Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D11242gsingletonON21721710941e-153
ZYRO0B14630g4.340ON16201853626e-39
TDEL0D007804.340ON15471873319e-35
SAKL0G17820g4.340ON15551802912e-29
YML072C (TCB3)4.340ON15451752842e-28
Suva_13.834.340ON15371752781e-27
Smik_13.684.340ON15371752744e-27
Skud_13.704.340ON15411752692e-26
AER148W4.340ON15021322674e-26
KLTH0D16654g4.340ON15401802552e-24
KAFR0I003104.340ON15051832462e-23
KLLA0B04708g4.340ON14901682444e-23
Ecym_11394.340ON14761692383e-22
Kwal_47.168954.340ON15061742373e-22
NDAI0D031304.340ON14951882303e-21
CAGL0L11440g4.340ON15301382285e-21
TPHA0B004404.340ON14551172172e-19
TBLA0E047204.340ON16811872162e-19
Kpol_1001.64.340ON14821172153e-19
NCAS0A061504.340ON15091951906e-16
NDAI0A064803.184ON31823682.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D11242g
         (217 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D11242g Chr4 (948040..948693) [654 bp, 217 aa] {ON} some si...   426   e-153
ZYRO0B14630g Chr2 (1183935..1188797) [4863 bp, 1620 aa] {ON} sim...   144   6e-39
TDEL0D00780 Chr4 complement(142296..146939) [4644 bp, 1547 aa] {...   132   9e-35
SAKL0G17820g Chr7 (1539639..1544306) [4668 bp, 1555 aa] {ON} sim...   116   2e-29
YML072C Chr13 complement(124730..129367) [4638 bp, 1545 aa] {ON}...   114   2e-28
Suva_13.83 Chr13 complement(126827..131440) [4614 bp, 1537 aa] {...   111   1e-27
Smik_13.68 Chr13 complement(122710..127323) [4614 bp, 1537 aa] {...   110   4e-27
Skud_13.70 Chr13 complement(122945..127570) [4626 bp, 1541 aa] {...   108   2e-26
AER148W Chr5 (914026..918534) [4509 bp, 1502 aa] {ON} Syntenic h...   107   4e-26
KLTH0D16654g Chr4 (1377197..1381819) [4623 bp, 1540 aa] {ON} sim...   102   2e-24
KAFR0I00310 Chr9 complement(66673..71190) [4518 bp, 1505 aa] {ON...    99   2e-23
KLLA0B04708g Chr2 complement(425404..429876) [4473 bp, 1490 aa] ...    99   4e-23
Ecym_1139 Chr1 complement(288027..292457) [4431 bp, 1476 aa] {ON...    96   3e-22
Kwal_47.16895 s47 complement(163274..167794) [4521 bp, 1506 aa] ...    96   3e-22
NDAI0D03130 Chr4 (742587..747074) [4488 bp, 1495 aa] {ON} Anc_4....    93   3e-21
CAGL0L11440g Chr12 (1215533..1220125) [4593 bp, 1530 aa] {ON} si...    92   5e-21
TPHA0B00440 Chr2 complement(93810..98177) [4368 bp, 1455 aa] {ON...    88   2e-19
TBLA0E04720 Chr5 (1202311..1207356) [5046 bp, 1681 aa] {ON} Anc_...    88   2e-19
Kpol_1001.6 s1001 complement(20699..25147) [4449 bp, 1482 aa] {O...    87   3e-19
NCAS0A06150 Chr1 (1212220..1216749) [4530 bp, 1509 aa] {ON}            78   6e-16
NDAI0A06480 Chr1 complement(1472312..1473268) [957 bp, 318 aa] {...    31   2.3  

>ZYRO0D11242g Chr4 (948040..948693) [654 bp, 217 aa] {ON} some
           similarities with uniprot|Q03640 Saccharomyces
           cerevisiae YML072C TCB3 Contains three calcium and lipid
           binding domains localized to the bud green fluorescent
           protein (GFP)-fusion protein localizes to the cell
           periphery mRNA is targeted to the bud via the mRNA
           transport system involving She2p C-terminal portion of
           Tcb1p Tcb2p and Tcb3p interact
          Length = 217

