Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D11286g5.476ON71771726260.0
TDEL0A034005.476ON8101475441e-58
NCAS0H022805.476ON6571444455e-46
YOR140W (SFL1)5.476ON7661484414e-45
Suva_8.1915.476ON7581484362e-44
Smik_15.3195.476ON7621424353e-44
Skud_15.3035.476ON7481504301e-43
NDAI0C013805.476ON7671284282e-43
Ecym_23125.476ON7561384176e-42
SAKL0G03586g5.476ON8531344179e-42
AFR136C5.476ON6951334121e-41
KNAG0B040405.476ON8521644142e-41
CAGL0I07183g5.476ON7711324089e-41
Kwal_55.212545.476ON8531323973e-39
KLTH0F14982g5.476ON8281413921e-38
KLLA0E03191g5.476ON7701313732e-36
Kpol_1062.85.77ON4331432133e-17
TPHA0A052505.77ON6011512073e-16
SAKL0H02354g5.77ON3851381972e-15
NDAI0D034304.385ON5971311932e-14
TBLA0A107004.385ON5871381932e-14
Skud_7.2086.209ON836651932e-14
Kpol_1033.466.209ON717651923e-14
NCAS0E038705.77ON3931381874e-14
TBLA0A020006.209ON627651895e-14
YGR249W (MGA1)5.77ON4561381867e-14
Suva_7.5445.77ON4691381867e-14
KAFR0C022506.209ON613721878e-14
Smik_16.585.77ON4531381851e-13
KAFR0B044105.77ON4651411851e-13
CAGL0F08195g5.77ON3251371811e-13
KNAG0F020206.209ON771671852e-13
YGL073W (HSF1)6.209ON833651852e-13
TDEL0G010105.77ON3981351822e-13
Smik_7.2096.209ON837651852e-13
TPHA0C001504.385ON5101391813e-13
KAFR0B069904.385ON545671814e-13
TBLA0G02700singletonON445661804e-13
Suva_7.1976.209ON846651816e-13
TDEL0E051706.209ON546671796e-13
KLLA0A10219g4.385ON4751301779e-13
KLLA0A05368g5.77ON4121371761e-12
Kpol_265.24.385ON5491361771e-12
ZYRO0C11506g5.77ON334741741e-12
Skud_7.5825.77ON4521381761e-12
NCAS0A064504.385ON6091281771e-12
KLTH0H04290g6.209ON569791771e-12
SAKL0A04576g6.209ON557671771e-12
TPHA0H011305.77ON4391471752e-12
ZYRO0G08734g6.209ON572671752e-12
Kwal_56.240366.209ON567671752e-12
YHR206W (SKN7)4.385ON622641753e-12
Smik_8.2964.385ON625641743e-12
Skud_8.2734.385ON623641743e-12
CAGL0F09097g4.385ON630641734e-12
SAKL0B12408g4.385ON465641724e-12
NDAI0I011106.209ON905651745e-12
Suva_15.4124.385ON617641725e-12
TDEL0D003204.385ON547641716e-12
Ecym_22086.209ON529671716e-12
CAGL0H03443g6.209ON706651719e-12
AFL085C6.209ON569661709e-12
KLTH0D17182g4.385ON4641321691e-11
KLLA0D03322g6.209ON677671701e-11
TPHA0E028806.209ON718651701e-11
ZYRO0G00484g4.385ON647641672e-11
Ecym_74744.385ON4961371653e-11
KNAG0K004705.77ON414711634e-11
AEL216C5.77ON4501371644e-11
KNAG0M001804.385ON615711645e-11
KLTH0H00814g5.77ON390751609e-11
NCAS0D037806.209ON760671621e-10
ADL388W4.385ON4821311601e-10
NDAI0B009405.77ON5261381611e-10
Kwal_47.167704.385ON461641601e-10
TBLA0E049804.385ON791671612e-10
Ecym_55735.77ON5721481531e-09
Kpol_1050.795.77ON4331421492e-09
Suva_12.2414.385ON349741287e-07
Skud_10.3734.385ON346711109e-05
YJR147W (HMS2)4.385ON358671054e-04
Smik_10.4424.385ON34763920.014
Kpol_1010.625.88ON97338717.2
Smik_14.731.94ON221956718.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D11286g
         (717 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D11286g Chr4 (952637..954790) [2154 bp, 717 aa] {ON} some s...  1016   0.0  
TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.4...   214   1e-58
NCAS0H02280 Chr8 (447781..449754) [1974 bp, 657 aa] {ON} Anc_5.476    176   5e-46
YOR140W Chr15 (586981..589281) [2301 bp, 766 aa] {ON}  SFL1Trans...   174   4e-45
Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W ...   172   2e-44
Smik_15.319 Chr15 (548397..550685) [2289 bp, 762 aa] {ON} YOR140...   172   3e-44
Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140...   170   1e-43
NDAI0C01380 Chr3 complement(287185..289488) [2304 bp, 767 aa] {O...   169   2e-43
Ecym_2312 Chr2 complement(607441..609711) [2271 bp, 756 aa] {ON}...   165   6e-42
SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some s...   165   9e-42
AFR136C Chr6 complement(682887..684974) [2088 bp, 695 aa] {ON} S...   163   1e-41
KNAG0B04040 Chr2 complement(773334..775892) [2559 bp, 852 aa] {O...   164   2e-41
CAGL0I07183g Chr9 complement(690080..692395) [2316 bp, 771 aa] {...   161   9e-41
Kwal_55.21254 s55 complement(752205..754766) [2562 bp, 853 aa] {...   157   3e-39
KLTH0F14982g Chr6 complement(1224825..1227311) [2487 bp, 828 aa]...   155   1e-38
KLLA0E03191g Chr5 (296592..298904) [2313 bp, 770 aa] {ON} some s...   148   2e-36
Kpol_1062.8 s1062 complement(17211..18512) [1302 bp, 433 aa] {ON...    87   3e-17
TPHA0A05250 Chr1 (1183602..1185407) [1806 bp, 601 aa] {ON} Anc_5...    84   3e-16
SAKL0H02354g Chr8 complement(236815..237972) [1158 bp, 385 aa] {...    80   2e-15
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     79   2e-14
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    79   2e-14
Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W ...    79   2e-14
Kpol_1033.46 s1033 (115581..117734) [2154 bp, 717 aa] {ON} (1155...    79   3e-14
NCAS0E03870 Chr5 (759876..761057) [1182 bp, 393 aa] {ON} Anc_5.77      77   4e-14
TBLA0A02000 Chr1 (482464..484347) [1884 bp, 627 aa] {ON} Anc_6.2...    77   5e-14
YGR249W Chr7 (988049..989419) [1371 bp, 456 aa] {ON}  MGA1Protei...    76   7e-14
Suva_7.544 Chr7 (943366..944775) [1410 bp, 469 aa] {ON} YGR249W ...    76   7e-14
KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.2...    77   8e-14
Smik_16.58 Chr16 complement(107370..108731) [1362 bp, 453 aa] {O...    76   1e-13
KAFR0B04410 Chr2 (916555..917952) [1398 bp, 465 aa] {ON} Anc_5.7...    76   1e-13
CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some si...    74   1e-13
KNAG0F02020 Chr6 complement(384620..386935) [2316 bp, 771 aa] {O...    76   2e-13
YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimer...    76   2e-13
TDEL0G01010 Chr7 complement(209613..210809) [1197 bp, 398 aa] {O...    75   2e-13
Smik_7.209 Chr7 (363136..365649) [2514 bp, 837 aa] {ON} YGL073W ...    76   2e-13
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    74   3e-13
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    74   4e-13
TBLA0G02700 Chr7 (710230..711567) [1338 bp, 445 aa] {ON}               74   4e-13
Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W ...    74   6e-13
TDEL0E05170 Chr5 (951579..953219) [1641 bp, 546 aa] {ON} Anc_6.2...    74   6e-13
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    73   9e-13
KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {...    72   1e-12
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    73   1e-12
ZYRO0C11506g Chr3 (891756..892760) [1005 bp, 334 aa] {ON} some s...    72   1e-12
Skud_7.582 Chr7 (962776..964134) [1359 bp, 452 aa] {ON} YGR249W ...    72   1e-12
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    73   1e-12
KLTH0H04290g Chr8 complement(387890..389599) [1710 bp, 569 aa] {...    73   1e-12
SAKL0A04576g Chr1 complement(422093..423766) [1674 bp, 557 aa] {...    73   1e-12
TPHA0H01130 Chr8 (250116..251435) [1320 bp, 439 aa] {ON} Anc_5.7...    72   2e-12
ZYRO0G08734g Chr7 (704684..706402) [1719 bp, 572 aa] {ON} simila...    72   2e-12
Kwal_56.24036 s56 (822498..824201) [1704 bp, 567 aa] {ON} YGL073...    72   2e-12
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    72   3e-12
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    72   3e-12
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    72   3e-12
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    71   4e-12
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    71   4e-12
NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {O...    72   5e-12
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    71   5e-12
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    70   6e-12
Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}...    70   6e-12
CAGL0H03443g Chr8 (320888..323008) [2121 bp, 706 aa] {ON} weakly...    70   9e-12
AFL085C Chr6 complement(279712..281421) [1710 bp, 569 aa] {ON} S...    70   9e-12
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    70   1e-11
KLLA0D03322g Chr4 complement(276591..278624) [2034 bp, 677 aa] {...    70   1e-11
TPHA0E02880 Chr5 complement(603237..605393) [2157 bp, 718 aa] {O...    70   1e-11
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    69   2e-11
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    68   3e-11
KNAG0K00470 Chr11 complement(79664..80908) [1245 bp, 414 aa] {ON...    67   4e-11
AEL216C Chr5 complement(228433..229785) [1353 bp, 450 aa] {ON} S...    68   4e-11
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    68   5e-11
KLTH0H00814g Chr8 complement(90962..92134) [1173 bp, 390 aa] {ON...    66   9e-11
NCAS0D03780 Chr4 (702461..704743) [2283 bp, 760 aa] {ON} Anc_6.209     67   1e-10
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    66   1e-10
NDAI0B00940 Chr2 complement(218385..219965) [1581 bp, 526 aa] {O...    67   1e-10
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    66   1e-10
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    67   2e-10
Ecym_5573 Chr5 (1172938..1174656) [1719 bp, 572 aa] {ON} similar...    64   1e-09
Kpol_1050.79 s1050 (171402..172703) [1302 bp, 433 aa] {ON} (1714...    62   2e-09
Suva_12.241 Chr12 (384063..385112) [1050 bp, 349 aa] {ON} YJR147...    54   7e-07
Skud_10.373 Chr10 (662167..663207) [1041 bp, 346 aa] {ON} YJR147...    47   9e-05
YJR147W Chr10 (704196..705272) [1077 bp, 358 aa] {ON}  HMS2Prote...    45   4e-04
Smik_10.442 Chr10 (693234..694277) [1044 bp, 347 aa] {ON} YJR147...    40   0.014
Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa] ...    32   7.2  
Smik_14.73 Chr14 (127245..133904) [6660 bp, 2219 aa] {ON} YNL262...    32   8.2  

>ZYRO0D11286g Chr4 (952637..954790) [2154 bp, 717 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 717

 Score = 1016 bits (2626), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/717 (73%), Positives = 525/717 (73%)

Query: 1   MANQEDMSDSNAGQTQTSTNLXXXXXXXXXXXXXXXMTGPNANSNTVPXXXXXXXXXXXX 60
           MANQEDMSDSNAGQTQTSTNL               MTGPNANSNTVP            
Sbjct: 1   MANQEDMSDSNAGQTQTSTNLSGPSAVPPGGAAAGSMTGPNANSNTVPGQGSGTGSGTAS 60

Query: 61  XXXXXXXXXXHPPLQSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATY 120
                     HPPLQSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATY
Sbjct: 61  NGSSGSSGSSHPPLQSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATY 120

Query: 121 FKHTNIASFVRQLNMYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIK 180
           FKHTNIASFVRQLNMYGFHKVSNDHGKSSEHD                    ADVQEDIK
Sbjct: 121 FKHTNIASFVRQLNMYGFHKVSNDHGKSSEHDSASNSRTNNSNSSDNNNNSNADVQEDIK 180

Query: 181 IWKFRHSTGLFKRGDIEGLKYIKRRSSRNISHSSVRKXXXXXXXXXXXXXXXXXXXXXXX 240
           IWKFRHSTGLFKRGDIEGLKYIKRRSSRNISHSSVRK                       
Sbjct: 181 IWKFRHSTGLFKRGDIEGLKYIKRRSSRNISHSSVRKNSNSNGHTNNSSAGTNTNSGSTN 240

Query: 241 XXXXXXXXXXXMFGNVQFHDEEQEQLRXXXXXXXXXXXXXXXXTNEHLPXXXXXXXXXXX 300
                      MFGNVQFHDEEQEQLR                TNEHLP           
Sbjct: 241 DTNSTSGSITSMFGNVQFHDEEQEQLRQPQSQHIPHSQQHQQPTNEHLPHQHQLHLQQQQ 300

