFSNYRVVLIVPDLFDKTFVESMIHLLLIELDFQS 357

Query: 463 VAIMQESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFA 522
           +A++QESLA+CYGAG+S STCV++IGA QT+IACVD+G V+++S + L+YG DDIT+LFA
Sbjct: 358 IALIQESLASCYGAGLSNSTCVIDIGAKQTKIACVDDGVVVKNSALRLNYGGDDITRLFA 417

Query: 523 LFLLQSEFPYQDWDIETAHGWHLAEELKKNYTTFQDANVTVQLYNFIKRIPGQ----QAE 578
             LLQ++FPY DW+I   +GW LAE LKK   TFQDA++ +QLY+FIKR P      Q+ 
Sbjct: 418 HMLLQNKFPYADWNINEPNGWTLAETLKKQCITFQDADIAIQLYSFIKRDPYARKYTQSH 477

Query: 579 KFDFKVFDEVILAPLSLFYPGIVAQLRNELKPRSQNEKLESELPISRDIFTDNLDDWRSL 638
           K+++K+FDEV+ AP+ +F+P I   ++   K    NE +  + P S+DI+T   +D +SL
Sbjct: 478 KYEYKLFDEVMCAPMGIFFPDIFEVIKP--KQHKPNEYVIRQCPRSKDIYTLKPNDTKSL 535

Query: 639 SQTECLD--NQLYCGNQDEFQMLCKLL-------------DAPSRLDELQAENRLEP-DI 682
           +Q  C+    + Y     +  ++ KLL             ++    +E Q  + +E  ++
Sbjct: 536 TQMLCIQEPTKWYSNLSRDIDIVQKLLNLDTDDLDEQNDDESAGSKEETQINDEIEDINL 595

Query: 683 RQN---YAPLEKAIVQSITNAC--LSFDVSKMSSFYSNILVCGGGSNVPAFDFILTDRIN 737
           RQ      PLEKAI++SITNA   L  ++SK++  YSNIL+ GG S +PA DFILTDRIN
Sbjct: 596 RQYNNLSMPLEKAIIESITNASMLLGDNMSKLNVLYSNILIVGGSSKIPALDFILTDRIN 655

Query: 738 IWRPRILSHTSFPDLYKKLSKQIKDIKNSVKNGEGKSNGPQEDEQLKEKVQEVIKKELER 797
           IWRP++LS ++   L +K+ + IK  +   K  + +   PQ     K+K+ ++IK E+E 
Sbjct: 656 IWRPKLLSISALSTLMEKIGEVIKSYETDNK-LDLEPTDPQAAIAYKKKLSKLIKAEIEA 714

Query: 798 YHELIESQNNADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGS 857
           Y + +++ ++ D  LP+++LPPP D+DP++L WKG SV ++IKL+EEL +T  DW++ G+
Sbjct: 715 YWDSLQTLHSDDDLLPINILPPPHDMDPSMLTWKGGSVFSKIKLLEELNITKQDWNMLGN 774

Query: 858 RILQYKCIFTY 868
           RILQYKCIF Y
Sbjct: 775 RILQYKCIFEY 785

>Ecym_2306 Chr2 complement(594433..595656) [1224 bp, 407 aa] {ON}
           similar to Ashbya gossypii ABR084W
          Length = 407

 Score = 39.3 bits (90), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 27/99 (27%), Positives = 43/99 (43%)

Query: 427 SQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGISTSTCVVN 486
           +Q +   + L+    + +S  E L + +   M+     IM  SLAT Y  G   +  V++
Sbjct: 41  AQVSNIPMFLITHYSWSQSEQEILTQFVFESMKLNNFMIMPNSLATSYAFGSLQNCVVID 100

Query: 487 IGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFL 525
           IG   T I  + + T L+    +   G D I    A FL
Sbjct: 101 IGGAHTDIIPIVDYTPLEYLAYSAPVGGDAINAKLASFL 139

>TBLA0B01070 Chr2 (236811..237962) [1152 bp, 383 aa] {ON} Anc_2.117
           YHR129C
          Length = 383

 Score = 38.9 bits (89), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 45/105 (42%), Gaps = 1/105 (0%)

Query: 424 LKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGISTSTC 483
           LK S   ++ +V+    L  K + E +   L       A+ I   ++ + Y +G  T+ C
Sbjct: 100 LKVSNLGEHPLVVTEAPLNPKPNREKMCETLFESFNIPALYIANPAVLSLYASG-RTTGC 158