 Score =  426 bits (1094), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 206/217 (94%), Positives = 206/217 (94%)

Query: 1   MRVRDTKMSLDFDPSIPNTDTAVVQVLDPESLRPVNAGTAVSNRTQAVLRRSRDESVNAE 60
           MRVRDTKMSLDFDPSIPNTDTAVVQVLDPESLRPVNAGTAVSNRTQAVLRRSRDESVNAE
Sbjct: 1   MRVRDTKMSLDFDPSIPNTDTAVVQVLDPESLRPVNAGTAVSNRTQAVLRRSRDESVNAE 60

Query: 61  LNLHPGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKGIAYYEETF 120
           LNLHPGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKGIAYYEETF
Sbjct: 61  LNLHPGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKGIAYYEETF 120

Query: 121 GFQAPPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGIVNFRLNYX 180
           GFQAPPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGIVNFRLNY 
Sbjct: 121 GFQAPPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGIVNFRLNYP 180

Query: 181 XXXXXXXXXXQHFLSDYRYPDDESQYEEKMYGKNVVV 217
                     QHFLSDYRYPDDESQYEEKMYGKNVVV
Sbjct: 181 VAEVEEEPEAQHFLSDYRYPDDESQYEEKMYGKNVVV 217

>ZYRO0B14630g Chr2 (1183935..1188797) [4863 bp, 1620 aa] {ON} similar
            to uniprot|Q03640 Saccharomyces cerevisiae YML072C TCB3
            Contains three calcium and lipid binding domains
            localized to the bud green fluorescent protein
            (GFP)-fusion protein localizes to the cell periphery mRNA
            is targeted to the bud via the mRNA transport system
            involving She2p C-terminal portion of Tcb1p Tcb2p and
            Tcb3p interact
          Length = 1620

 Score =  144 bits (362), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 77/185 (41%), Positives = 112/185 (60%), Gaps = 10/185 (5%)

Query: 5    DTKMSLDFDPSIPNTDTAVVQVLDPESLRPVNA---GTAVSNRTQAVLRR-------SRD 54
            + K SLD D S+PN D A+VQ LDP+S  PV        +SN   +VL         S+D
Sbjct: 1417 NAKKSLDVDRSVPNLDYALVQELDPKSHLPVGGDDLSARLSNHVPSVLSGPVERKSFSKD 1476

Query: 55   ESVNAELNLHPGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKGIA 114
                   NL PGTNY G+LT +S +++  K +L++ L+ NGK+K L+++K  + D+ G A
Sbjct: 1477 RGDGIHKNLQPGTNYQGQLTLISTDRVAPKLQLNIGLSVNGKVKHLYKSKTQKEDEGGNA 1536

Query: 115  YYEETFGFQAPPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGIVN 174
             + E+F F+ PPE SL+F   S+H + +D  LGIA+IPL+DP +  G  I+ NL +G V 
Sbjct: 1537 TFNESFAFRGPPEGSLVFEAISHHRLTKDIELGIAEIPLNDPQIQIGGNINLNLGEGTVV 1596

Query: 175  FRLNY 179
            FR +Y
Sbjct: 1597 FRTDY 1601

>TDEL0D00780 Chr4 complement(142296..146939) [4644 bp, 1547 aa] {ON}
            Anc_4.340 YML072C
          Length = 1547

 Score =  132 bits (331), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 69/187 (36%), Positives = 114/187 (60%), Gaps = 8/187 (4%)

Query: 1    MRVRDTKMSLDFDPSIPNTDTAVVQVLDPESLRPVNAGTAV------SNRTQAVLRRSRD 54
            +   + + SLD D ++PN D A VQ LDP +  P + G         ++ TQ+  + +R+
Sbjct: 1342 LSFSEVRASLDADRTVPNNDYAPVQSLDPNTQLPASDGPDARDSSNGNSSTQSYNQHTRN 1401

Query: 55   ESVNAEL--NLHPGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKG 112
             S  +     L P   Y G +T ++ E+LG+  ++ VSLA  G++K L++TK  + D+KG
Sbjct: 1402 TSTASSFARTLAPNGTYRGSVTILATEQLGKNVQVKVSLAQGGRLKQLYKTKNQKVDEKG 1461

Query: 113  IAYYEETFGFQAPPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGI 172
            IA ++ET  F+A P+A+L+FG TS+H + +D  +GIAQI L+DP + +G  I+  L +G 
Sbjct: 1462 IARFDETCAFKASPQANLVFGVTSHHKLTKDREIGIAQITLNDPQLQQGDQIAVKLAEGK 1521

Query: 173  VNFRLNY 179
            V F+++Y
Sbjct: 1522 VLFKIDY 1528

>SAKL0G17820g Chr7 (1539639..1544306) [4668 bp, 1555 aa] {ON} similar
            to uniprot|Q03640 Saccharomyces cerevisiae YML072C TCB3
            Contains three calcium and lipid binding domains
            localized to the bud green fluorescent protein
            (GFP)-fusion protein localizes to the cell periphery mRNA
            is targeted to the bud via the mRNA transport system
            involving She2p C-terminal portion of Tcb1p Tcb2p and
            Tcb3p interact
          Length = 1555

 Score =  116 bits (291), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 64/180 (35%), Positives = 102/180 (56%), Gaps = 7/180 (3%)

Query: 7    KMSLDFDPSIPNTDTAVVQVLDPE-----SLRPVNAG--TAVSNRTQAVLRRSRDESVNA 59
            + SLDFDPS+PNT  A VQ          S  P N+G  ++++     + +R+   + + 
Sbjct: 1359 RSSLDFDPSVPNTSYASVQPPAQPPAHPTSPSPPNSGENSSIAGSAGPIHKRNASSASSF 1418

Query: 60   ELNLHPGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKGIAYYEET 119
               L P   Y G +T V  E LG+  ++ VSLA  G+IK L+RT+  + ++KG+A + E+
Sbjct: 1419 ARTLAPNGTYKGTITIVGAENLGKAVQVRVSLAQGGRIKHLYRTENQKSNEKGVAEFNES 1478

Query: 120  FGFQAPPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGIVNFRLNY 179
              F+A PEA+L+FG  S+H   +D  LG+AQI L DP + +   ++  L KG +  ++ Y
Sbjct: 1479 CTFKASPEANLVFGAVSHHKFSKDTDLGVAQINLGDPQIQQEGQVAIKLGKGHLVLKIEY 1538

>YML072C Chr13 complement(124730..129367) [4638 bp, 1545 aa] {ON}
            TCB3Lipid-binding ER protein, enriched at ER-plasma
            membrane contact sites; localized to the bud via specific
            mRNA transport; non-tagged protein detected in a
            phosphorylated state in mitochondria; C-termini of Tcb1p,
            Tcb2p and Tcb3p interact
          Length = 1545

 Score =  114 bits (284), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 99/175 (56%), Gaps = 3/175 (1%)

Query: 7    KMSLDFDPSIPNTDTAVVQVLDPESLRPVNAGTAVSNRTQAVLRRSRDESVNAEL--NLH 64
            + SLD+DPS+PNT  A VQ   P  ++P +  ++ SN+       SR  S  +     L 
Sbjct: 1352 RASLDYDPSVPNTSYAPVQSASP-VVKPTDNTSSSSNKKDTPSSNSRGHSRASSFARTLA 1410

Query: 65   PGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKGIAYYEETFGFQA 124
            P   Y G +T V+ E + +  ++ +SL   G++K +++TK+ + +  G+A ++E   F+A
Sbjct: 1411 PHGTYNGFITVVAAENVAKHVQIKISLTQGGRLKHIYKTKSQKANNDGVAVFDEECSFKA 1470

Query: 125  PPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGIVNFRLNY 179
             PEA+L+ G  S+  + RD+ LGIAQI L DP + +   IS  L  G +  ++NY
Sbjct: 1471 SPEANLVLGAISHQRLSRDKDLGIAQINLGDPQIQQDGQISVKLGDGHLIVKINY 1525

>Suva_13.83 Chr13 complement(126827..131440) [4614 bp, 1537 aa] {ON}
            YML072C (REAL)
          Length = 1537