Query: 301 XXXXXXXXXXXXXXRGILSETEPGFFTSQTPQMHPSLTYTSFPNHPTAQPAPNNSDPFLE 360
                         RGILSETEPGFFTSQTPQMHPSLTYTSFPNHPTAQPAPNNSDPFLE
Sbjct: 301 QQQQQQQQQQQQHQRGILSETEPGFFTSQTPQMHPSLTYTSFPNHPTAQPAPNNSDPFLE 360

Query: 361 SRYAELSQSYNVLRYEYNSLQYRHDEALGYLKGVNMDMVHVLELLESLVTIQTSSEPSPQ 420
           SRYAELSQSYNVLRYEYNSLQYRHDEALGYLKGVNMDMVHVLELLESLVTIQTSSEPSPQ
Sbjct: 361 SRYAELSQSYNVLRYEYNSLQYRHDEALGYLKGVNMDMVHVLELLESLVTIQTSSEPSPQ 420

Query: 421 EFSGLEQELLRFKALLMSRVHRNSDAQVQQPSQRSFGENRPLSSISVPTSHSNVPSLVQH 480
           EFSGLEQELLRFKALLMSRVHRNSDAQVQQPSQRSFGENRPLSSISVPTSHSNVPSLVQH
Sbjct: 421 EFSGLEQELLRFKALLMSRVHRNSDAQVQQPSQRSFGENRPLSSISVPTSHSNVPSLVQH 480

Query: 481 VFAVPARPSSAVNVVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHFSGPRMMMMNPFES 540
           VFAVPARPSSAVNVVQ                            DHFSGPRMMMMNPFES
Sbjct: 481 VFAVPARPSSAVNVVQPASTTGSASSAPVPAPTPAPPPPPPQATDHFSGPRMMMMNPFES 540

Query: 541 TGNGSKRNMSILMDPLAPAPNLMLGMSPSHPQPFMNSSPVTASAAGYRAPRQTDRSSKIS 600
           TGNGSKRNMSILMDPLAPAPNLMLGMSPSHPQPFMNSSPVTASAAGYRAPRQTDRSSKIS
Sbjct: 541 TGNGSKRNMSILMDPLAPAPNLMLGMSPSHPQPFMNSSPVTASAAGYRAPRQTDRSSKIS 600

Query: 601 LVAXXXXXXXXXXXXXXXXXXXXHQHVASGGTPXXXXXXXXXXXXPIKEEQQTMTMVEPP 660
           LVA                    HQHVASGGTP            PIKEEQQTMTMVEPP
Sbjct: 601 LVASKNSHSSNNSDSSSGSGSLSHQHVASGGTPAGQGVGASAGAAPIKEEQQTMTMVEPP 660

Query: 661 RPPSAKEQGDIVRPIPTRSLGSSENTRGSSGVYSLLNDERPASPLDGEMTPTKKVKL 717
           RPPSAKEQGDIVRPIPTRSLGSSENTRGSSGVYSLLNDERPASPLDGEMTPTKKVKL
Sbjct: 661 RPPSAKEQGDIVRPIPTRSLGSSENTRGSSGVYSLLNDERPASPLDGEMTPTKKVKL 717

>TDEL0A03400 Chr1 (605729..608161) [2433 bp, 810 aa] {ON} Anc_5.476
           YOR140W
          Length = 810

 Score =  214 bits (544), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 102/147 (69%), Positives = 112/147 (76%), Gaps = 12/147 (8%)

Query: 71  HPPLQSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFV 130
           H PLQ+TVFIHKLYNILEDDDLKDLIWWSPSG SFLIRP E+FSRALATYFKHTNIASFV
Sbjct: 44  HVPLQNTVFIHKLYNILEDDDLKDLIWWSPSGTSFLIRPTERFSRALATYFKHTNIASFV 103

Query: 131 RQLNMYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGL 190
           RQLNMYGFHKVSNDH K  +                         Q+ +KIW+FRHS G+
Sbjct: 104 RQLNMYGFHKVSNDHNKGIQQQQQQQQPSSEAG------------QDGVKIWEFRHSMGI 151

Query: 191 FKRGDIEGLKYIKRRSSRNISHSSVRK 217
           FKRGDIEGLK+IKRRSSRNI+  +VRK
Sbjct: 152 FKRGDIEGLKFIKRRSSRNIAALNVRK 178

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 62/103 (60%), Gaps = 19/103 (18%)

Query: 359 LESRYAELSQSYNVLRYEYNSLQYRHDEALGYLKGVNMDMVHVLELLESLVTIQTSS--- 415
           LE++  EL+QS++ LRY+Y  LQY+HDE L  L+ +N DMV +L+ L+  VT+Q  S   
Sbjct: 283 LETKLRELTQSFDGLRYDYFMLQYKHDELLEQLRVLNTDMVKLLDFLQKFVTLQKLSSEV 342

Query: 416 --------EPSP--------QEFSGLEQELLRFKALLMSRVHR 442
                   +PS         QE S LEQE+LRFKA LM R+ +
Sbjct: 343 YHEASLKDDPSKLHQFQKHQQEMSYLEQEILRFKANLMQRLTK 385

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 3/36 (8%)

Query: 527 FSGPRMMMMNPFESTGNGS--KRNMSILMDPLAPAP 560
           F+GPRMMM NPFE+TG  S  KRNMSILMDPL+ AP
Sbjct: 533 FAGPRMMM-NPFETTGQTSSVKRNMSILMDPLSSAP 567

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 31/59 (52%), Positives = 41/59 (69%), Gaps = 7/59 (11%)

Query: 663 PSAKE--QGDIVRPIPTRSLGSSENTRGSSGVYSLLNDE--RPASPLDGEMTPTKKVKL 717
           P+ KE  Q +I+ P+P+R+    E+ RGSSGVYSLLN E   PASP+ GE +  KK+KL
Sbjct: 755 PATKEPSQHNIISPVPSRT--DIESRRGSSGVYSLLNREGSAPASPM-GESSSNKKIKL 810

>NCAS0H02280 Chr8 (447781..449754) [1974 bp, 657 aa] {ON} Anc_5.476
          Length = 657

 Score =  176 bits (445), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 101/144 (70%), Gaps = 8/144 (5%)

Query: 76  STVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQLNM 135
           +T+FIHKLYNILED DL+DLIWWS SG SF I+P EKFS+ALATYFKHTNI SFVRQLN+
Sbjct: 47  NTIFIHKLYNILEDKDLEDLIWWSSSGQSFFIKPTEKFSKALATYFKHTNITSFVRQLNI 106

Query: 136 YGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADV-QEDIKIWKFRHSTGLFKRG 194
           YGFHKVSND      H                      D+  E IKIW+F+HS G+FK+G
Sbjct: 107 YGFHKVSND------HQYINYPNNNNSNDNDSKGKEREDLTNETIKIWEFKHSAGIFKKG 160

Query: 195 DIEGLKYIKRR-SSRNISHSSVRK 217
           D+EGLK IKRR SSRNIS  + +K
Sbjct: 161 DVEGLKLIKRRSSSRNISAMNQKK 184

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 17/32 (53%), Positives = 21/32 (65%), Gaps = 2/32 (6%)

Query: 530 PRMMMMNPFESTGNG--SKRNMSILMDPLAPA 559
           P  +M NPFE T N   +KRN S+L+DPL P 
Sbjct: 476 PNQIMQNPFERTNNSISTKRNQSVLLDPLTPV 507

 Score = 35.0 bits (79), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 30/124 (24%), Positives = 53/124 (42%), Gaps = 14/124 (11%)

Query: 329 QTPQMHPS--LTYTSFPNHPTAQPAPNNSDPFLESRYAELSQSYNVLRYEYNSLQYRHDE 386
           Q PQ  P   + Y  +P  P +     +S+ +  +R  +L+ S N    E  S  +    
Sbjct: 247 QQPQAQPQKHIQYQRYPYTPYSSV---DSNTYQNNRRKQLNMSPNQYNEEDESSTHGKFS 303

Query: 387 A--LGYLKGVNMDMVHVLELLESLVTIQTSS-------EPSPQEFSGLEQELLRFKALLM 437
              +  L+ +N DM  ++  +E  VT+   S       +P  Q +   + EL  FK  ++
Sbjct: 304 VSEIDDLRSINQDMAKLIGFMEYFVTLHLDSGKYKIDDDPQKQNWENFQNELANFKNNVI 363

Query: 438 SRVH 441
            R+H
Sbjct: 364 KRLH 367

>YOR140W Chr15 (586981..589281) [2301 bp, 766 aa] {ON}
           SFL1Transcriptional repressor and activator; involved in
           repression of flocculation-related genes, and activation
           of stress responsive genes; negatively regulated by
           cAMP-dependent protein kinase A subunit Tpk2p
          Length = 766

 Score =  174 bits (441), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 99/148 (66%), Gaps = 14/148 (9%)

Query: 73  PLQSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQ 132
           P Q+ +FIHKLY ILED+ L DLIWW+PSGLSF+I+P+E+FS+ALATYFKHTNI SFVRQ
Sbjct: 59  PPQNAIFIHKLYQILEDESLHDLIWWTPSGLSFMIKPVERFSKALATYFKHTNITSFVRQ 118

Query: 133 LNMYGFHKVSNDHG--------------KSSEHDXXXXXXXXXXXXXXXXXXXXADVQED 178
           LN+YGFHKVS+DH                S+ HD                     +    
Sbjct: 119 LNIYGFHKVSHDHSSNDANSGDDANTNDDSNTHDDNSGNKNSSGDENTGGGVQEKEKSNP 178

Query: 179 IKIWKFRHSTGLFKRGDIEGLKYIKRRS 206
            KIW+F+HS+G+FK+GDIEGLK+IKRR+
Sbjct: 179 TKIWEFKHSSGIFKKGDIEGLKHIKRRA 206

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 38/140 (27%), Positives = 59/140 (42%), Gaps = 29/140 (20%)

Query: 335 PSLTYTSFPNHPTAQPAPNNSDP---------FLESRYAELSQSYNVLRYEYNSLQYRHD 385
           PS +  SF N     P  NNS P         +  + +A L +S N    E N      D
Sbjct: 241 PSTSSNSFGNFVPQIPGANNSIPEYFNNSHVTYENANHAPL-ESNNPEMQEQNRPPNFQD 299

Query: 386 EALGYLKGVNMDMVHVLELLESLVTIQTS-------------------SEPSPQEFSGLE 426
           E L +LK +N DMV ++E ++  +++Q S                    +   ++    E
Sbjct: 300 ETLKHLKEINFDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKKSENIVKDHQKQLQAFE 359

Query: 427 QELLRFKALLMSRVHRNSDA 446
            ++L FK  +MSR HR  D+
Sbjct: 360 SDMLTFKQHVMSRAHRTIDS 379

 Score = 37.4 bits (85), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 35/70 (50%), Gaps = 10/70 (14%)

Query: 525 DHFSGPRMMMMNPFESTGNG----SKRNMSILMDPLAPAPNLMLGMSPSHPQPFMNSSPV 580
           D FS P+MM  NPF S  N     +KR  S+LMDPL PA    +G+      P MN +P 
Sbjct: 485 DTFSTPQMMH-NPFASKNNNKPGNTKRTNSVLMDPLTPA--ASVGVQGPLNYPIMNINP- 540

Query: 581 TASAAGYRAP 590
             S   Y  P
Sbjct: 541 --SVRDYNKP 548

>Suva_8.191 Chr8 (342114..344390) [2277 bp, 758 aa] {ON} YOR140W
           (REAL)
          Length = 758

 Score =  172 bits (436), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 81/148 (54%), Positives = 99/148 (66%), Gaps = 14/148 (9%)

Query: 73  PLQSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQ 132
           P Q+ +FIHKLY ILEDD L DLIWWSPSGLSF+I+P+E+FS+ALATYFKHTNI SFVRQ
Sbjct: 55  PPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQ 114

Query: 133 LNMYGFHKVSNDHGK---------SSEHDXXXXXXXXXXXXXXXXXXXXADVQED----- 178
           LN+YGFHKVS+DH           ++  D                    A  QE      
Sbjct: 115 LNIYGFHKVSHDHTSNDTNSGDDGNTNDDANATDDNGGNKNSSGDETTGAGAQEKEKSNP 174

Query: 179 IKIWKFRHSTGLFKRGDIEGLKYIKRRS 206
            KIW+F+HS+G+FK+GDIE LK+IKRR+
Sbjct: 175 TKIWEFKHSSGIFKKGDIESLKHIKRRA 202

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/81 (28%), Positives = 38/81 (46%), Gaps = 19/81 (23%)

Query: 385 DEALGYLKGVNMDMVHVLELLESLVTIQ------------TSSEPSP-------QEFSGL 425
           DE L +LK +N DM+ ++E ++  +++Q             S + S         +    
Sbjct: 293 DETLTHLKDINFDMIKIIESMQHFISLQHNFCSQSFTFKNVSKKKSENIIKDHQNQLKVF 352

Query: 426 EQELLRFKALLMSRVHRNSDA 446
           E ++L FK  +MSR HR  DA
Sbjct: 353 ESDMLTFKQHVMSRAHRTIDA 373

>Smik_15.319 Chr15 (548397..550685) [2289 bp, 762 aa] {ON} YOR140W
           (REAL)
          Length = 762