Query: 484 VVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQS 528
           VV  G        + EG  L  S   +D G  DITK   L L +S
Sbjct: 159 VVEAGDGYCSSVPIYEGFALTPSIRRIDIGGRDITKHLQLQLRKS 203

>Ecym_5237 Chr5 complement(489181..490356) [1176 bp, 391 aa] {ON}
           similar to Ashbya gossypii ADR316W
          Length = 391

 Score = 38.1 bits (87), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 51/119 (42%), Gaps = 2/119 (1%)

Query: 423 QLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGISTST 482
           Q+K    A +KV+L  P +    + E +   +  +  F  V +  +++   Y  G+S S 
Sbjct: 95  QMKIPSTAGHKVLLTEPPMNPLKNREQMCEVMFEKYDFGGVYVAIQAVLALYAQGLS-SG 153

Query: 483 CVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFPY-QDWDIETA 540
            VV+ G   T I  V E  VL      LD    D+T+     L +  + + +  D ET 
Sbjct: 154 VVVDSGDGVTHIVPVYESVVLNHLTRRLDVAGRDVTRYLIDLLSRRGYAFNKTADFETV 212

>KNAG0H03650 Chr8 complement(678598..679761) [1164 bp, 387 aa] {ON}
           Anc_2.117 YHR129C
          Length = 387

 Score = 37.4 bits (85), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 30/123 (24%), Positives = 53/123 (43%), Gaps = 4/123 (3%)

Query: 408 DFTGLLEHVLRSPRFQLKR--SQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAI 465
           D   L  H+  S + QL +  SQ   + +++    L    + ET+   L     F A+ +
Sbjct: 87  DMELLWSHIFYS-KLQLGQGNSQIGDHPLLITEAPLNSTKNRETMCEILYETFNFDALYV 145

Query: 466 MQESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFL 525
              ++ + Y  G  T+ CV+  G   +    V +G  L  S   +D G  DIT+    ++
Sbjct: 146 AHPAVLSLYATG-QTTGCVLECGEGYSASTPVYQGFALPSSIRRIDIGGRDITQELQFYI 204

Query: 526 LQS 528
            +S
Sbjct: 205 RKS 207

>KAFR0L01080 Chr12 complement(202561..204441) [1881 bp, 626 aa] {ON}
           Anc_7.266 YER077C
          Length = 626

 Score = 37.7 bits (86), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 14/34 (41%), Positives = 24/34 (70%)

Query: 552 NYTTFQDANVTVQLYNFIKRIPGQQAEKFDFKVF 585
           N +T +   + ++L+NFI R  GQQ+ +FDFK++
Sbjct: 452 NSSTIETEKLLIELHNFIIRTEGQQSTQFDFKIY 485

>ZYRO0F01122g Chr6 complement(88017..89375,89479..89508) [1389 bp,
           462 aa] {ON} similar to uniprot|Q05123 Saccharomyces
           cerevisiae YMR033W ARP9 Actin-related protein involved
           in transcriptional regulation; subunit of the chromatin
           remodeling Snf/Swi complex
          Length = 462

 Score = 37.0 bits (84), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 21/99 (21%), Positives = 46/99 (46%)

Query: 427 SQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGISTSTCVVN 486
           ++ +   V +V    + +  +E++++ L   ++     ++  +L++ Y  G   + CV++
Sbjct: 104 AELSNIPVFIVTHHSWSQFQLESIVQFLFEALRVNGAMLLSTALSSTYAMGSLQNCCVID 163

Query: 487 IGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFL 525
           IG   T I  V +   L     T+ YG + I +  A  L
Sbjct: 164 IGTAHTDIIPVVDYAPLVPLTSTIPYGGNTINENLARIL 202

>Ecym_1520 Chr1 (1071497..1071506,1072543..1073663) [1131 bp, 376
           aa] {ON} similar to Ashbya gossypii ABR222W  1-intron
          Length = 376

 Score = 36.6 bits (83), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/55 (38%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 249 TTLVIHPGSNSLKVGFAKDESP-FVIPSCVAIPKSELHNQIPMDQKNQTCYTRDQ 302
             LVI  GS   K GFA D++P  V PS V  P+   H  I +    + CY  D+
Sbjct: 7   AALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPR---HQGIMVGMGQKDCYVGDE 58

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 322 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 375