 Score =  111 bits (278), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 103/175 (58%), Gaps = 3/175 (1%)

Query: 7    KMSLDFDPSIPNTDTAVVQVLDPESLRPVNAGTAVSNRTQAVLRRSRDESVNAEL--NLH 64
            + S+D+DPS+PNT  A VQ   P +++  +  +++SN+ +A +  SR  S  +     L 
Sbjct: 1344 RASVDYDPSVPNTSYAPVQSSSP-AVKQADNNSSLSNKKEAPINGSRAGSRASSFARTLA 1402

Query: 65   PGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKGIAYYEETFGFQA 124
            P   Y G +T ++ E + +  ++ +SL   G++K +++TK+ + +  GIA ++E   F+A
Sbjct: 1403 PHGTYNGFITVLAAENIAKHVQIKISLTQGGRLKHIYKTKSQKTNDDGIALFDEECSFKA 1462

Query: 125  PPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGIVNFRLNY 179
             PEA+L+ G  S+  + RD+ LGIAQI L DP + +   IS  L  G +  +++Y
Sbjct: 1463 SPEANLVLGAISHQRLSRDKDLGIAQINLGDPQIQQDGQISVKLGDGHLIVKISY 1517

>Smik_13.68 Chr13 complement(122710..127323) [4614 bp, 1537 aa] {ON}
            YML072C (REAL)
          Length = 1537

 Score =  110 bits (274), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 59/175 (33%), Positives = 98/175 (56%), Gaps = 3/175 (1%)

Query: 7    KMSLDFDPSIPNTDTAVVQVLDPESLRPVNAGTAVSNRTQAVLRRSRDESVNAEL--NLH 64
            + SLD+DPS+PNT  A VQ   P +++  ++ +  SN+       SR  S  +     L 
Sbjct: 1344 RASLDYDPSVPNTSYAPVQNGSP-AVKQADSNSNSSNKKDTPSSNSRGHSRASSFARTLA 1402

Query: 65   PGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKGIAYYEETFGFQA 124
            P   Y G +T V+ E + +  ++ VSL   G++K +++TK+ + +  G+A ++E   F+A
Sbjct: 1403 PNGTYNGFITVVAAENIAKHVQIKVSLTQGGRLKHIYKTKSQKANNDGVALFDEECSFKA 1462

Query: 125  PPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGIVNFRLNY 179
             PEA+L+ G  S+  + RD+ LGI QI L DP + +   IS  L  G +  ++NY
Sbjct: 1463 SPEANLVLGAISHQRLSRDKDLGIVQINLGDPQIQQDGQISVKLGDGHLIVKINY 1517

>Skud_13.70 Chr13 complement(122945..127570) [4626 bp, 1541 aa] {ON}
            YML072C (REAL)
          Length = 1541

 Score =  108 bits (269), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 99/175 (56%), Gaps = 3/175 (1%)

Query: 7    KMSLDFDPSIPNTDTAVVQVLDPESLRPVNAGTAVSNR--TQAVLRRSRDESVNAELNLH 64
            + SLD+DPS+PNT  A VQ     +++ V+  ++  N+  T +   R+   + +    L 
Sbjct: 1348 RASLDYDPSVPNTSYAAVQN-GSSAVKQVDNNSSSGNKKDTPSSTPRAHSRASSFARTLA 1406

Query: 65   PGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKGIAYYEETFGFQA 124
            P   Y G +T ++ E + +  ++ VSL   G++K +++TK+ + +  GIA ++E   F+A
Sbjct: 1407 PNGTYNGFITVIAAENIAKHVQIRVSLTQGGRLKHIYKTKSQKTNNDGIALFDEECSFKA 1466

Query: 125  PPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGIVNFRLNY 179
             PEA+L+ G  S+  + RD+ LG AQI L DP + +   IS  L  G +  ++NY
Sbjct: 1467 SPEANLVLGAISHQKLSRDKDLGFAQINLGDPQIQQDGQISVKLGDGHLIVKINY 1521

>AER148W Chr5 (914026..918534) [4509 bp, 1502 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YML072C (TCB3)
          Length = 1502

 Score =  107 bits (267), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 81/132 (61%)