 Score =  172 bits (435), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 82/142 (57%), Positives = 98/142 (69%), Gaps = 14/142 (9%)

Query: 73  PLQSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQ 132
           P Q+ +FIHKLY ILEDD L DLIWWSPSGLSF+I+P+E+FS+ALATYFKHTNI SFVRQ
Sbjct: 59  PPQNAIFIHKLYQILEDDSLHDLIWWSPSGLSFMIKPVERFSKALATYFKHTNITSFVRQ 118

Query: 133 LNMYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXAD------VQED-----IKI 181
           LN+YGFHKVS+DH   S +D                     D      VQE       KI
Sbjct: 119 LNIYGFHKVSHDH---SSNDTNGGDEANTNDDSSGNKNTSGDENNGVSVQEKERSNPTKI 175

Query: 182 WKFRHSTGLFKRGDIEGLKYIK 203
           W+F+HS+G+FK+GDIEGLK+IK
Sbjct: 176 WEFKHSSGIFKKGDIEGLKHIK 197

 Score = 49.7 bits (117), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 39/154 (25%), Positives = 68/154 (44%), Gaps = 27/154 (17%)

Query: 320 ETEPGFFTSQTPQMHPSLTYTSFPNHPTAQPAPNNSDP--FLESRYAELSQSYNVLRYEY 377
           +T+ G     +    PS + ++F N     P+ NN+ P  F  S     + S+  L Y  
Sbjct: 220 DTDSGVRARPSSVQDPSTSSSAFGNFVPQIPSANNTIPECFNNSHVTYENLSHGALEYNN 279

Query: 378 NSLQYR------HDEALGYLKGVNMDMVHVLELLESLVTIQTS----------------- 414
             +Q +       DEAL +LK +N+DMV ++E ++  +++Q S                 
Sbjct: 280 PDMQEQSKPPSFQDEALKHLKDINVDMVKIIESMQHFISLQHSFCSQSFTFKNVSKKKSE 339

Query: 415 --SEPSPQEFSGLEQELLRFKALLMSRVHRNSDA 446
              +   ++    E ++L FK  +MSR HR  D+
Sbjct: 340 NIVKEHQKQLKAFENDMLTFKQHVMSRAHRTIDS 373

 Score = 34.3 bits (77), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 32/59 (54%), Gaps = 7/59 (11%)

Query: 525 DHFSGPRMMMMNPFESTGNG----SKRNMSILMDPLAPAPNLMLGMSPSHPQPFMNSSP 579
           D FS P+MM  NPF S        ++R  S+LMDPL PA +  +G+      P MN +P
Sbjct: 481 DTFSTPQMMH-NPFASKNTNKPGNTRRTNSVLMDPLTPAAS--VGVQAPLNYPIMNINP 536

>Skud_15.303 Chr15 (541019..543265) [2247 bp, 748 aa] {ON} YOR140W
           (REAL)
          Length = 748

 Score =  170 bits (430), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 100/150 (66%), Gaps = 16/150 (10%)

Query: 73  PLQSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQ 132
           P Q+ +FIHKLY ILEDD L DLIWWS SGLSF+I+P+E+FS+ALATYFKHTNI SFVRQ
Sbjct: 41  PPQNAIFIHKLYQILEDDSLHDLIWWSSSGLSFMIKPVERFSKALATYFKHTNITSFVRQ 100

Query: 133 LNMYGFHKVSNDHGKS---SEHDXXXXXXXXX------XXXXXXXXXXXADVQED----- 178
           LN+YGFHKVS+DH  +   S  D                          A VQE      
Sbjct: 101 LNIYGFHKVSHDHNSNEINSGDDANTNDVNSTNDDGGGSKNSSGEENNGATVQEKEKEKS 160

Query: 179 --IKIWKFRHSTGLFKRGDIEGLKYIKRRS 206
              KIW+F+HS+G+FK+GDIEGLK+IKRR+
Sbjct: 161 NPTKIWEFKHSSGIFKKGDIEGLKHIKRRA 190

 Score = 40.8 bits (94), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 22/81 (27%), Positives = 40/81 (49%), Gaps = 19/81 (23%)

Query: 385 DEALGYLKGVNMDMVHVLELLESLVTIQ------------TSSEPSP-------QEFSGL 425
           DE L +LK +N+DM+ ++E ++  +++Q             S + S        ++    
Sbjct: 283 DETLTHLKEINVDMIKIIESMQHFISLQHNFCSKSFTFKNVSKKKSENIMKDHQKQLKTF 342

Query: 426 EQELLRFKALLMSRVHRNSDA 446
           E ++L FK  +MSR HR  D+
Sbjct: 343 ENDMLTFKQHVMSRAHRTMDS 363

 Score = 34.7 bits (78), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 26/61 (42%), Positives = 34/61 (55%), Gaps = 9/61 (14%)

Query: 525 DHFSGPRMMMMNPFESTGNG-----SKRNMSILMDPLAPAPNLMLGMSPSHPQPFMNSSP 579
           D F+ P+MM  NPF S  NG     +KR  S+LMDPL PA    +G+  +   P MN +P
Sbjct: 467 DTFNTPQMMH-NPFASK-NGHKPGNTKRTNSVLMDPLTPA--TSVGIQGTLNYPIMNINP 522

Query: 580 V 580
            
Sbjct: 523 T 523

>NDAI0C01380 Chr3 complement(287185..289488) [2304 bp, 767 aa] {ON}
           Anc_5.476
          Length = 767

 Score =  169 bits (428), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 75/128 (58%), Positives = 89/128 (69%), Gaps = 1/128 (0%)

Query: 76  STVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQLNM 135
           +T+FIHKLYNILED DL+DLIWWS  G SFLIRP E+FS+ALATYFKHTNI SFVRQLN+
Sbjct: 77  NTIFIHKLYNILEDKDLEDLIWWSNDGKSFLIRPTERFSKALATYFKHTNITSFVRQLNI 136

Query: 136 YGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGLFKRGD 195
           YGFHKVSNDH   +                        D  E +KIW+F+HS G+F++GD
Sbjct: 137 YGFHKVSNDHQYINNKTEDDTTTNVTNHANTDVNNNITD-NEQVKIWEFKHSAGIFRKGD 195

Query: 196 IEGLKYIK 203
           +E LK IK
Sbjct: 196 VESLKLIK 203

 Score = 38.5 bits (88), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 26/95 (27%), Positives = 44/95 (46%), Gaps = 18/95 (18%)

Query: 375 YEYNSLQYRHDEALGYLKGVNMDMVHVLELLESLVTIQTS------SEPS---------- 418
           YE    QY H+     +K  NMDM+ +++ ++  V++         SEPS          
Sbjct: 351 YEQPDPQYTHESVEQTMKAANMDMIKLIDYMQKFVSLLNKNTNGIISEPSIGTSLKDNEM 410

Query: 419 PQEFSGLEQELLRFKALLMSRVHRNSDAQVQQPSQ 453
            Q++   + E+  FK  ++SR+  N  A  +Q SQ
Sbjct: 411 KQQWDEFQSEITNFKRSILSRLQIN--AMYEQSSQ 443

 Score = 33.1 bits (74), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 16/35 (45%), Positives = 21/35 (60%), Gaps = 3/35 (8%)

Query: 528 SGPRMMMMNPFESTGNG---SKRNMSILMDPLAPA 559
           +G   MM NPF S  +    SKR+ S+L+DPL P 
Sbjct: 553 TGKYQMMQNPFNSNASSRYSSKRHRSVLLDPLTPV 587

>Ecym_2312 Chr2 complement(607441..609711) [2271 bp, 756 aa] {ON}
           similar to Ashbya gossypii AFR136C
          Length = 756

 Score =  165 bits (417), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 99/138 (71%), Gaps = 20/138 (14%)

Query: 76  STVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQLNM 135
           ST FIHKLY++LED+++KDLIWWS S  SFLI+P EKFS+ALAT+FKHTN+ASFVRQLNM
Sbjct: 70  STAFIHKLYSMLEDEEMKDLIWWSESENSFLIKPNEKFSKALATFFKHTNVASFVRQLNM 129

Query: 136 YGFHKVSNDHG---KSSEHDXXXXXXXXXXXXXXXXXXXXADVQED-IKIWKFRHSTGLF 191
           YGFHKVS DH    KSSE D                     D++ED I +W+FRHS G F
Sbjct: 130 YGFHKVS-DHKSNEKSSETD---------------GAHGNGDIEEDSINLWEFRHSLGCF 173

Query: 192 KRGDIEGLKYIKRRSSRN 209
           ++GD E LK IKRRSS+N
Sbjct: 174 RKGDKESLKSIKRRSSKN 191

 Score = 47.8 bits (112), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 58/248 (23%), Positives = 87/248 (35%), Gaps = 97/248 (39%)

Query: 379 SLQYRHDEALGYLKGVNMDMVHVLELLESLVTIQT-----------------SSEPS--- 418
           +LQ R+D A+  L+  NMDM+ +L+L++  + I T                  S PS   
Sbjct: 289 TLQNRYDNAIEELRATNMDMMKLLDLVQKAIWISTVPSASSNTSAIAPGVSSGSRPSTPV 348

Query: 419 -----------------------PQEFSGLEQELLRFKALLMSRVHRNSDAQVQQPSQR- 454
                                   Q F  L QE+++FKA +++++ R  D      SQ+ 
Sbjct: 349 NVSAQIGQDVVSPGYELSPKTNQKQYFEQLNQEIVKFKASILNKLQRQIDYHAPYHSQKL 408

Query: 455 ------SFGENRPLSSISVPT---SHSNVPSLVQHVFA---------VPARPSSAVNVVQ 496
                  +    PLSS   P     H N  S +    +         +P + S+A     
Sbjct: 409 SQAPVMYYSSLAPLSSDPTPDMEFQHYNSASPINSPVSDGLYSTSNPIPEQTSTATTA-- 466

Query: 497 XXXXXXXXXXXXXXXXXXXXXXXXXXXXDHFSGPRMMMMNPFESTGNG----SKRNMSIL 552
                                           GP  +MMNPF    +      KR+MS+ 
Sbjct: 467 -----------------------------GIKGPPYLMMNPFAKRKSTESLPKKRHMSVF 497

Query: 553 MDPLAPAP 560
           MDPLAP P
Sbjct: 498 MDPLAPVP 505

>SAKL0G03586g Chr7 (297103..299664) [2562 bp, 853 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 853

 Score =  165 bits (417), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 76/134 (56%), Positives = 97/134 (72%), Gaps = 17/134 (12%)

Query: 77  TVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQLNMY 136
           T FIHKLY++LED ++KDLIWWSP+  SFLI+P EKFS+ALAT+FKHTN+ASFVRQLNMY
Sbjct: 43  TAFIHKLYSMLEDQEMKDLIWWSPTQDSFLIKPNEKFSKALATFFKHTNVASFVRQLNMY 102

Query: 137 GFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQED-IKIWKFRHSTGLFKRGD 195
           GFHKV+++ GK ++                      A   ED I +W+F+HS+  F++GD
Sbjct: 103 GFHKVNDNTGKQTD----------------KYSTDSASTNEDSINLWEFKHSSSAFRKGD 146

Query: 196 IEGLKYIKRRSSRN 209
           +EGLK IKRRSSRN
Sbjct: 147 MEGLKTIKRRSSRN 160

 Score = 34.7 bits (78), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 16/48 (33%), Positives = 29/48 (60%)

Query: 359 LESRYAELSQSYNVLRYEYNSLQYRHDEALGYLKGVNMDMVHVLELLE 406
           L+S++ E  Q+   L+ E  +  +  D+ +  L+  NMDM+ +LEL+E
Sbjct: 241 LDSKHNEGVQNTTSLKNEQANAPWNCDQTVYELRTTNMDMIRLLELIE 288

 Score = 31.6 bits (70), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 16/34 (47%), Positives = 20/34 (58%), Gaps = 4/34 (11%)

Query: 528 SGPRMMMMNPF----ESTGNGSKRNMSILMDPLA 557
           SG   +MMNPF     S  +   R+MS+LMDPL 
Sbjct: 545 SGTPYLMMNPFAKRKSSASSARNRHMSVLMDPLV 578

>AFR136C Chr6 complement(682887..684974) [2088 bp, 695 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOR140W
           (SFL1)
          Length = 695

 Score =  163 bits (412), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 92/133 (69%), Gaps = 19/133 (14%)

Query: 77  TVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQLNMY 136
           T FIHKLY++LEDD++KDLIWWS S  SFLI+P EKFS+ALAT+FKHTN+ASFVRQLNMY
Sbjct: 25  TAFIHKLYSMLEDDNMKDLIWWSASQNSFLIKPNEKFSKALATFFKHTNVASFVRQLNMY 84

Query: 137 GFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGLFKRGDI 196
           GFHKVS DH  SS                        D  E I +W+FRHS G F++GD 
Sbjct: 85  GFHKVS-DHKPSSAKGTSQ------------------DEDEAINLWEFRHSMGCFRKGDK 125

Query: 197 EGLKYIKRRSSRN 209
           E LK IKRRSS+N
Sbjct: 126 ESLKSIKRRSSKN 138

>KNAG0B04040 Chr2 complement(773334..775892) [2559 bp, 852 aa] {ON}
           Anc_5.476 YOR140W
          Length = 852