>NDAI0A01300 Chr1 complement(280662..282359) [1698 bp, 565 aa] {ON}
           Anc_7.448 YPR034W
          Length = 565

 Score = 37.0 bits (84), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 44/86 (51%), Gaps = 4/86 (4%)

Query: 431 QYKVVLVIPDL---FEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGISTSTCVVNI 487
           +Y +V+ IP +    +   +E     +    +F    I+ E LA     G S S  V+++
Sbjct: 105 EYPLVITIPSMKKEIDGEVLEKYFSLVFERFKFPVFQIILEPLAITLSLGKS-SGLVIDM 163

Query: 488 GATQTRIACVDEGTVLQDSCITLDYG 513
           G++  R+  + +GTV++++ ++  YG
Sbjct: 164 GSSGCRVTPIIDGTVIKNAVLSSKYG 189

>Kpol_181.2 s181 complement(1914..3305) [1392 bp, 463 aa] {ON}
           complement(1914..3305) [1392 nt, 464 aa]
          Length = 463

 Score = 35.8 bits (81), Expect = 0.46,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 58/135 (42%), Gaps = 7/135 (5%)

Query: 384 YPIVKGGSFNIASPDYRSLQDLMGDFTGLL-EHVLRSPRFQLKRSQFAQYKVVLVIPDLF 442
           +PIV G   NI +     LQ L   +  +L E  L  P     R + +    +L+    +
Sbjct: 66  HPIVNGEIVNIDA----FLQFLKIVYVSILNEKSLSDPN-SFDR-ELSNIPFLLISHHSW 119

Query: 443 EKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGISTSTCVVNIGATQTRIACVDEGTV 502
            + H+E +   +   +Q  +   +  SLA+ Y      ++C+++IG T T I  V +   
Sbjct: 120 SQFHIEKITHFVFEALQLNSFITLPVSLASNYAMISLQNSCIIDIGETHTDIVPVIDYLQ 179

Query: 503 LQDSCITLDYGSDDI 517
           +     ++ YG   I
Sbjct: 180 MDHIASSIKYGGQTI 194

>NCAS0B07130 Chr2 complement(1354064..1355209) [1146 bp, 381 aa]
           {ON} Anc_2.117
          Length = 381

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 29/130 (22%), Positives = 52/130 (40%), Gaps = 4/130 (3%)

Query: 390 GSFNIASPDYRSLQDLMGDFTGLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVET 449
           G   +  P  R + +   D   L  H        LK + F ++ +++    L  + + + 
Sbjct: 69  GLLRLRHPMNRGIVENWDDMETLWSHTFNDI---LKINDFDEHPLLITEAPLNPEKNRDK 125

Query: 450 LIRCLITEMQFQAVAIMQESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCIT 509
           +      +  F AV I   S  + Y +G  T+ CV++ G        + EG  L  S   
Sbjct: 126 MCEVFFEKFDFAAVYIANPSTLSLYASG-RTTGCVLDCGDGYCSSVPIYEGFALPSSIRR 184

Query: 510 LDYGSDDITK 519
           +D G  D+T+
Sbjct: 185 IDVGGRDVTE 194

>NCAS0A14720 Chr1 (2903450..2904907) [1458 bp, 485 aa] {ON}
           Anc_7.448 YPR034W
          Length = 485

 Score = 35.8 bits (81), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 26/90 (28%), Positives = 45/90 (50%), Gaps = 8/90 (8%)

Query: 431 QYKVVLVIPDLFEKSHVETLIRCLITEMQFQ-----AVAIMQESLATCYGAGISTSTCVV 485
           +Y +V+ IP       V+ +I     E+ F+      + I+ E LA     G S+S  VV
Sbjct: 105 EYPLVITIPS--ANKDVDEIILKKYFELAFETFNVPVLQIIIEPLAVALSLGKSSS-LVV 161

Query: 486 NIGATQTRIACVDEGTVLQDSCITLDYGSD 515
           N+GA+   +  + +GTV++ + +   YG D
Sbjct: 162 NLGASGCNVTPIVDGTVIKHAVMKSKYGGD 191

>TDEL0C03120 Chr3 (558606..559922) [1317 bp, 438 aa] {ON} Anc_7.448
           YPR034W
          Length = 438

 Score = 35.0 bits (79), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 1/69 (1%)

Query: 447 VETLIRCLITEMQFQAVAIMQESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDS 506
           VE      + ++Q  A+ I+ E LA     G S S  V+++GA  T +  + +GTV++  
Sbjct: 113 VENYFDLALNKLQVPALQIVVEPLAVALAMGKS-SALVIDVGARGTTVTPIVDGTVVRSG 171