Query: 48   VLRRSRDESVNAELNLHPGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQ 107
            + RR   ++     +L P + Y+G +T VS E LG+  +L +SL  +GK+K L+RT+  +
Sbjct: 1354 IPRRQLSQASVFTRSLAPNSIYSGTVTLVSAENLGKTVQLRISLTKDGKLKHLYRTEKQK 1413

Query: 108  CDKKGIAYYEETFGFQAPPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTN 167
             D  G+  ++ET  FQAPPEASLIFG  ++H   +D +LGIAQ+ L+D  + +   I   
Sbjct: 1414 ADVNGVCTFQETCDFQAPPEASLIFGAVAHHTFSKDTNLGIAQVALNDSQIRQDGQILIK 1473

Query: 168  LDKGIVNFRLNY 179
            L  G + F+L+Y
Sbjct: 1474 LGPGHLIFKLSY 1485

>KLTH0D16654g Chr4 (1377197..1381819) [4623 bp, 1540 aa] {ON} similar
            to uniprot|Q03640 Saccharomyces cerevisiae YML072C TCB3
            Contains three calcium and lipid binding domains
            localized to the bud green fluorescent protein
            (GFP)-fusion protein localizes to the cell periphery mRNA
            is targeted to the bud via the mRNA transport system
            involving She2p C-terminal portion of Tcb1p Tcb2p and
            Tcb3p interact
          Length = 1540

 Score =  102 bits (255), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 96/180 (53%), Gaps = 12/180 (6%)

Query: 7    KMSLDFDPSIPNTDTAVVQVLDPESLRPVNA-------GTAVSNRTQAVLRRSRDESVNA 59
            K+S D+D + PNT  A V     ES  P  A       G++V      + +RS   + + 
Sbjct: 1348 KLSADYDVTKPNTSYAKV-----ESYHPAPAVASKNGDGSSVVGAPGPIHQRSASTASSF 1402

Query: 60   ELNLHPGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKGIAYYEET 119
               L P   Y G++T V  E +G+  ++  SLA  GKIK ++RT+  + + +G   + E+
Sbjct: 1403 ARTLAPNGTYKGKVTLVGAENMGKALQVRFSLAQGGKIKHMYRTENKKSNSEGWVDFGES 1462

Query: 120  FGFQAPPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGIVNFRLNY 179
              F+A PEA+L+FGG + H   +D  LG+AQI L DP + +   IS  L +G +  +++Y
Sbjct: 1463 CEFKASPEANLVFGGVTVHRFGKDTELGVAQINLGDPQIQQEGQISVRLGRGHLILKIDY 1522

>KAFR0I00310 Chr9 complement(66673..71190) [4518 bp, 1505 aa] {ON}
            Anc_4.340 YML072C
          Length = 1505

 Score = 99.4 bits (246), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 61/183 (33%), Positives = 100/183 (54%), Gaps = 9/183 (4%)

Query: 4    RDTKMSLDFDPSIPNTDTAVVQ---VLDPESL--RPV--NAGTAVSNRTQAVLRRSRDES 56
            R  + S D+D SIP+   A V    V    S+  +P   + G +++   + V +RSR  S
Sbjct: 1306 RKGRTSADYDASIPDNSYAQVNQNGVAQRSSIDNQPQVDDGGYSIAGVQEIVNKRSRASS 1365

Query: 57   VNAELNLHPGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKGIAYY 116
                L+  P + Y G LT ++ E + +  +  VSLA NGKIK +++T   +  + GI   
Sbjct: 1366 FARTLS--PNSTYEGTLTIIAAEHIAKNVQFKVSLAQNGKIKSVYKTANHRAQENGIVTV 1423

Query: 117  EETFGFQAPPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGIVNFR 176
             ET  F+A PEA+L+ G  S H + +D  +GIAQI L+DP ++  + ++  L +G +  +
Sbjct: 1424 NETCAFKASPEANLVIGAISRHTLGKDRDVGIAQILLNDPQIHVEENMAVKLAEGRIIVK 1483