 Score =  164 bits (414), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 104/164 (63%), Gaps = 21/164 (12%)

Query: 75  QSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQLN 134
           Q+TVFIHKLY+ILEDD L+DLIWW+P+G+SF IRP E FS+ LATYFKHTNI SFVRQLN
Sbjct: 61  QNTVFIHKLYHILEDDALRDLIWWAPNGMSFYIRPNETFSKTLATYFKHTNITSFVRQLN 120

Query: 135 MYGFHKVSN-----------DHGKSS---------EHDXXXXXXXXXXXXXXXXXXXXAD 174
           +YGFHKV+N           + G+++         + +                      
Sbjct: 121 IYGFHKVTNWNDTAAFAAVSNDGRNNSLGALPGGPDMNTHSPSTGVVVKSEPHTKSGPGA 180

Query: 175 VQEDIKIWKFRHSTGLFKRGDIEGLKYIKRRSS-RNISHSSVRK 217
               +KIW+F+HS  LF+RGDIEGLK+IKRRSS ++IS  S RK
Sbjct: 181 TSSPVKIWEFKHSANLFRRGDIEGLKFIKRRSSAKSISQMSSRK 224

 Score = 36.2 bits (82), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 5/37 (13%)

Query: 527 FSGPRMMMMNPFES---TGNG--SKRNMSILMDPLAP 558
           ++ P+  MMNPFE    TG+   +KRNMS+L+DPL P
Sbjct: 598 YNEPQRPMMNPFEMRNFTGDALVTKRNMSVLVDPLTP 634

>CAGL0I07183g Chr9 complement(690080..692395) [2316 bp, 771 aa] {ON}
           some similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140w SFL1
          Length = 771

 Score =  161 bits (408), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 91/132 (68%), Gaps = 4/132 (3%)

Query: 76  STVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQLNM 135
           +TVFI+KLY++LE+ DL DLIWW+ +G SFLIRP E FS+ LA YFKHTNI SFVRQLN+
Sbjct: 8   NTVFINKLYDLLENKDLDDLIWWAANGESFLIRPSESFSQNLAHYFKHTNITSFVRQLNI 67

Query: 136 YGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGLFKRGD 195
           YGFHK+SNDH     H+                        E+IK+W+F+HS GLFK+GD
Sbjct: 68  YGFHKISNDHF----HNLKREKKQKSSTDNNTGVSNNNSGDENIKVWEFKHSGGLFKKGD 123

Query: 196 IEGLKYIKRRSS 207
           +E LK IKRRSS
Sbjct: 124 LENLKLIKRRSS 135

 Score = 35.4 bits (80), Expect = 0.65,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 82/212 (38%), Gaps = 29/212 (13%)

Query: 370 YNVLRYEYNSLQYRHDEALGYLKGVNMDMVHVLELLESLVTIQ------TSSEPSPQEFS 423
           YN   YE  S+Q  H   +  ++  NMDM+ +LEL+  L  +        +SE  P+   
Sbjct: 306 YNETLYEQ-SIQLNHQ--IAQMRNTNMDMLAILELMSKLAEMNKEVLNINNSEKIPE--- 359

Query: 424 GLEQELLRFKALLMSRVHRNSDAQVQQPSQRSFG-ENRPLSSISVPTSHSNVPSLVQHVF 482
            L     RF    ++ +  N   ++   +   FG ++  L S S    H + P     V+
Sbjct: 360 -LMANHYRFFDAQLTSLKNNILDRINNTNIHKFGMDSNDLRSASQTNIHLSHPIAQNMVY 418

Query: 483 --AVPARPSSAVNVVQXXXXXXXXXXXXXXXXXXXXXXXX-----XXXXDHFSGPRMMMM 535
             A  A P S    ++                                 D+FS   +   
Sbjct: 419 SSADQAIPKSVPYYLKQGQRTSPDNGTTTPAGAQNYSKNQVVQHPQAANDYFSSVHVQTA 478

Query: 536 NPFE---STGNG-----SKRNMSILMDPLAPA 559
           NPFE   +  NG     ++R+MS+L+DPL PA
Sbjct: 479 NPFEKFQTEKNGIINVTARRHMSVLVDPLTPA 510

>Kwal_55.21254 s55 complement(752205..754766) [2562 bp, 853 aa] {ON}
           YOR140W (SFL1) - 1:1 [contig 130] FULL
          Length = 853

 Score =  157 bits (397), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 72/132 (54%), Positives = 88/132 (66%), Gaps = 5/132 (3%)

Query: 77  TVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQLNMY 136
           T FIHKLY++LED+++ +LIWWSPS  SFLIRP E+FS+ALATYFKHTN+ASFVRQLNMY
Sbjct: 58  TAFIHKLYSMLEDEEMHELIWWSPSQTSFLIRPTERFSKALATYFKHTNVASFVRQLNMY 117

Query: 137 GFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGLFKRGDI 196
           GFHKV NDH    +                              +W+F+HS+  F+RGD+
Sbjct: 118 GFHKV-NDH----KAHGAKSGAANKGEEAGLKTRGGQPTDNSTSVWEFKHSSAAFRRGDM 172

Query: 197 EGLKYIKRRSSR 208
           E LK IKRRSSR
Sbjct: 173 ESLKLIKRRSSR 184

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 65/274 (23%), Positives = 100/274 (36%), Gaps = 94/274 (34%)

Query: 357 PFLESRYAELSQSYNVLRYEYNSLQYRHDEALGYLKGVNMDMVHVLELLESLV------- 409
           PF   + ++     ++ + +  S Q +++ A+  L+  NMDM+ +L+L+ SLV       
Sbjct: 374 PFNNPKLSDAFPGMHMAKLDNLSYQTQYEIAVEDLRNSNMDMIKLLDLVHSLVTVSPQLS 433

Query: 410 -------------TIQTSSEPSPQEFS------GLEQ--------ELLRFKALLMSRVHR 442
                        T   S  P+  +FS       L+Q        E+ R K   + RV R
Sbjct: 434 GANNRKQDEVKRSTTPVSGMPASNDFSESPKDGSLQQQYLDNIMGEIARLKNSTLYRVQR 493

Query: 443 NSDAQVQQPSQRSFGENRPLSSISVPTS-------------------------------- 470
           +  A +QQ         RP SS+  PT+                                
Sbjct: 494 S--ALLQQ-------GMRPSSSLEHPTAAATTYPMAFPGRAALSTQTSMSSPALSQMATG 544

Query: 471 -HSNVPSLVQHVFAVPARPSSAVNVVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHFSG 529
            H+++P +   ++  PA   SA   +                                S 
Sbjct: 545 HHASLPQMTHPMYYQPAYTPSAYPTIAGPVSDYYGTAAIKAPGA--------------SA 590

Query: 530 PRMMMMNPFESTGNGS---KRNMSILMDPLAPAP 560
           P  + MNPFE  G+ S    RNMS+LMDPLAPAP
Sbjct: 591 P-CLKMNPFEKKGSTSSSRNRNMSVLMDPLAPAP 623

>KLTH0F14982g Chr6 complement(1224825..1227311) [2487 bp, 828 aa]
           {ON} some similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 828

 Score =  155 bits (392), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 74/141 (52%), Positives = 90/141 (63%), Gaps = 13/141 (9%)

Query: 77  TVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQLNMY 136
           T FIHKLY++LED ++ +LIWWSP   SFLIRP E+F +ALATYFKHTN+ASFVRQLNMY
Sbjct: 72  TAFIHKLYSMLEDPEMDELIWWSPPQTSFLIRPTERFGKALATYFKHTNVASFVRQLNMY 131

Query: 137 GFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGLFKRGDI 196
           GFHKV NDH                           +  +    IW+F+HS+  F+RGD+
Sbjct: 132 GFHKV-NDH----------KTHAASKNGAAKTDDPASKSENTTSIWEFKHSSSAFRRGDM 180

Query: 197 EGLKYIKRRSSRNISHSSVRK 217
           E LK IKRRSSR    +S RK
Sbjct: 181 ESLKLIKRRSSRY--QASARK 199

 Score = 52.0 bits (123), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 62/251 (24%), Positives = 102/251 (40%), Gaps = 49/251 (19%)

Query: 357 PFLESRYAELSQSYNVLRYEYNSLQYRHDEALGYLKGVNMDMVHVLELLESLVTIQ---- 412
           P + ++ +++     + +++ N+ Q +++ A+  L+  NMDMV +L+L+ +LVT+     
Sbjct: 365 PQINTKVSDVLHGVQLAKFDNNAYQNQYEAAVEDLRNSNMDMVRLLDLVHNLVTLTPQLA 424

Query: 413 -----------------TSSEPSPQEFS-----------GLEQ---ELLRFKALLMSRVH 441
                             S  P+P E              ++Q   E+ R K   + R+ 
Sbjct: 425 AASSGRPSEGIKRSTTPVSGHPNPSEMGTSPRDTPSQQQCMDQIMSEIARLKNSTLYRLQ 484

Query: 442 RNSDAQVQQPSQRSFGENRPLSSISVPTSHS---------NVPSLVQHVFAVPARPSSAV 492
           R++  Q       SF E    SS ++P +           + P+L Q   A PA P   +
Sbjct: 485 RSTMLQQTVRPVHSFSEYPMTSSSAIPAASRPPLSNQTSLSSPALSQLTNAQPA-PLPQM 543

Query: 493 NVVQXXXXXXXXXXXXXXXXXXXXXXXXXXXXDHFSGPRMMMMNPFE---STGNGSKRNM 549
           +                               +  S P +M MNPFE   ST +   RNM
Sbjct: 544 SHAMYYPPAYGPSVYPGTPGPQSDYFGTTAKANSGSMPYLM-MNPFEKKTSTSSSGNRNM 602

Query: 550 SILMDPLAPAP 560
           S+LMDPLAPAP
Sbjct: 603 SVLMDPLAPAP 613

>KLLA0E03191g Chr5 (296592..298904) [2313 bp, 770 aa] {ON} some
           similarities with uniprot|P20134 Saccharomyces
           cerevisiae YOR140W SFL1 Transcription factor with
           domains homologous to Hsf1p and to myc oncoprotein
           required for normal cell surface assembly and
           flocculence
          Length = 770

 Score =  148 bits (373), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 72/131 (54%), Positives = 88/131 (67%), Gaps = 21/131 (16%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHTNIASFVRQLNMYGF 138
           FIHKLY++LEDDDLK+LIWWSPS  SFLIRP E+FS+AL+ +FKHTN+ASFVRQLNMYGF
Sbjct: 88  FIHKLYSMLEDDDLKNLIWWSPSCDSFLIRPTERFSKALSAFFKHTNVASFVRQLNMYGF 147

Query: 139 HKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQE-DIKIWKFRHSTGLFKRGDIE 197
            KVS DH  +                         D  E  I +W+F+HS+G F++GD E
Sbjct: 148 QKVS-DHKST-------------------WAANTDDSDEPSINLWEFKHSSGYFRKGDTE 187

Query: 198 GLKYIKRRSSR 208
            LK IKR SS+
Sbjct: 188 SLKSIKRGSSK 198

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/48 (31%), Positives = 33/48 (68%)

Query: 359 LESRYAELSQSYNVLRYEYNSLQYRHDEALGYLKGVNMDMVHVLELLE 406
           +++   EL QS + LR E++ LQ+ ++ A+  L+  N+DM+ +L++++
Sbjct: 307 IDTNVHELHQSISGLRNEHSDLQHSYEMAVEELRATNIDMIKMLDIVQ 354

 Score = 33.5 bits (75), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 21/27 (77%), Gaps = 4/27 (14%)

Query: 533 MMMNPFE----STGNGSKRNMSILMDP 555
           +MMNPFE    STG+  KR+MS+LMDP
Sbjct: 502 LMMNPFERRISSTGSSKKRHMSVLMDP 528

>Kpol_1062.8 s1062 complement(17211..18512) [1302 bp, 433 aa] {ON}
           complement(17211..18512) [1302 nt, 434 aa]
          Length = 433

 Score = 86.7 bits (213), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 74/143 (51%), Gaps = 14/143 (9%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLS-FLIRPIE-KFS-RALATYFKHTNIASFVRQLNM 135
           F+H+LY+IL   DL D I+WS    S F I+P   +FS + L +YFKH N++SFVRQL+M
Sbjct: 6   FLHQLYSILHQPDLTDWIYWSEDDSSIFAIKPYSTQFSSQILKSYFKHGNVSSFVRQLHM 65

Query: 136 YGFHKVS--NDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADV--------QEDIKIWKFR 185
           YGFHK+S  N  G     +                    +D+           + IW F 
Sbjct: 66  YGFHKLSHLNKQGNDKNGNNTDPQNTTNNGNNSGIDPSESDISFPPTLPQDRSLTIWYFT 125

Query: 186 HSTGLF-KRGDIEGLKYIKRRSS 207
           H +G F K  DI  L+ I+R+S+
Sbjct: 126 HPSGYFHKNADILNLEKIQRKST 148

>TPHA0A05250 Chr1 (1183602..1185407) [1806 bp, 601 aa] {ON} Anc_5.77
           YGR249W
          Length = 601