Query: 507 CITLDYGSD 515
            +   +G D
Sbjct: 172 VMKSRFGGD 180

>ZYRO0F02772g Chr6 complement(235322..236439,236524..236533) [1128
           bp, 375 aa] {ON} uniprot|Q2HWE7 Zygosaccharomyces rouxii
           ACT1 Actin
          Length = 375

 Score = 35.0 bits (79), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 321 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>NDAI0G03040 Chr7 complement(708715..709832,710590..710599) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 35.0 bits (79), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 321 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>Skud_6.31 Chr6 complement(56454..57536) [1083 bp, 360 aa] {ON}
           YFL039C (REAL)
          Length = 360

 Score = 35.0 bits (79), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 306 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 359

>SAKL0B11220g Chr2 (978268..978297,978363..979733) [1401 bp, 466 aa]
           {ON} similar to uniprot|Q05123 Saccharomyces cerevisiae
           YMR033W ARP9 Actin-related protein
          Length = 466

 Score = 35.0 bits (79), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 20/83 (24%), Positives = 42/83 (50%)

Query: 435 VLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGISTSTCVVNIGATQTRI 494
           +LV    + +SH+E + + +   ++  +  I+  +LAT Y  G   ++ V+++G  +T +
Sbjct: 111 LLVSHHSWTRSHIEQITQYVFELLEINSFMILPLALATTYAFGSLQNSLVIDVGLEKTDL 170

Query: 495 ACVDEGTVLQDSCITLDYGSDDI 517
             + + T +     TL  GS  I
Sbjct: 171 VPILDYTPIGFLSTTLRKGSTSI 193

>TDEL0C00470 Chr3 complement(72546..73663,73929..73938) [1128 bp,
           375 aa] {ON} 
          Length = 375

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 321 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>CAGL0K12694g Chr11 (1258451..1258460,1259340..1260457) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039c ACT1 actin
          Length = 375

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 321 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>Suva_6.18 Chr6 complement(26677..27794,28152..28161) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 321 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>Smik_6.39 Chr6 complement(68673..69790,70076..70085) [1128 bp, 375
           aa] {ON} YFL039C (REAL)
          Length = 375

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 321 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>YFL039C Chr6 complement(53260..54377,54687..54696) [1128 bp, 375
           aa] {ON}  ACT1Actin, structural protein involved in cell
           polarization, endocytosis, and other cytoskeletal
           functions
          Length = 375

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 321 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>KNAG0L00250 Chr12 complement(32595..33712,34194..34203) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 35.0 bits (79), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 321 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>KAFR0D00940 Chr4 complement(198280..199397,199945..199954) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 35.0 bits (79), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 321 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>Kpol_1058.15 s1058 complement(49082..50199,50349..50358) [1128 bp,
           375 aa] {ON} complement(49082..50199,50349..50358) [1128
           nt, 376 aa]
          Length = 375

 Score = 34.7 bits (78), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 321 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>TBLA0C00440 Chr3 complement(81591..82708,83412..83421) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 34.7 bits (78), Expect = 0.89,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 321 APSSMEVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>TPHA0D00250 Chr4 complement(34030..35147,35712..35721) [1128 bp,
           375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 34.7 bits (78), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 321 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>NCAS0C03700 Chr3 complement(745133..746250,746901..746910) [1128
           bp, 375 aa] {ON} Anc_8.23 YFL039C
          Length = 375

 Score = 34.7 bits (78), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 321 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>SAKL0B00968g Chr2 complement(89966..91083,91524..91533) [1128 bp,
           375 aa] {ON} highly similar to uniprot|P02579
           Saccharomyces cerevisiae YFL039C ACT1 Actin
          Length = 375

 Score = 34.7 bits (78), Expect = 0.96,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 321 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 374

>ABR222W Chr2 (818719..818728,819032..820152) [1131 bp, 376 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YFL039C
           (ACT1); 1-intron
          Length = 376

 Score = 34.7 bits (78), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 32/57 (56%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+ +KC
Sbjct: 322 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKC 375

>TBLA0H02800 Chr8 (655357..656811) [1455 bp, 484 aa] {ON} Anc_2.593
           YMR033W
          Length = 484

 Score = 34.3 bits (77), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/94 (21%), Positives = 40/94 (42%), Gaps = 6/94 (6%)