Query: 177  LNY 179
            +NY
Sbjct: 1484 VNY 1486

>KLLA0B04708g Chr2 complement(425404..429876) [4473 bp, 1490 aa] {ON}
            similar to uniprot|Q03640 Saccharomyces cerevisiae
            YML072C TCB3 Contains three calcium and lipid binding
            domains localized to the bud green fluorescent protein
            (GFP)-fusion protein localizes to the cell periphery mRNA
            is targeted to the bud via the mRNA transport system
            involving She2p C-terminal portion of Tcb1p Tcb2p and
            Tcb3p interact
          Length = 1490

 Score = 98.6 bits (244), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 92/168 (54%), Gaps = 2/168 (1%)

Query: 12   FDPSIPNTDTAVVQVLDPESLRPVNAGTAVSNRTQAVLRRSRDESVNAELNLHPGTNYTG 71
            FDPS+PNT  A V+     ++      +++ +   A+ +RS   + N   +  PG+ + G
Sbjct: 1308 FDPSVPNTSYASVRAQTAPTVS-AKGDSSIQDPHGAIHKRSLSAASNFSRSTIPGS-HKG 1365

Query: 72   RLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKGIAYYEETFGFQAPPEASLI 131
            + T +  E LG+  ++ VSLA  G+I+ LHRT   + D+ G+  + E   F+A  ++S++
Sbjct: 1366 KATIIGAENLGKAVQVRVSLAQGGRIRHLHRTHERKADENGVCQFNEVVDFKATGDSSIV 1425

Query: 132  FGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGIVNFRLNY 179
             G  ++H   +D  LG++QI L DP + +   ++  L  G V F++ Y
Sbjct: 1426 LGAVAHHKFSKDTELGVSQINLSDPQLQQEGQVALRLGSGHVIFKIEY 1473

>Ecym_1139 Chr1 complement(288027..292457) [4431 bp, 1476 aa] {ON}
            similar to Ashbya gossypii AER148W
          Length = 1476

 Score = 96.3 bits (238), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 92/169 (54%), Gaps = 4/169 (2%)

Query: 15   SIPNTDTAVVQVLDP---ESLRPVNAGTAVSNRTQAVLRRSRDESVNAELNLHPGTNYTG 71
            + PN    VVQ   P    S    N  T++      + +R+  ++ ++   L P   Y G
Sbjct: 1291 ATPNNSYVVVQSEPPHENSSSGGKNDTTSIGGSPGPMRKRNLSQASSSLRPLIPQNIYPG 1350

Query: 72   RLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKGIA-YYEETFGFQAPPEASL 130
            R+T +  E LG+  ++ +SLA +GK+K L+R++  + D  G   ++ E   F+APPEA+L
Sbjct: 1351 RVTLLGAEGLGKSVQVRISLAKDGKMKHLYRSEKQKADATGACIFHNEICEFKAPPEANL 1410

Query: 131  IFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGIVNFRLNY 179
            +FG  ++H   +D +LG+AQI + DP + +   +S  L  G + F++ Y
Sbjct: 1411 VFGAVAHHTFSKDTNLGVAQINMGDPQLKQDSQVSIKLGSGHIIFKIEY 1459

>Kwal_47.16895 s47 complement(163274..167794) [4521 bp, 1506 aa] {ON}
            YML072C - Hypothetical ORF [contig 219] FULL
          Length = 1506

 Score = 95.9 bits (237), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 92/174 (52%), Gaps = 1/174 (0%)

Query: 7    KMSLDFDPSIPNTDTAVVQVLDPESLRPVNA-GTAVSNRTQAVLRRSRDESVNAELNLHP 65
            K+S DFD + PN   A V+  +P +    N  G++V      + +RS   + +    L P
Sbjct: 1314 KLSTDFDVTKPNNSYAPVESFNPAAAPSKNGDGSSVVGTPGPIHQRSASSASSFARTLAP 1373

Query: 66   GTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKGIAYYEETFGFQAP 125
               Y G++T V  E LG+  ++  SLA  G+IK L+RT+  + +  G   + E+  F+A 
Sbjct: 1374 NGTYKGKVTIVGAENLGKSVQVRFSLAQGGRIKHLYRTENKKANSDGWVDFGESCEFKAA 1433