 Score = 84.3 bits (207), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 75/151 (49%), Gaps = 24/151 (15%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLS-FLIRPIE-KFS-RALATYFKHTNIASFVRQLN 134
           VFIH+LY+IL+  DL++ I W P     F I+P    FS + L  YFKH N  SFVRQL 
Sbjct: 3   VFIHQLYSILDQSDLREWIHWIPDADGVFAIKPFHHNFSQKVLQKYFKHKNFTSFVRQLY 62

Query: 135 MYGFHKVS-------------NDHGKSSE------HDXXXXXXXXXXXXXXXXXXXXADV 175
           MYGFHK+S             ++ GK+S+       D                     + 
Sbjct: 63  MYGFHKLSPNKNVIDSKASLTSNTGKTSQTNSTSAKDSNSRKSNSLSDKSKGNSENAKNG 122

Query: 176 QEDIKIWKFRHSTGLFKRG-DIEGLKYIKRR 205
           +EDI+ W F H +GLF +G D+  L  I+R+
Sbjct: 123 KEDIE-WYFTHPSGLFHKGSDVVTLNKIQRK 152

>SAKL0H02354g Chr8 complement(236815..237972) [1158 bp, 385 aa] {ON}
           some similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 385

 Score = 80.5 bits (197), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 71/138 (51%), Gaps = 21/138 (15%)

Query: 74  LQSTVFIHKLYNILEDDDLKDLIWWS-PSGLSFLIRPI--EKFSRALATYFKHTNIASFV 130
           +Q+  FIH+L+ IL+ +DL   I+WS  S   F ++P   E  S+ L  YFKH N++SFV
Sbjct: 1   MQTKTFIHQLHGILQQEDLDQWIYWSSKSQTVFALKPYDPEFSSQVLKRYFKHGNVSSFV 60

Query: 131 RQLNMYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGL 190
           RQL+MYGFHK+++ +   S+                          +D  IW F H +G 
Sbjct: 61  RQLHMYGFHKIASSNAPQSQ-----------------IAANTTANNKDSVIWNFTHPSGN 103

Query: 191 FKRGDIE-GLKYIKRRSS 207
           F R      L  I+R+SS
Sbjct: 104 FHRDSTTVELSKIQRKSS 121

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 67/131 (51%), Gaps = 33/131 (25%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFVRQLNMYG 137
           F+ KLY ILE +   +L+ W+P G SF++    KF+ + L T+FKH+N +SFVRQLN Y 
Sbjct: 83  FVRKLYKILETNTFPNLVRWTPEGTSFVVLDTGKFTTQILPTHFKHSNFSSFVRQLNKYD 142

Query: 138 FHKV---SNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGLFKRG 194
           FHKV   S++ G+    +                             W+F H +  FKR 
Sbjct: 143 FHKVKRKSDEPGRKKYGELS---------------------------WEFTHPS--FKRH 173

Query: 195 DIEGLKYIKRR 205
           D  GL+ IKR+
Sbjct: 174 DEAGLENIKRK 184

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON}
           Anc_4.385 YJR147W
          Length = 587

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 65/138 (47%), Gaps = 37/138 (26%)

Query: 76  STVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQLN 134
           S  F+  +Y ILE +D  D+I WS  G SFL+    KF S+ L  +FKH+N ASFVRQLN
Sbjct: 64  SNDFVRIIYGILEREDYPDIITWSEKGDSFLVLDTGKFTSQILPNHFKHSNFASFVRQLN 123

Query: 135 MYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTG----- 189
            Y FHKV                                  QE+ K WK+   +      
Sbjct: 124 KYDFHKVKR-------------------------------TQEEKKKWKYGEQSWEFCHP 152

Query: 190 LFKRGDIEGLKYIKRRSS 207
           LFKR   +GL  IKR++S
Sbjct: 153 LFKRNHDDGLNNIKRKTS 170

>Skud_7.208 Chr7 (371946..374456) [2511 bp, 836 aa] {ON} YGL073W
           (REAL)
          Length = 836

 Score = 79.0 bits (193), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 46/65 (70%), Gaps = 1/65 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQLNMY 136
            F++KL+++L DD    LI W+P G SF++   E+F    L  YFKH+N ASFVRQLNMY
Sbjct: 175 AFVNKLWSMLNDDSNAKLIQWAPDGKSFIVTNREEFVHEILPKYFKHSNFASFVRQLNMY 234

Query: 137 GFHKV 141
           G+HKV
Sbjct: 235 GWHKV 239

>Kpol_1033.46 s1033 (115581..117734) [2154 bp, 717 aa] {ON}
           (115581..117734) [2154 nt, 718 aa]
          Length = 717

 Score = 78.6 bits (192), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 35/65 (53%), Positives = 47/65 (72%), Gaps = 1/65 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRA-LATYFKHTNIASFVRQLNMY 136
            F++K++N++ DD+  +LI WS  GLS +I   E+  R  L  YFKH+N ASFVRQLNMY
Sbjct: 185 TFVNKVWNMVNDDNNAELIRWSSDGLSIVINNREELVREILPKYFKHSNFASFVRQLNMY 244

Query: 137 GFHKV 141
           G+HKV
Sbjct: 245 GWHKV 249

>NCAS0E03870 Chr5 (759876..761057) [1182 bp, 393 aa] {ON} Anc_5.77
          Length = 393

 Score = 76.6 bits (187), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 74/138 (53%), Gaps = 27/138 (19%)

Query: 74  LQSTVFIHKLYNILEDDDLKDLIWWSP-SGLSFLIRPIE-KFS-RALATYFKHTNIASFV 130
           +Q   FIH+L++IL++  L D I WS      F+++P +  FS + L  YFKH NI+SFV
Sbjct: 1   MQHRNFIHQLHSILQEPTLDDWITWSSFDNNVFILKPYDPNFSDKVLKKYFKHGNISSFV 60

Query: 131 RQLNMYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGL 190
           RQL+MYGFHK++  H  ++                         VQ    IW F+H +G 
Sbjct: 61  RQLHMYGFHKIATVHNNNNV--------------------VNDKVQ---TIWHFKHPSGN 97

Query: 191 FKRG-DIEGLKYIKRRSS 207
           F R   ++ LK I+R+S+
Sbjct: 98  FTRDVHLDSLKKIQRKST 115

>TBLA0A02000 Chr1 (482464..484347) [1884 bp, 627 aa] {ON} Anc_6.209
           YGL073W
          Length = 627

 Score = 77.4 bits (189), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 37/65 (56%), Positives = 46/65 (70%), Gaps = 1/65 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSR-ALATYFKHTNIASFVRQLNMY 136
            F++KL+N+L D   +D+I WS  G SFL+   EKF    L  YFKH+N ASFVRQLNMY
Sbjct: 162 AFVNKLWNMLNDPINQDMIRWSDDGKSFLVVNREKFVHHVLPNYFKHSNFASFVRQLNMY 221

Query: 137 GFHKV 141
           G+HKV
Sbjct: 222 GWHKV 226

>YGR249W Chr7 (988049..989419) [1371 bp, 456 aa] {ON}  MGA1Protein
           similar to heat shock transcription factor; multicopy
           suppressor of pseudohyphal growth defects of ammonium
           permease mutants
          Length = 456

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 73/138 (52%), Gaps = 24/138 (17%)

Query: 74  LQSTVFIHKLYNILEDDDLKDLIWWSPS-GLSFLIRPIE-KFS-RALATYFKHTNIASFV 130
           +Q   F+H+L+ IL + ++   I+WSP+    F ++P +  FS   L  YFKH N+ SFV
Sbjct: 1   MQPKTFVHQLHAILLEPEVNKWIYWSPTDNTVFFLKPYDPNFSTHVLKRYFKHGNVNSFV 60

Query: 131 RQLNMYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTG- 189
           RQL+MYGFHK+S+     S  +                     +V+E ++ WKF H +G 
Sbjct: 61  RQLHMYGFHKLSHPSPDQSSAN-------------------NGNVKELVE-WKFTHPSGF 100

Query: 190 LFKRGDIEGLKYIKRRSS 207
            FK  +   L  I+R+S+
Sbjct: 101 FFKEANAGILNKIQRKST 118

>Suva_7.544 Chr7 (943366..944775) [1410 bp, 469 aa] {ON} YGR249W
           (REAL)
          Length = 469

 Score = 76.3 bits (186), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 75/138 (54%), Gaps = 24/138 (17%)

Query: 74  LQSTVFIHKLYNILEDDDLKDLIWWSPS-GLSFLIRPIE-KFS-RALATYFKHTNIASFV 130
           +Q   F+H+L++IL + ++   I+WSP+  + F ++P +  FS   L  YFKH N+ SFV
Sbjct: 1   MQPKTFVHQLHSILLEPEVNQWIYWSPTDSMVFFLKPYDPNFSTHVLKRYFKHGNVNSFV 60

Query: 131 RQLNMYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTG- 189
           RQL+MYGFHK+S+   + +  +                     + +E ++ WKF H +G 
Sbjct: 61  RQLHMYGFHKLSHPSPEQTSAN-------------------NGNTKELVE-WKFTHPSGF 100

Query: 190 LFKRGDIEGLKYIKRRSS 207
            FK  +   L  I+R+S+
Sbjct: 101 FFKEANAGVLNKIQRKST 118

>KAFR0C02250 Chr3 (445113..446954) [1842 bp, 613 aa] {ON} Anc_6.209
           YGL073W
          Length = 613

 Score = 76.6 bits (187), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 48/72 (66%), Gaps = 1/72 (1%)

Query: 71  HPPLQSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASF 129
           HP      F++KL+++L D+   DLI WS  G SF++   E+F    L  YFKH+N ASF
Sbjct: 144 HPHKSRPAFVNKLWSMLNDNSNLDLIQWSNDGKSFVVTNREQFVHEILPKYFKHSNFASF 203

Query: 130 VRQLNMYGFHKV 141
           VRQLNMYG+HKV
Sbjct: 204 VRQLNMYGWHKV 215

>Smik_16.58 Chr16 complement(107370..108731) [1362 bp, 453 aa] {ON}
           YGR249W (REAL)
          Length = 453

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 73/138 (52%), Gaps = 24/138 (17%)

Query: 74  LQSTVFIHKLYNILEDDDLKDLIWWSPS-GLSFLIRPIE-KFS-RALATYFKHTNIASFV 130
           +Q   F+H+L++IL + ++   I+WSP+  + F ++P +  FS   L  YFKH N+ SFV
Sbjct: 1   MQPKTFVHQLHSILLEPEVNKWIYWSPTDNMVFFLKPYDPNFSTHVLKRYFKHGNVNSFV 60

Query: 131 RQLNMYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTG- 189
           RQL+MYGFHK+S+                              +V+E ++ WKF H +G 
Sbjct: 61  RQLHMYGFHKLSH-------------------PSPDQVSTNNGNVKELVE-WKFTHPSGF 100

Query: 190 LFKRGDIEGLKYIKRRSS 207
            FK  +   L  I+R+S+
Sbjct: 101 FFKEANAGVLNKIQRKST 118

>KAFR0B04410 Chr2 (916555..917952) [1398 bp, 465 aa] {ON} Anc_5.77
           YGR249W
          Length = 465

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/141 (37%), Positives = 76/141 (53%), Gaps = 12/141 (8%)

Query: 74  LQSTVFIHKLYNILEDDDLKDLIWWSP-SGLSFLIRPIE-KFS-RALATYFKHTNIASFV 130
           +Q   FIH+L++IL++ DL +LI WSP     FL++P +  FS + L  YFKH NI+SFV
Sbjct: 1   MQPRTFIHQLHSILQEPDLHNLICWSPMENNIFLLKPHDPNFSTQVLKRYFKHGNISSFV 60

Query: 131 RQLNMYGFHKV-SNDH--GKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHS 187
           RQL+MYGFHK+ S++H    ++                       A V+     W F H 
Sbjct: 61  RQLHMYGFHKLPSHNHMTNSTANTTTTATTINNNDMNFENRDKDKASVE-----WHFTHP 115

Query: 188 TGLFKR-GDIEGLKYIKRRSS 207
           +G F R  D   L  I+R+S+
Sbjct: 116 SGHFYRDADASTLNKIQRKSA 136

>CAGL0F08195g Chr6 (813050..814027) [978 bp, 325 aa] {ON} some
           similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249w MGA1
          Length = 325

 Score = 74.3 bits (181), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 67/137 (48%), Gaps = 18/137 (13%)

Query: 74  LQSTVFIHKLYNILEDDDLKDLIWWSPS--GLSFLIRPI--EKFSRALATYFKHTNIASF 129
           +Q   F+H+L++IL D  L  +I W+    G  FL++P   E     L  YFKH N++SF
Sbjct: 1   MQHKTFVHQLHSILSDPTLTGIINWNDDEIGTVFLLKPYHPEFCDNVLKRYFKHGNVSSF 60

Query: 130 VRQLNMYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTG 189
           VRQL+MYGFHKV N+   S  ++                    +  +    IWKF H +G
Sbjct: 61  VRQLHMYGFHKVGNNSVNSHINN-------------IEGNKIVSKKEPHFIIWKFSHPSG 107