Query: 438 IPDLFEKSH------VETLIRCLITEMQFQAVAIMQESLATCYGAGISTSTCVVNIGATQ 491
           IP L   +H      +E++   +  +++   + ++  SL   Y      + C+++IG   
Sbjct: 108 IPLLLLNNHKWSQFQMESITNFVFEKLKLNGLMLLPISLGASYSMVSLQNCCIIDIGLNH 167

Query: 492 TRIACVDEGTVLQDSCITLDYGSDDITKLFALFL 525
           T I  + + T +     TL+YG   I  +    L
Sbjct: 168 TDIVPIVDYTTINHLSNTLNYGGSYINTILQKLL 201

>ABR084W Chr2 (540620..540649,540708..542072) [1395 bp, 464 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YMR033W
           (ARP9); 1-intron
          Length = 464

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 40/172 (23%), Positives = 62/172 (36%), Gaps = 21/172 (12%)

Query: 362 TPDRRYYGADALRCSKDHFVIRYPIVKG------GSFNIASPDYRS-LQDLMGDFTGLLE 414
            P R Y   +    S +   + YPIV G      G        Y+S L   + +     E
Sbjct: 37  VPTRVYRDEEGQLTSFESAEVVYPIVDGRIADLDGLLYFLKLIYKSILSHWIAEHPDTWE 96

Query: 415 -HVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIMQESLATC 473
            H    P   L    ++Q +  L+   +FE             EM+     ++  +L+  
Sbjct: 97  AHASNIPMLLLTHYSWSQREQELITQYVFE-------------EMRLNHFMVVPAALSIS 143

Query: 474 YGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFL 525
           Y  G   +  V++IGAT T I  + +   L     +   G DDI    A  L
Sbjct: 144 YAFGSIQNCLVIDIGATHTDIVPIVDYVPLDYMAYSAPIGGDDINAKLATLL 195

>TDEL0B06860 Chr2 (1214531..1214560,1214657..1216012) [1386 bp, 461
           aa] {ON} Anc_2.593 YMR033W
          Length = 461

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 24/82 (29%), Positives = 40/82 (48%), Gaps = 6/82 (7%)

Query: 438 IPDLFEKSHVETLIRC-LITEMQFQAVAI-----MQESLATCYGAGISTSTCVVNIGATQ 491
           IP L    H  + I+  +IT+  F+A+ I     +  SLA+ Y      + C+++IG T 
Sbjct: 108 IPLLMVAHHSWSQIQLEVITQFVFEALQINNALLLPASLASSYAMSSLQNCCIIDIGTTH 167

Query: 492 TRIACVDEGTVLQDSCITLDYG 513
           T I  + + T L+     + YG
Sbjct: 168 TDIIPIIDYTPLEALSSKIAYG 189

>CAGL0K05335g Chr11 (521914..523503) [1590 bp, 529 aa] {ON} similar
           to uniprot|Q12406 Saccharomyces cerevisiae YPR034w ARP7
           Actin-like protein
          Length = 529

 Score = 34.3 bits (77), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 20/86 (23%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 434 VVLVIPDL----FEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGISTSTCVVNIGA 489
           +V+ +P +     E   VE  +     +++   + I+ E L      G S+S  V+++GA
Sbjct: 118 LVITLPSMTNRELETKIVENYMELAFEKLKVPVLQIVVEPLGIMLSTGKSSS-LVIDVGA 176

Query: 490 TQTRIACVDEGTVLQDSCITLDYGSD 515
           T   +  + +GT+L++S +   +  D
Sbjct: 177 TGCTVTPIIDGTILRNSIVKSRFAGD 202

>TDEL0D01550 Chr4 complement(305973..307415) [1443 bp, 480 aa] {ON}
           Anc_1.287 YJL081C
          Length = 480

 Score = 34.3 bits (77), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 25/46 (54%), Gaps = 1/46 (2%)

Query: 245 SDANTTLVIHPGSNSLKVGFAKDESP-FVIPSCVAIPKSELHNQIP 289
            D  T +VI PGS S  +GF+  + P  ++PSC    K+E  +  P
Sbjct: 11  GDEITAVVIDPGSFSTNIGFSGTDCPQAILPSCYGEQKAETEDNAP 56

>KLLA0D05357g Chr4 (461726..461735,462516..463633) [1128 bp, 375 aa]
           {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+  KC
Sbjct: 321 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHLKC 374