Query: 126  PEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGIVNFRLNY 179
             EA+L+FG  + H   +D  LG+AQI L DP + +   +S  L +G +  ++ Y
Sbjct: 1434 TEANLVFGAVNVHRFGKDTELGVAQINLGDPQIRQEGQLSVKLARGHLILKILY 1487

>NDAI0D03130 Chr4 (742587..747074) [4488 bp, 1495 aa] {ON} Anc_4.340
          Length = 1495

 Score = 93.2 bits (230), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 96/188 (51%), Gaps = 16/188 (8%)

Query: 2    RVRDTKMSLDFDPSIPNTDTAVVQVLDPESLRPVNAGTAVSNRTQAVLRRSRDESVNA-- 59
            R+R+   SL++D S+PN        ++P S    NA    S ++  + R +     N   
Sbjct: 1294 RIRN---SLEYDTSVPNNSYTPRPSVEPAS---SNAEERASTKSNNLSRNTSSNMSNVGG 1347

Query: 60   --------ELNLHPGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKK 111
                       L P   Y G +  +S EKLG+  ++ +SL   G++K L++T+  + +  
Sbjct: 1348 KKSRASSFARTLAPNGTYNGNVNILSSEKLGKNIQIIISLTQAGRMKHLYKTRVQKANDN 1407

Query: 112  GIAYYEETFGFQAPPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKG 171
            G   + E   F+A PEA+L+ G  ++H + +D+ LGIAQ+ L DP + + + ++  L+ G
Sbjct: 1408 GTNVFNEACAFKASPEATLVIGAVAHHKLSKDKSLGIAQVNLGDPQIQKDENLALKLNDG 1467

Query: 172  IVNFRLNY 179
             V  +L+Y
Sbjct: 1468 HVIIKLDY 1475

>CAGL0L11440g Chr12 (1215533..1220125) [4593 bp, 1530 aa] {ON} similar
            to uniprot|Q03640 Saccharomyces cerevisiae YML072c
          Length = 1530

 Score = 92.4 bits (228), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 77/138 (55%), Gaps = 1/138 (0%)

Query: 42   SNRTQAVLRRSRDESVNAELNLHPGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLH 101
            SN++   + R    S  A   L P    TG L  +SG+ LGR  ++ VSL   G+IK ++
Sbjct: 1376 SNQSTPGIERISTASTFAR-TLGPDAATTGTLKILSGDNLGRNIQIKVSLTQAGRIKYIY 1434

Query: 102  RTKAMQCDKKGIAYYEETFGFQAPPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRG 161
            +TK  + D  G   + E   F+A PEA++I G  S H + +D+ +G  Q+ L DPSV+ G
Sbjct: 1435 KTKKCKADNNGDIEFHEDVQFKASPEANIILGAVSVHTLGKDKEVGFGQVSLKDPSVHMG 1494

Query: 162  KLISTNLDKGIVNFRLNY 179
            + I+ N+ +G V   ++Y
Sbjct: 1495 QPITVNVGEGHVTVLIDY 1512

>TPHA0B00440 Chr2 complement(93810..98177) [4368 bp, 1455 aa] {ON}
            Anc_4.340 YML072C
          Length = 1455

 Score = 88.2 bits (217), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 69/117 (58%)

Query: 63   LHPGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKGIAYYEETFGF 122
            L P   Y G++  V+ E LG+   + +SLA N K+K + ++K  + D KG+ Y  E   F
Sbjct: 1317 LAPNGIYNGKIQIVAAENLGKHIDVKISLAQNSKLKRIFKSKPKKADAKGVVYINENCVF 1376

Query: 123  QAPPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGIVNFRLNY 179
            ++ P+A+LIF   S+H + +D+ LGI ++ L DP ++    I   L +G++  +++Y
Sbjct: 1377 KSSPDATLIFNAVSHHTLAKDKDLGITKLNLSDPQISSTGNIGVKLGEGMIVVKIDY 1433

>TBLA0E04720 Chr5 (1202311..1207356) [5046 bp, 1681 aa] {ON} Anc_4.340
            YML072C
          Length = 1681

 Score = 87.8 bits (216), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 54/187 (28%), Positives = 94/187 (50%), Gaps = 15/187 (8%)