Query: 190 LFKR-GDIEGLKYIKRR 205
            F R    E L  I R+
Sbjct: 108 NFHRESSYETLCKITRK 124

>KNAG0F02020 Chr6 complement(384620..386935) [2316 bp, 771 aa] {ON}
           Anc_6.209 YGL073W
          Length = 771

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 46/67 (68%), Gaps = 1/67 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSR-ALATYFKHTNIASFVRQLNMY 136
            F++KL+++L D    DLI W+  G SF++   EKF    L  YFKH+N ASFVRQLNMY
Sbjct: 168 AFVNKLWSMLNDQANLDLIRWADDGKSFIVTNREKFVHDILPKYFKHSNFASFVRQLNMY 227

Query: 137 GFHKVSN 143
           G+HKV +
Sbjct: 228 GWHKVQD 234

>YGL073W Chr7 (368753..371254) [2502 bp, 833 aa] {ON}  HSF1Trimeric
           heat shock transcription factor, activates multiple
           genes in response to stresses that include hyperthermia;
           recognizes variable heat shock elements (HSEs)
           consisting of inverted NGAAN repeats;
           posttranslationally regulated
          Length = 833

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 46/65 (70%), Gaps = 1/65 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQLNMY 136
            F++KL+++L DD    LI W+  G SF++   E+F  + L  YFKH+N ASFVRQLNMY
Sbjct: 174 AFVNKLWSMLNDDSNTKLIQWAEDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMY 233

Query: 137 GFHKV 141
           G+HKV
Sbjct: 234 GWHKV 238

>TDEL0G01010 Chr7 complement(209613..210809) [1197 bp, 398 aa] {ON}
           Anc_5.77 YGR249W
          Length = 398

 Score = 74.7 bits (182), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 71/135 (52%), Gaps = 26/135 (19%)

Query: 79  FIHKLYNILEDDDLKDLI-WWSPSGLSFLIRPIEK-FSR-ALATYFKHTNIASFVRQLNM 135
           FIH+LY IL++  L++ I W+      F+++P +  FS+  L  YFKH N++SFVRQL+M
Sbjct: 6   FIHQLYAILQESQLQEWISWFKDDDSVFVLKPHDGGFSKYVLRRYFKHGNVSSFVRQLHM 65

Query: 136 YGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKI--WKFRHSTGLFKR 193
           YGFHK++N      E                      +D Q D     W F H  G F++
Sbjct: 66  YGFHKITNPQEGLGE--------------------GRSDEQGDRATTRWFFAHPLGYFRK 105

Query: 194 -GDIEGLKYIKRRSS 207
             D+  LK I+R+S+
Sbjct: 106 DADLASLKKIQRKST 120

>Smik_7.209 Chr7 (363136..365649) [2514 bp, 837 aa] {ON} YGL073W
           (REAL)
          Length = 837

 Score = 75.9 bits (185), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 46/65 (70%), Gaps = 1/65 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQLNMY 136
            F++KL+++L DD    LI W+  G SF++   E+F  + L  YFKH+N ASFVRQLNMY
Sbjct: 175 AFVNKLWSMLNDDSNTKLIQWAKDGKSFIVTNREEFVHQILPKYFKHSNFASFVRQLNMY 234

Query: 137 GFHKV 141
           G+HKV
Sbjct: 235 GWHKV 239

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
           Anc_4.385 YJR147W
          Length = 510

 Score = 74.3 bits (181), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 48/139 (34%), Positives = 67/139 (48%), Gaps = 41/139 (29%)

Query: 75  QSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQL 133
           Q   F+ K+Y+ILE  +  +++ W+ +G SF++    KF S+ L  +FKH+N ASFVRQL
Sbjct: 47  QQNEFVRKIYSILEGGEYPEIVTWTEAGDSFVVVDTGKFTSQILPNHFKHSNFASFVRQL 106

Query: 134 NMYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWK-------FRH 186
           N Y FHKV                                  QE+ K+W+       F+H
Sbjct: 107 NKYDFHKVKR-------------------------------TQEERKVWQYGELSWEFKH 135

Query: 187 STGLFKRGDIEGLKYIKRR 205
              LFKRG  E L  IKR+
Sbjct: 136 P--LFKRGQEENLDNIKRK 152

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON}
           Anc_4.385 YJR147W
          Length = 545

 Score = 74.3 bits (181), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 47/67 (70%), Gaps = 1/67 (1%)

Query: 76  STVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFVRQLN 134
           S  F+ KLYNILE+++  D++ W+  G SF++    KF+ + L  +FKH+N ASFVRQLN
Sbjct: 58  SNEFVRKLYNILENNEYPDIVRWTARGDSFVVLDTGKFTTKILPNHFKHSNFASFVRQLN 117

Query: 135 MYGFHKV 141
            Y FHK+
Sbjct: 118 KYDFHKI 124

>TBLA0G02700 Chr7 (710230..711567) [1338 bp, 445 aa] {ON} 
          Length = 445

 Score = 73.9 bits (180), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 35/66 (53%), Positives = 48/66 (72%), Gaps = 1/66 (1%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSR-ALATYFKHTNIASFVRQLNMYG 137
           F++KL+N+L++   +D+I W+  G SFL+   EKF    L  YFKH+N ASFVRQLNMYG
Sbjct: 121 FVNKLWNMLKEPINQDMIRWNDDGKSFLVVNREKFVHHVLPNYFKHSNFASFVRQLNMYG 180

Query: 138 FHKVSN 143
           +HKV +
Sbjct: 181 WHKVQD 186

>Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W
           (REAL)
          Length = 846

 Score = 74.3 bits (181), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 1/65 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQLNMY 136
            F++KL+++L DD    LI W+  G SF++   E+F    L  YFKH+N ASFVRQLNMY
Sbjct: 175 AFVNKLWSMLNDDSNTKLIQWALDGKSFIVTNREEFVHEILPKYFKHSNFASFVRQLNMY 234

Query: 137 GFHKV 141
           G+HKV
Sbjct: 235 GWHKV 239

>TDEL0E05170 Chr5 (951579..953219) [1641 bp, 546 aa] {ON} Anc_6.209
           YGL073W
          Length = 546

 Score = 73.6 bits (179), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 49/67 (73%), Gaps = 1/67 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQLNMY 136
            F++K++++L D+   +LI WS  G SF++   E+F  + L  YFKH+N+ASFVRQLNMY
Sbjct: 119 AFVNKVWSMLNDESNVNLIQWSKDGKSFIVVNREEFVHQILPKYFKHSNLASFVRQLNMY 178

Query: 137 GFHKVSN 143
           G+HKV +
Sbjct: 179 GWHKVQD 185

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           some similarites with YHR206W uniprot|P38889
           Saccharomyces cerevisiae
          Length = 475

 Score = 72.8 bits (177), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 63/130 (48%), Gaps = 29/130 (22%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSR-ALATYFKHTNIASFVRQLNMYG 137
           F+ KL+ ILE ++   +I WSP G +F++    KF+   L  +FKH+N ASFVRQLN Y 
Sbjct: 43  FVRKLFLILESEEYTSIISWSPDGKNFIVLDTNKFTTDILPKHFKHSNFASFVRQLNKYD 102

Query: 138 FHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGLFKRGDIE 197
           FHKV     + SE                        +Q     W+F H    F+R D  
Sbjct: 103 FHKVKRKKNEVSE-----------------------GIQ---NAWEFNHQ--YFRRHDEA 134

Query: 198 GLKYIKRRSS 207
           GL  I+R+ S
Sbjct: 135 GLDNIRRKPS 144

>KLLA0A05368g Chr1 complement(490032..491270) [1239 bp, 412 aa] {ON}
           weakly similar to uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 412

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 71/137 (51%), Gaps = 12/137 (8%)

Query: 74  LQSTVFIHKLYNILEDDDLKDLIWWSPSGLS-FLIRP-IEKFS-RALATYFKHTNIASFV 130
           + S  FIH+L++IL  D+L + I WS    S F+I+P    FS + L  +FKH N++SFV
Sbjct: 1   MHSKTFIHQLHHILMQDELIEWIRWSEDDESMFIIKPNAPNFSSKVLKRFFKHGNVSSFV 60

Query: 131 RQLNMYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGL 190
           RQL+MYGFHK+   H  SS                       A  + +I+ WKF H +  
Sbjct: 61  RQLHMYGFHKL--PHSASS-----TLAASGADNNGATASTNNATSKSEIE-WKFTHHSHD 112

Query: 191 FKRGDIEG-LKYIKRRS 206
           F +   E  LK I R+S
Sbjct: 113 FCKSASEAQLKRIHRKS 129

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
           [1650 nt, 550 aa]
          Length = 549

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 66/136 (48%), Gaps = 31/136 (22%)

Query: 75  QSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQL 133
           QS  F+ K+Y ILE  D  D++ W+ +G SF++     F S+ L  +FKH+N ASFVRQL
Sbjct: 83  QSNEFVRKIYGILERGDYPDIVRWTENGDSFVVLDTGSFTSQILPNHFKHSNFASFVRQL 142

Query: 134 NMYGFHKV--SNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGLF 191
           N Y FHKV  + +  K+ ++                              W+F H   LF
Sbjct: 143 NKYDFHKVKRTQEERKACQYGELS--------------------------WEFNHP--LF 174

Query: 192 KRGDIEGLKYIKRRSS 207
           KR     L  IKR+++
Sbjct: 175 KRNQEANLDNIKRKAA 190

>ZYRO0C11506g Chr3 (891756..892760) [1005 bp, 334 aa] {ON} some
           similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W
          Length = 334

 Score = 71.6 bits (174), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 36/74 (48%), Positives = 51/74 (68%), Gaps = 5/74 (6%)

Query: 74  LQSTVFIHKLYNILEDDDLKDLIWWSPS--GLSFLIRPIEKF--SRALATYFKHTNIASF 129
           + +  FIH+L+ IL D  L + I WS    G+ F++RP +K+  +  L  YFKH N++SF
Sbjct: 1   MHTKTFIHQLHAILNDATLAEWIRWSDDQDGV-FVLRPYDKWFSTLVLKRYFKHGNVSSF 59

Query: 130 VRQLNMYGFHKVSN 143
           VRQL+MYGFHK+SN
Sbjct: 60  VRQLHMYGFHKLSN 73

>Skud_7.582 Chr7 (962776..964134) [1359 bp, 452 aa] {ON} YGR249W
           (REAL)
          Length = 452

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 74/138 (53%), Gaps = 24/138 (17%)

Query: 74  LQSTVFIHKLYNILEDDDLKDLIWWSPS-GLSFLIRPIE-KFS-RALATYFKHTNIASFV 130
           +Q   F+H+L++IL + ++   I+WS +  + F ++P +  FS + L  YFKH N+ SFV
Sbjct: 1   MQPKTFVHQLHSILLEPEVNKWIYWSSTDNVVFFLKPYDPNFSTQVLKRYFKHGNVNSFV 60

Query: 131 RQLNMYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTG- 189
           RQL+MYGFHK+S+   + +                        + +E ++ WKF H +G 
Sbjct: 61  RQLHMYGFHKLSHPSPEQAS-------------------ASNGNAKELVE-WKFTHPSGF 100

Query: 190 LFKRGDIEGLKYIKRRSS 207
            FK  +   L  I+R+S+
Sbjct: 101 FFKEANAGILNKIQRKST 118

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON}
           Anc_4.385
          Length = 609

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 63/128 (49%), Gaps = 33/128 (25%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSR-ALATYFKHTNIASFVRQLNMYG 137
           F+ KLY ILE +   D++ W+ +G +F++    KF+   L  +FKH+N ASFVRQLN Y 
Sbjct: 56  FVRKLYTILEKNAYPDIVRWTENGDTFVVLDTGKFTEDILPNHFKHSNFASFVRQLNKYD 115

Query: 138 FHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGLFKRGDIE 197
           FHK+                                DV+   + W+F+H +  F+R   E
Sbjct: 116 FHKIK---------------------------KKVTDVE---RSWEFKHPS--FRRHFDE 143

Query: 198 GLKYIKRR 205
           GL  IKR+
Sbjct: 144 GLDNIKRK 151

>KLTH0H04290g Chr8 complement(387890..389599) [1710 bp, 569 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 569

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 49/79 (62%), Gaps = 6/79 (7%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQLNMY 136
            F++KL++++ D   + LI WS  G SF+I   E F    L  YFKH+N ASFVRQLNMY
Sbjct: 160 AFVNKLWSMVNDSANQKLIHWSADGKSFVITNREHFVHEILPKYFKHSNFASFVRQLNMY 219

Query: 137 GFHKVSN-----DHGKSSE 150
           G+HKV +      HG S E
Sbjct: 220 GWHKVQDVRSGSIHGNSDE 238

>SAKL0A04576g Chr1 complement(422093..423766) [1674 bp, 557 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 557

 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (68%), Gaps = 1/67 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFVRQLNMY 136
            F++KL++++ D   + LI WS  G SF++   E+F    L  YFKH+N ASFVRQLNMY
Sbjct: 165 AFVNKLWSMVNDTSNQKLIHWSKDGKSFIVTKREQFVHEILPKYFKHSNFASFVRQLNMY 224