>KLLA0E22925g Chr5 complement(2040279..2041421) [1143 bp, 380 aa]
           {ON} similar to uniprot|P38696 Saccharomyces cerevisiae
           YHR129C ARP1 Actin-related protein of the dynactin
           complex required for spindle orientation and nuclear
           migration putative ortholog of mammalian centractin
          Length = 380

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 32/147 (21%), Positives = 62/147 (42%), Gaps = 16/147 (10%)

Query: 382 IRYPIVKGGSFNIASPDYRSLQDLMGDFTGLLEHVLRSPRFQLKRSQFAQYKVVLVIPDL 441
           +R+P+  G        D+ +L+ L G       HV       L+ S    + V++    L
Sbjct: 72  LRHPLEHG-----VVTDWNALEQLWG-------HVFEK---GLQLSSLQDHPVLVTEAPL 116

Query: 442 FEKSHVETLIRCLITEMQFQAVAIMQESLATCYGAGISTSTCVVNIGATQTRIACVDEGT 501
             K + E +   L       AV +  +++ + Y +G  T+ CV++ G   +    V +G 
Sbjct: 117 NPKKNREQMCELLFETFSVPAVYVSIQAVLSLYASG-RTTGCVLDSGDGCSHAVPVYDGY 175

Query: 502 VLQDSCITLDYGSDDITKLFALFLLQS 528
            L  +   +D    DI++L  + + +S
Sbjct: 176 TLPSAIRRIDIAGRDISELLQVLIRKS 202

>Kwal_14.1109 s14 complement(199181..200263) [1083 bp, 360 aa] {ON}
           YFL039C (ACT1) - Actin [contig 244] FULL
          Length = 360

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+  KC
Sbjct: 306 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHLKC 359

>KLTH0G18832g Chr7 (1626178..1626187,1626854..1627971) [1128 bp, 375
           aa] {ON} highly similar to uniprot|P60010 Saccharomyces
           cerevisiae YFL039C ACT1 Actin structural protein
           involved in cell polarization endocytosis and other
           cytoskeletal functions
          Length = 375

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/57 (24%), Positives = 31/57 (54%), Gaps = 3/57 (5%)

Query: 808 ADHTLPVSVLPPPRDLDPAILIWKGASVLAQIKLVEELYLTGADWDIHGSRILQYKC 864
           A  ++ V ++ PP   +    +W G S+LA +   ++++++  ++D  G  I+  KC
Sbjct: 321 APSSMKVKIIAPP---ERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHLKC 374

>TDEL0B04810 Chr2 (849529..850650) [1122 bp, 373 aa] {ON} Anc_2.117
           YHR129C
          Length = 373

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 65/173 (37%), Gaps = 18/173 (10%)

Query: 347 LIEDKNDYNRINWITTPDRRYYGADALRCSKDHFVIRYPIVKGGSFNIASPDYRSLQDLM 406
           LI D N YN+I               L C  D FV        G   +  P  R +    
Sbjct: 38  LIGDAN-YNKIM-----------VGGLEC--DSFVGNKAQRLRGLLKLKHPMERGVVSDW 83

Query: 407 GDFTGLLEHVLRSPRFQLKRSQFAQYKVVLVIPDLFEKSHVETLIRCLITEMQFQAVAIM 466
            D   L  H+L      L+ +   ++ +++    L  +S+ E ++          A+ + 
Sbjct: 84  DDMELLWSHILFD---SLQLTSGMEHPLLITEAPLNPESNKEKMLEVFFETFNIPAICVS 140

Query: 467 QESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSCITLDYGSDDITK 519
              + + Y +G  T+ CVV+ G        V EG  L  S   ++ G  D+TK
Sbjct: 141 IPGVLSLYASG-RTTGCVVDCGEGYCSSVPVCEGYTLASSIKRINLGGIDVTK 192

>KLLA0B14839g Chr2 complement(1304089..1305354) [1266 bp, 421 aa]
           {ON} conserved hypothetical protein
          Length = 421

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 20/65 (30%), Positives = 32/65 (49%), Gaps = 2/65 (3%)

Query: 155 LKKIGIEKVETNTLPPTGLFQPMILINQKNYSSDYLKKDEQVFALRDRKVLRNNTQVPSM 214
           L   GI   E     P   FQ M   NQ+ Y+SDY++K   +    +  V+ N+T++ ++
Sbjct: 141 LDTKGISWAEYQEHSPYAGFQGMNFSNQETYASDYVRKHNPLILFDN--VVNNDTRLANI 198