Query: 137 GFHKVSN 143
           G+HKV +
Sbjct: 225 GWHKVQD 231

>TPHA0H01130 Chr8 (250116..251435) [1320 bp, 439 aa] {ON} Anc_5.77
           YGR249W
          Length = 439

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 74/147 (50%), Gaps = 18/147 (12%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLS-FLIRPI-EKFS-RALATYFKHTNIASFVRQLN 134
            F+H+L++IL  ++L + I+W+    + F I+P   +FS + L  YFKH N++SFVRQL+
Sbjct: 5   TFLHQLFSILAQENLNEWIYWTEDDDAVFAIKPYASQFSAKILKGYFKHGNVSSFVRQLH 64

Query: 135 MYGFHKVSNDHGKS-------------SEHDXXXXXXXXXXXXXXXXXXXXADVQEDIK- 180
           MYGFHK+SN + +S             +  D                    A  Q+  K 
Sbjct: 65  MYGFHKLSNSNNRSKCQVSFLGVDNSLTASDPKIEPESPEFGKYKEKMSRPALPQDRAKT 124

Query: 181 IWKFRHSTGLF-KRGDIEGLKYIKRRS 206
           IW F H +G+F K  +   L  I R+S
Sbjct: 125 IWYFTHPSGVFHKNAETSDLDKIHRKS 151

>ZYRO0G08734g Chr7 (704684..706402) [1719 bp, 572 aa] {ON} similar
           to uniprot|P10961 Saccharomyces cerevisiae YGL073W HSF1
           Trimeric heat shock transcription factor activates
           multiple genes in response to hyperthermia recognizes
           variable heat shock elements
          Length = 572

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 49/67 (73%), Gaps = 1/67 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQLNMY 136
           +F++K++++L D+   +LI W+  G SF++   E+F  + L  YFKH+N ASFVRQLNMY
Sbjct: 112 LFVNKVWSMLNDESNGNLIRWAEDGKSFVVVNREEFVHQVLPKYFKHSNFASFVRQLNMY 171

Query: 137 GFHKVSN 143
           G+HKV +
Sbjct: 172 GWHKVQD 178

>Kwal_56.24036 s56 (822498..824201) [1704 bp, 567 aa] {ON} YGL073W
           (HSF1) - heat shock transcription factor [contig 166]
           FULL
          Length = 567

 Score = 72.0 bits (175), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 34/67 (50%), Positives = 45/67 (67%), Gaps = 1/67 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQLNMY 136
            F++KL++++ D   + LI WS  G SF+I   E F    L  YFKH+N ASFVRQLNMY
Sbjct: 159 AFVNKLWSMVNDSANQKLIHWSSDGKSFIITNREHFVHEILPKYFKHSNFASFVRQLNMY 218

Query: 137 GFHKVSN 143
           G+HKV +
Sbjct: 219 GWHKVQD 225

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
           response regulator and transcription factor; physically
           interacts with the Tup1-Cyc8 complex and recruits Tup1p
           to its targets; part of a branched two-component
           signaling system; required for optimal induction of
           heat-shock genes in response to oxidative stress;
           involved in osmoregulation
          Length = 622

 Score = 72.0 bits (175), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 1/64 (1%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFVRQLNMYG 137
           F+ KL+ ILE+++  D++ W+ +G SF++    KF+   L  +FKH+N ASFVRQLN Y 
Sbjct: 87  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 146

Query: 138 FHKV 141
           FHKV
Sbjct: 147 FHKV 150

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
           (REAL)
          Length = 625

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 1/64 (1%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFVRQLNMYG 137
           F+ KL+ ILE+++  D++ W+ +G SF++    KF+   L  +FKH+N ASFVRQLN Y 
Sbjct: 88  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 147

Query: 138 FHKV 141
           FHKV
Sbjct: 148 FHKV 151

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
           (REAL)
          Length = 623

 Score = 71.6 bits (174), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 1/64 (1%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFVRQLNMYG 137
           F+ KL+ ILE+++  D++ W+ +G SF++    KF+   L  +FKH+N ASFVRQLN Y 
Sbjct: 87  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 146

Query: 138 FHKV 141
           FHKV
Sbjct: 147 FHKV 150

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar
           to uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
           transcription factor
          Length = 630

 Score = 71.2 bits (173), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 1/64 (1%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFVRQLNMYG 137
           F+ KL+NILE +   +++ WS +G SF++    KF+ + L  +FKH+N ASFVRQLN Y 
Sbjct: 77  FVRKLFNILESNQYSNIVRWSNTGDSFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 136

Query: 138 FHKV 141
           FHK+
Sbjct: 137 FHKI 140

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
           to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
           weakly similar to YHR206W uniprot|P38889 Saccharomyces
           cerevisiae
          Length = 465

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFVRQLNMYG 137
           F+ KL+NILE  +  D++ W+ +G SF++     F+ + L  +FKH+N ASFVRQLN Y 
Sbjct: 26  FVRKLFNILEGGEYTDIVCWTETGDSFVVLNTNDFTTKILPKHFKHSNFASFVRQLNKYD 85

Query: 138 FHKV 141
           FHKV
Sbjct: 86  FHKV 89

>NDAI0I01110 Chr9 complement(267274..269991) [2718 bp, 905 aa] {ON}
           Anc_6.209
          Length = 905

 Score = 71.6 bits (174), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 45/65 (69%), Gaps = 1/65 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQLNMY 136
            F++K+++++ D   K LI WS  G SF+++  E F    L  YFKH+N ASFVRQLNMY
Sbjct: 265 AFVNKVWSMINDPVNKGLINWSDDGRSFIVQNRENFVHEVLPKYFKHSNFASFVRQLNMY 324

Query: 137 GFHKV 141
           G+HKV
Sbjct: 325 GWHKV 329

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
           (REAL)
          Length = 617

 Score = 70.9 bits (172), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 45/64 (70%), Gaps = 1/64 (1%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFVRQLNMYG 137
           F+ KL+ ILE+++  D++ W+ +G SF++    KF+   L  +FKH+N ASFVRQLN Y 
Sbjct: 87  FVRKLFRILENNEYPDIVTWTENGKSFVVLDTGKFTTHILPNHFKHSNFASFVRQLNKYD 146

Query: 138 FHKV 141
           FHKV
Sbjct: 147 FHKV 150

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
           Anc_4.385 YJR147W
          Length = 547

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFVRQLNMYG 137
           F+ KLY ILE  +  D++ W+ +G SF++    KF+ + L  +FKH+N ASFVRQLN Y 
Sbjct: 34  FVRKLYGILERCEYPDIVRWTETGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 93

Query: 138 FHKV 141
           FHKV
Sbjct: 94  FHKV 97

>Ecym_2208 Chr2 complement(410156..411745) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AFL085C
          Length = 529

 Score = 70.5 bits (171), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 46/67 (68%), Gaps = 1/67 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFVRQLNMY 136
            F++KL++++ D   + LI W+  G SF++   E+F    L  YFKH+N ASFVRQLNMY
Sbjct: 213 AFVNKLWSMVNDPTNQALIHWNDDGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMY 272

Query: 137 GFHKVSN 143
           G+HKV +
Sbjct: 273 GWHKVQD 279

>CAGL0H03443g Chr8 (320888..323008) [2121 bp, 706 aa] {ON} weakly
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073w HSF1
          Length = 706

 Score = 70.5 bits (171), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 33/65 (50%), Positives = 44/65 (67%), Gaps = 1/65 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQLNMY 136
            F++K+++++ D     LI WS  GLS ++   EKF    L  YFKH+N ASFVRQLNMY
Sbjct: 229 AFVNKVWSMINDPVNSHLIQWSEDGLSLIVVNREKFVHEILPKYFKHSNFASFVRQLNMY 288

Query: 137 GFHKV 141
           G+HKV
Sbjct: 289 GWHKV 293

>AFL085C Chr6 complement(279712..281421) [1710 bp, 569 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL073W
           (HSF1)
          Length = 569

 Score = 70.1 bits (170), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 46/66 (69%), Gaps = 1/66 (1%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQLNMYG 137
           F++KL++++ D   + LI WS  G SF++   E+F    L  YFKH+N ASFVRQLNMYG
Sbjct: 160 FVNKLWSMVNDPVNQSLIHWSHDGKSFIVTQREQFVHEILPKYFKHSNFASFVRQLNMYG 219

Query: 138 FHKVSN 143
           +HKV +
Sbjct: 220 WHKVQD 225

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 464

 Score = 69.7 bits (169), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 67/132 (50%), Gaps = 31/132 (23%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFVRQLNMYG 137
           F+ KL+ ILE  +  D+I W+  G SF++    +F+ + L  +FKH+N +SFVRQLN Y 
Sbjct: 30  FVRKLFKILEGAEYNDIIRWTEDGDSFVVLNTNEFTTKILPQHFKHSNFSSFVRQLNKYD 89

Query: 138 FHKV--SNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGLFKRGD 195
           FHK+  +N+  ++S++                              W+F+H    FK  D
Sbjct: 90  FHKIKRTNEEKQNSQYGEHS--------------------------WEFKHP--FFKIHD 121

Query: 196 IEGLKYIKRRSS 207
            + L  IKR+S+
Sbjct: 122 EDQLDNIKRKSA 133

>KLLA0D03322g Chr4 complement(276591..278624) [2034 bp, 677 aa] {ON}
           similar to uniprot|P10961 Saccharomyces cerevisiae
           YGL073W HSF1 Trimeric heat shock transcription factor
           activates multiple genes in response to hyperthermia
           recognizes variable heat shock elements
          Length = 677

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 32/67 (47%), Positives = 45/67 (67%), Gaps = 1/67 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQLNMY 136
            F++KL++++ D   +  I WS SG S ++   E+F    L  YFKH+N ASFVRQLNMY
Sbjct: 196 AFVNKLWSMVNDKSNEKFIHWSTSGESIVVPNRERFVQEVLPKYFKHSNFASFVRQLNMY 255

Query: 137 GFHKVSN 143
           G+HKV +
Sbjct: 256 GWHKVQD 262

>TPHA0E02880 Chr5 complement(603237..605393) [2157 bp, 718 aa] {ON}
           Anc_6.209 YGL073W
          Length = 718

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 42/65 (64%), Gaps = 1/65 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRA-LATYFKHTNIASFVRQLNMY 136
            F++K++N++ D     LI W+  G SF +   E   R  L  YFKH+N ASFVRQLNMY
Sbjct: 170 TFVNKVWNMINDPSNNQLIQWADDGKSFFVTNKEDLIREILPKYFKHSNFASFVRQLNMY 229

Query: 137 GFHKV 141
           G+HK+
Sbjct: 230 GWHKI 234

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
           similar to uniprot|P38889 Saccharomyces cerevisiae
           YHR206W
          Length = 647

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFVRQLNMYG 137
           F+ KL+ ILE  +  D++ W+  G SF++    KF+ + L  +FKH+N ASFVRQLN Y 
Sbjct: 44  FVRKLFGILERCEYPDIVRWTEKGESFVVLDTGKFTTQILPNHFKHSNFASFVRQLNKYD 103

Query: 138 FHKV 141
           FHKV
Sbjct: 104 FHKV 107

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
           Ashbya gossypii ADL388W
          Length = 496

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 64/137 (46%), Gaps = 43/137 (31%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFVRQLNMYG 137
           F+ KL+ ILE  +  ++I W+  G SF++    +F+   L  +FKH+N +SFVRQLN Y 
Sbjct: 43  FVRKLFAILESGEYTNIISWTKDGNSFVVVDTNEFTTNILPKHFKHSNFSSFVRQLNKYD 102

Query: 138 FHKV--------SNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTG 189
           FHKV        ++D+GK S                                W+F+H   
Sbjct: 103 FHKVKRTPEERQNSDYGKHS--------------------------------WEFQHPK- 129

Query: 190 LFKRGDIEGLKYIKRRS 206
            F+R D   L  IKR++
Sbjct: 130 -FRRSDEAALDRIKRKT 145

>KNAG0K00470 Chr11 complement(79664..80908) [1245 bp, 414 aa] {ON}
           Anc_5.77 YGR249W
          Length = 414

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 49/71 (69%), Gaps = 3/71 (4%)

Query: 74  LQSTVFIHKLYNILEDDDLKDLIWWSPS-GLSFLIRPIEK-FSR-ALATYFKHTNIASFV 130
           +Q   F+HKL++IL++  + +LI WS     +F ++P +  F+   L  YFKH N++SFV
Sbjct: 1   MQIKTFVHKLHSILQEPGISNLIAWSDKYDGAFCLKPYDADFANLVLKRYFKHGNVSSFV 60

Query: 131 RQLNMYGFHKV 141
           RQL+MYGFHK+
Sbjct: 61  RQLHMYGFHKI 71

>AEL216C Chr5 complement(228433..229785) [1353 bp, 450 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR249W
           (MGA1)
          Length = 450

 Score = 67.8 bits (164), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/137 (30%), Positives = 66/137 (48%), Gaps = 14/137 (10%)

Query: 74  LQSTVFIHKLYNILEDDDLKDLIWWSPSGLS-FLIRPIE-KF-SRALATYFKHTNIASFV 130
           +Q   FIH+L+++L D  L+  I WS      F ++P + +F    L   FKH N++SFV
Sbjct: 1   MQPKTFIHQLHHMLSDRSLETWIRWSAEDDHIFCLKPYDPEFPGTVLKKNFKHGNVSSFV 60