Query: 215 ANTPD 219
            N  D
Sbjct: 199 KNFED 203

>Kpol_1043.17 s1043 complement(29682..31853) [2172 bp, 723 aa] {ON}
           complement(29682..31853) [2172 nt, 724 aa]
          Length = 723

 Score = 32.7 bits (73), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 3/49 (6%)

Query: 775 NGPQEDEQLKEKVQEVIKKELERYHELIESQNNADHTLPVSVL---PPP 820
           N P+  +QLK +   +I K+++R  EL+ S  NA+  L VS++   PPP
Sbjct: 403 NQPEPKQQLKLEKTAIILKQVKRVIELLASTLNANKYLLVSIIEDTPPP 451

>NCAS0H03060 Chr8 (588900..590318) [1419 bp, 472 aa] {ON} Anc_2.593
           YMR033W
          Length = 472

 Score = 32.3 bits (72), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 21/32 (65%)

Query: 705 DVSKMSSFYSNILVCGGGSNVPAFDFILTDRI 736
           D+SK+ + + NI++ GG S++  F   LT R+
Sbjct: 327 DISKLRTMWENIVIIGGTSSIQGFKEALTSRL 358

>Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa]
           {ON} YNL271C (BNI1) - contains formin homology domains;
           homologous to BNR1 (BNI1 related protein) [contig 118]
           FULL
          Length = 1968

 Score = 32.7 bits (73), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 93/231 (40%), Gaps = 43/231 (18%)

Query: 600 IVAQLRNELKPRSQN-------EKLESELPISRDIFTDNLDDWRSLS-QTECLDNQLYCG 651
           + A+L+N   PR  N       EK++ +L I  D  TD+ D   S     E ++ Q    
Sbjct: 550 LRARLKNAGLPRILNKMKRLNYEKVDEQLAIFEDSTTDDFDTLYSQGPNGELINMQDPVS 609

Query: 652 NQDEFQMLCKLLDAPSRL-----------DELQAENRLEPDIRQNYAPLEKAIVQSITNA 700
                  LCK  +A   L            EL   ++ +P  R     L  A+V +++ A
Sbjct: 610 MTQNLWDLCKGTEAEEHLMSLLQNLLISTGELGGTSKEDPAQRTKQLKLIDALVSNVSMA 669

Query: 701 CLSFDVSKMSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQI 760
            +       SSF S I           +D + TD   I R  IL +  +   Y+++  + 
Sbjct: 670 SVDL----QSSFNSAIQRL--------YDAMQTDE--IARRAILENRDWVKRYEEIKAER 715

Query: 761 KDIKNSVKNGEGKSNGPQEDEQLK------EKVQEVIKKELERYHELIESQ 805
            ++K  + N EG   G Q  E+LK      EK Q V     +  HEL ES+
Sbjct: 716 NNLKEKLSNAEGGLVG-QLQEELKQRDHILEKSQRVTA---QLQHELDESK 762

>TPHA0F01940 Chr6 (437533..439053) [1521 bp, 506 aa] {ON} Anc_2.129
           YNL137C
          Length = 506

 Score = 32.3 bits (72), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 41/156 (26%), Positives = 71/156 (45%), Gaps = 9/156 (5%)

Query: 658 MLCKLLDAPSRLDELQAENRLE--PDIRQNYAPLEKAIVQSITNACLSFDVSKMSSF--Y 713
           M    LD+ ++LD      ++E  P + Q YA LEK +  ++  A  +  + +   F  +
Sbjct: 68  MFQSKLDSVAQLDASLRGGKVEDTPYLLQTYAVLEKRLDFALFRAMFASSIRQARQFILH 127

Query: 714 SNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSF--PDLYKKLSKQIKDIKNSVKNGE 771
            N+ V G     P+F     D  N+ + ++L       PDL K L+   + I    K  E
Sbjct: 128 GNVHVNGVRVKHPSFILKPGDVFNVKQEKVLQALGAKKPDLKKALNVDKRQIILHNKFVE 187

Query: 772 -GKSNGPQEDEQLKEKVQEVIKKELER--YHELIES 804
             K N  Q  +Q  EK++++    +E+  Y  L+E+
Sbjct: 188 FAKKNPKQAWKQRIEKIKQLSNDSVEKKEYLTLVEN 223

>Kpol_520.11 s520 complement(26673..28139) [1467 bp, 488 aa] {ON}
           complement(26673..28139) [1467 nt, 489 aa]
          Length = 488

 Score = 32.3 bits (72), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 27/131 (20%), Positives = 58/131 (44%), Gaps = 17/131 (12%)

Query: 434 VVLVIPDLFEKSH------VETLIRCLITEMQFQAVAIMQESLATCYGAGISTSTCVVNI 487
           V++ IP    K+       +E   +    + +   + I+ ESL+   G G  TS  V++I
Sbjct: 102 VLITIPSSISKNEDIENKVIEQYCKIAFEKFKIPYLQIVNESLSISLGLGKKTS-LVIDI 160

Query: 488 GATQTRIACVDEGTVLQDSCITLDYGSDDITKLFALFLLQSEFPYQDWDIE-----TAHG 542
             + + +  + +G ++++  +   YG D     F  + +  +F   D D+E     +++ 
Sbjct: 161 SGSGSSVTPIVDGVIIKNGIVKSKYGGD-----FLDYQIIKKFSTIDEDLEEEMTNSSNI 215

Query: 543 WHLAEELKKNY 553
           W  +    KN+
Sbjct: 216 WVSSNSWIKNF 226

>Suva_15.326 Chr15 complement(565392..566546) [1155 bp, 384 aa] {ON}
           YHR129C (REAL)
          Length = 384

 Score = 32.0 bits (71), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 33/72 (45%), Gaps = 1/72 (1%)

Query: 448 ETLIRCLITEMQFQAVAIMQESLATCYGAGISTSTCVVNIGATQTRIACVDEGTVLQDSC 507
           E + + L       A+ +   ++ + Y +G  T+ CV++ G        + +G  L  S 
Sbjct: 125 EVMAQVLFETFNLPALYVSNPAVLSLYASG-RTTGCVIDCGEGYCSTVPIYDGFALPASM 183

Query: 508 ITLDYGSDDITK 519
           + +D G  DITK
Sbjct: 184 MRMDIGGRDITK 195

>NCAS0A09450 Chr1 (1877793..1879892) [2100 bp, 699 aa] {ON}
           Anc_1.273 YJL093C
          Length = 699

 Score = 32.0 bits (71), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 34/63 (53%)

Query: 720 GGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSVKNGEGKSNGPQE 779
           G  +++ A +F L+D   +  P   SH +F  L+KK+   IKDI +  K  +  SN  +E
Sbjct: 618 GKSTSMEAKNFWLSDDTPLKYPINQSHFAFISLFKKIEFLIKDIIDDEKTSKIISNTMKE 677

Query: 780 DEQ 782
           D+ 
Sbjct: 678 DDN 680

>KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa]
           {ON} some similarities with uniprot|P41832 Saccharomyces
           cerevisiae YNL271C BNI1 Formin nucleates the formation
           of linear actin filaments involved in cell processes
           such as budding and mitotic spindle orientation which
           require the formation of polarized actin cables
           functionally redundant with BNR1
          Length = 1976

 Score = 32.0 bits (71), Expect = 10.0,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 67/163 (41%), Gaps = 33/163 (20%)

Query: 659 LCKLLDAPSRL-----------DELQAENRLEPDIRQNYAPLEKAIVQSITNACLSFDVS 707
           LCK  DA   L            EL ++N+ +P  R     L  A+V +++ A     V 
Sbjct: 619 LCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKLIDALVSNVSMAS----VD 674

Query: 708 KMSSFYSNILVCGGGSNVPAFDFILTDRINIWRPRILSHTSFPDLYKKLSKQIKDIKNSV 767
             SSF S I           +D + TD I   R  IL +  +   Y+++     ++K  +
Sbjct: 675 MQSSFNSAIQRL--------YDAMQTDEI--ARRAILENRDWVKRYEEIKADRDNLKEKL 724

Query: 768 KNGEGKSNGPQEDE-----QLKEKVQEVIKKELERYHELIESQ 805
            N EG   G  +DE      + EK Q V     +  HEL ES+
Sbjct: 725 SNAEGGLVGQLQDEVRQRDHILEKSQRV---NAQLQHELDESK 764

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 91,734,374
Number of extensions: 4233893
Number of successful extensions: 16493
Number of sequences better than 10.0: 114
Number of HSP's gapped: 17003
Number of HSP's successfully gapped: 116
Length of query: 868
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 750
Effective length of database: 39,950,811
Effective search space: 29963108250
Effective search space used: 29963108250
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)