Query: 131 RQLNMYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGL 190
           RQL++YGFHK+    G +S                           ++  +W F H +G 
Sbjct: 61  RQLHLYGFHKLQTGPGAASS----------GPAGDNEPPTHIIKSNKESMVWYFTHPSGY 110

Query: 191 FKRGDIE-GLKYIKRRS 206
           F +G  +  L  I+R+S
Sbjct: 111 FYKGACQPDLARIQRKS 127

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
           Anc_4.385 YJR147W
          Length = 615

 Score = 67.8 bits (164), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (64%), Gaps = 3/71 (4%)

Query: 72  PPLQSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFV 130
           PP  S  F+ KL+ ILE +   +++ W+  G SF++    KF+ + L  +FKH+N ASFV
Sbjct: 73  PP--SNEFVRKLFKILESNIYSNIVRWTEEGDSFVVLDTGKFTTQILPNHFKHSNFASFV 130

Query: 131 RQLNMYGFHKV 141
           RQLN Y FHKV
Sbjct: 131 RQLNKYDFHKV 141

>KLTH0H00814g Chr8 complement(90962..92134) [1173 bp, 390 aa] {ON}
           some similarities with uniprot|P53050 Saccharomyces
           cerevisiae YGR249W MGA1 Protein similar to heat shock
           transcription factor; multicopy suppressor of
           pseudohyphal growth defects of ammonium permease mutants
          Length = 390

 Score = 66.2 bits (160), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 50/75 (66%), Gaps = 7/75 (9%)

Query: 74  LQSTVFIHKLYNILEDDDLKDLIWWSPS----GLSFLIRPIEK-FS-RALATYFKHTNIA 127
           +Q+  FIH+L+ IL+  +L+  I W P     G+ F +RP +  FS   L  YFKH N++
Sbjct: 1   MQNKTFIHQLHAILQQPELERWIRWEPDEQLRGV-FSLRPHDAAFSTNVLKRYFKHGNVS 59

Query: 128 SFVRQLNMYGFHKVS 142
           SFVRQL+MYGFHK++
Sbjct: 60  SFVRQLHMYGFHKLA 74

>NCAS0D03780 Chr4 (702461..704743) [2283 bp, 760 aa] {ON} Anc_6.209
          Length = 760

 Score = 67.0 bits (162), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 44/67 (65%), Gaps = 1/67 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQLNMY 136
            F++KL++++ D+    LI WS  G SF++     F    L  YFKH+N ASFVRQLNMY
Sbjct: 196 AFVNKLWSMVNDEANHPLIQWSDDGKSFVVTNRGSFVHEILPKYFKHSNFASFVRQLNMY 255

Query: 137 GFHKVSN 143
           G+HK+ +
Sbjct: 256 GWHKIQD 262

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
           (HMS2)
          Length = 482

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 62/131 (47%), Gaps = 31/131 (23%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFVRQLNMYG 137
           F+ KL+ ILE  +  D+I W+  G SF++    +F+   L  +FKH+N +SFVRQLN Y 
Sbjct: 38  FVRKLFAILESGEYTDIISWTKEGNSFVVVDTNEFTTNILPKHFKHSNFSSFVRQLNKYD 97

Query: 138 FHKVSN--DHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGLFKRGD 195
           FHKV    +  +SS +                              W+F+H    F+R D
Sbjct: 98  FHKVKRTPEERQSSVYGEHS--------------------------WEFQHPR--FRRND 129

Query: 196 IEGLKYIKRRS 206
              L  IKR++
Sbjct: 130 EAALDRIKRKT 140

>NDAI0B00940 Chr2 complement(218385..219965) [1581 bp, 526 aa] {ON}
           Anc_5.77 YGR249W
          Length = 526

 Score = 66.6 bits (161), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 70/138 (50%), Gaps = 21/138 (15%)

Query: 74  LQSTVFIHKLYNILEDDDLKDLI-WWSPSGLSFLIRPIE-KFS-RALATYFKHTNIASFV 130
           +Q   F+++L+ IL+   L   I W+S     FL++P +  FS + L  YFKH NI+SFV
Sbjct: 1   MQQRNFVNQLHLILQQKGLHQWIRWYSIEKSIFLLKPYDPNFSEKVLKKYFKHGNISSFV 60

Query: 131 RQLNMYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDIKIWKFRHSTGL 190
           RQL+MYGFHK+S++   +S  +                            IW F H +G 
Sbjct: 61  RQLHMYGFHKISSNDLPNSILNSNPNPNNRINT-----------------IWYFAHPSGF 103

Query: 191 FKRGDI-EGLKYIKRRSS 207
           F +    E LK I+R+S+
Sbjct: 104 FTQTSTNEILKKIQRKST 121

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
           (SKN7) - transcription factor involved in oxidative
           stress response [contig 376] FULL
          Length = 461

 Score = 66.2 bits (160), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 43/64 (67%), Gaps = 1/64 (1%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFS-RALATYFKHTNIASFVRQLNMYG 137
           F+ KL+ ILE  +  D+I W+  G SF++    +F+ + L  +FKH+N +SFVRQLN Y 
Sbjct: 29  FVRKLFKILEGGEYTDIIRWTADGDSFVVLNTNEFTTKILPQHFKHSNFSSFVRQLNKYD 88

Query: 138 FHKV 141
           FHK+
Sbjct: 89  FHKI 92

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON}
           Anc_4.385 YJR147W
          Length = 791

 Score = 66.6 bits (161), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 30/67 (44%), Positives = 44/67 (65%), Gaps = 1/67 (1%)

Query: 76  STVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKF-SRALATYFKHTNIASFVRQLN 134
           S +F+  L+NILED+  +++I W+  G  F++     F S  L  +F H+N ASFVRQLN
Sbjct: 32  SNLFVKTLFNILEDEKYQNIIKWTEKGDRFVVIDAGLFTSDILPIHFNHSNFASFVRQLN 91

Query: 135 MYGFHKV 141
            +GFHK+
Sbjct: 92  KFGFHKI 98

>Ecym_5573 Chr5 (1172938..1174656) [1719 bp, 572 aa] {ON} similar to
           Ashbya gossypii AEL216C
          Length = 572

 Score = 63.5 bits (153), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 68/148 (45%), Gaps = 17/148 (11%)

Query: 74  LQSTVFIHKLYNILEDDDLKDLIWWSPSGLS-FLIRPIE-KF-SRALATYFKHTNIASFV 130
           +Q   FIH+L+++L D  L+  I WS      F ++P + +F  + L   FKH N++SFV
Sbjct: 1   MQPKTFIHQLHHMLNDKSLESWIRWSAEDDHIFCLKPYDPEFPGKVLKKNFKHGNVSSFV 60

Query: 131 RQLNMYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQED-----IK----- 180
           RQL+MYGFHK+    G +  H                       +  +     IK     
Sbjct: 61  RQLHMYGFHKLQT--GPNGMHTTVNAGAGAGLPASAATAGSTTSMDNEPPTHIIKSNKES 118

Query: 181 -IWKFRHSTGLFKRGDIE-GLKYIKRRS 206
            +W F H +G F +   +  L  I+R+S
Sbjct: 119 MVWYFTHPSGYFYKDACQPDLARIQRKS 146

>Kpol_1050.79 s1050 (171402..172703) [1302 bp, 433 aa] {ON}
           (171402..172703) [1302 nt, 434 aa]
          Length = 433

 Score = 62.0 bits (149), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 62/142 (43%), Gaps = 12/142 (8%)

Query: 78  VFIHKLYNILEDDDLKDLI-WWSPSGLSFLIRPI--EKFSRALATYFKHTNIASFVRQLN 134
            F+H+L+++L   D K+ I W +     F+I P   E   + L  YFKH N +SFVRQL+
Sbjct: 3   TFVHQLFSMLNQPDYKEWIHWLNDEDSIFVITPYNQEFGDKVLKKYFKHGNFSSFVRQLH 62

Query: 135 MYGFHKVSNDHGKSSEHDXXXXXXXXXXXXXXXXXXXXADVQEDI--------KIWKFRH 186
           MYGF K+   +   S  +                     +    I          W F H
Sbjct: 63  MYGFQKLPIKNNDDSNGNVSITRGNELNNNVDIEFFNNDNPMYHIPSRPKRGSTTWHFTH 122

Query: 187 STGLFKRG-DIEGLKYIKRRSS 207
            +G F R  D+  L  I+R+SS
Sbjct: 123 PSGFFHRNSDVVTLNRIQRKSS 144

>Suva_12.241 Chr12 (384063..385112) [1050 bp, 349 aa] {ON} YJR147W
           (REAL)
          Length = 349

 Score = 53.9 bits (128), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 2/74 (2%)

Query: 76  STVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRALATYFKHT--NIASFVRQL 133
           S VF+ KL+ +L+ +   ++I W P G  F+I   ++F++ +   F  +  + ASFVRQL
Sbjct: 4   SDVFVSKLFQLLQSNAYSEIIQWLPDGTRFVIWNTDQFAKVILKRFFPSLPSFASFVRQL 63

Query: 134 NMYGFHKVSNDHGK 147
           + Y F K+   HGK
Sbjct: 64  SKYEFQKMERLHGK 77

>Skud_10.373 Chr10 (662167..663207) [1041 bp, 346 aa] {ON} YJR147W
           (REAL)
          Length = 346

 Score = 47.0 bits (110), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 23/71 (32%), Positives = 41/71 (57%), Gaps = 1/71 (1%)

Query: 78  VFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRA-LATYFKHTNIASFVRQLNMY 136
           VF+ KL+++L+ +    +I WS  G  F+I   E+F++  L  +F  ++  +FV+QL+ Y
Sbjct: 6   VFVSKLFHLLQSNAYSSIIQWSSDGSRFIIWDPEQFTKVILERFFSLSSYTAFVKQLSKY 65

Query: 137 GFHKVSNDHGK 147
            F K    H +
Sbjct: 66  SFQKTKRPHCE 76

>YJR147W Chr10 (704196..705272) [1077 bp, 358 aa] {ON}  HMS2Protein
           with similarity to heat shock transcription factors;
           overexpression suppresses the pseudohyphal filamentation
           defect of a diploid mep1 mep2 homozygous null mutant
          Length = 358

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 75  QSTVFIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRA-LATYFKHTNIASFVRQL 133
           Q  VF+ KLY++L+ +   ++I WS  G   +I   ++F++  L  +F     A+FV+QL
Sbjct: 9   QPDVFVSKLYHLLQGNAYSNIIQWSTDGSKLVIWNPDQFTKVILERFFGIHTFAAFVKQL 68

Query: 134 NMYGFHK 140
           + Y F K
Sbjct: 69  SKYNFQK 75

>Smik_10.442 Chr10 (693234..694277) [1044 bp, 347 aa] {ON} YJR147W
           (REAL)
          Length = 347

 Score = 40.0 bits (92), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 35/63 (55%), Gaps = 1/63 (1%)

Query: 79  FIHKLYNILEDDDLKDLIWWSPSGLSFLIRPIEKFSRA-LATYFKHTNIASFVRQLNMYG 137
           F+  L+ IL+ +    +I WS  G  F+I   ++F++  L  +F   + A+F +QL+ Y 
Sbjct: 7   FLSILFEILQGNAYSSIIQWSADGSKFIIWNPDQFTKVILERFFSIASFAAFAKQLSKYK 66

Query: 138 FHK 140
           F K
Sbjct: 67  FQK 69

>Kpol_1010.62 s1010 complement(151895..154816) [2922 bp, 973 aa]
           {ON} complement(151895..154816) [2922 nt, 974 aa]
          Length = 973

 Score = 32.0 bits (71), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 21/38 (55%), Gaps = 4/38 (10%)

Query: 540 STGNGSKRNMSILMDPLAPAPNL----MLGMSPSHPQP 573
           S   G KR MS LM P +PAPNL    +L  +P  P P
Sbjct: 464 SDAKGHKRAMSDLMKPSSPAPNLPLPELLSRTPELPTP 501

>Smik_14.73 Chr14 (127245..133904) [6660 bp, 2219 aa] {ON} YNL262W
            (REAL)
          Length = 2219

 Score = 32.0 bits (71), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 31/56 (55%), Gaps = 1/56 (1%)

Query: 381  QYRHDEALGYLKGVNMDMVH-VLELLESLVTIQTSSEPSPQEFSGLEQELLRFKAL 435
            QY  D  +  L G ++DM + +LEL++SL  +   S+ +  E   L +ELL+   L
Sbjct: 2027 QYEADYVIPVLPGSHLDMKNPLLELIKSLCHVMLLSQSTTLEIRALRKELLKIFEL 2082

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.313    0.128    0.371 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 57,096,032
Number of extensions: 2065337
Number of successful extensions: 5220
Number of sequences better than 10.0: 88
Number of HSP's gapped: 5258
Number of HSP's successfully gapped: 118
Length of query: 717
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 600
Effective length of database: 40,065,477
Effective search space: 24039286200
Effective search space used: 24039286200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 69 (31.2 bits)