Query: 7    KMSLDFDPSIPNTDTAVV---------QVLDPES-----LRPVNAGTAVSNRTQAVLRRS 52
            K + ++DPSIPN +   V         +  D +S         N G   +  + +  +RS
Sbjct: 1478 KNTAEYDPSIPNQEYVKVPANSLANKPETTDKQSEHANHYHKGNGGVGGATNSGS-HQRS 1536

Query: 53   RDESVNAELNLHPGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKG 112
               + +    L P   Y G +  ++ EK+ +  ++ VSLA  G++K L  TK ++ D KG
Sbjct: 1537 VSRASSFARTLAPNGTYEGVVKVIAAEKVAKNVQIKVSLAQGGRMKPLFMTKTLKADDKG 1596

Query: 113  IAYYEETFGFQAPPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGI 172
            +  + +   F+A PEA+L+FG  ++H   +D  +G+AQI LDD  + +   I+  L  G 
Sbjct: 1597 VVAFNDEGKFKASPEANLVFGAIAHHKFSKDRDIGVAQINLDDEQIQQENNIAIKLGDGH 1656

Query: 173  VNFRLNY 179
            V  +++Y
Sbjct: 1657 VVVKVDY 1663

>Kpol_1001.6 s1001 complement(20699..25147) [4449 bp, 1482 aa] {ON}
            complement(20699..25147) [4449 nt, 1483 aa]
          Length = 1482

 Score = 87.4 bits (215), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 69/117 (58%)

Query: 63   LHPGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTKAMQCDKKGIAYYEETFGF 122
            L P   Y G +T ++ E L +  ++ VSL   G++K L +TK  + D  GIA++ E   F
Sbjct: 1345 LAPNGTYRGIVTILATENLSKNVQVKVSLTQKGRMKSLFKTKPQKTDDDGIAHFNENCEF 1404

Query: 123  QAPPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLISTNLDKGIVNFRLNY 179
            +A PEA+L+FG  ++H + +D  LG+AQI L DP +     I+  + +G +  +++Y
Sbjct: 1405 KASPEANLVFGVVAHHKLSKDRDLGLAQINLGDPQIQNEGNIAIKIGEGRIIVKIDY 1461

>NCAS0A06150 Chr1 (1212220..1216749) [4530 bp, 1509 aa] {ON} 
          Length = 1509

 Score = 77.8 bits (190), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 99/195 (50%), Gaps = 24/195 (12%)

Query: 9    SLDFDPSIPNTDTAVVQ----VLDPESLRPVN-----AGTAVSNRTQ------------- 46
            SLD+DPS PN   A VQ    +   +SLR  N     +  A+SN +Q             
Sbjct: 1308 SLDYDPSTPNKSYAAVQGPNNLEGQDSLRTQNGSDQKSAAALSNHSQVDNSNIKQAQSQP 1367

Query: 47   AVLRRSRDESVNAEL--NLHPGTNYTGRLTFVSGEKLGRKARLHVSLACNGKIKVLHRTK 104
            +  +  +D + ++ +   L P   Y+G L+ ++ E + +   + VSL   GK + ++ + 
Sbjct: 1368 STPKTPKDLTRSSSMAHTLRPDGVYSGTLSILTAENVAKNVVVRVSLTEKGKNRHIYTSS 1427

Query: 105  AMQCDKKGIAYYEETFGFQAPPEASLIFGGTSYHLMRRDEHLGIAQIPLDDPSVNRGKLI 164
              + + KGIA + E   F+  PE +++ G  S+H + +D+ LG AQ+ L DP V+ G+ I
Sbjct: 1428 KQKINDKGIATFNENTTFKTTPETTVVIGAVSHHKLSKDKDLGFAQVNLSDPQVHAGENI 1487

Query: 165  STNLDKGIVNFRLNY 179
            +  L  G +  R++Y
Sbjct: 1488 ALKLGDGHLIVRIDY 1502

>NDAI0A06480 Chr1 complement(1472312..1473268) [957 bp, 318 aa]
          {ON} Anc_3.184 YDL015C
          Length = 318

 Score = 30.8 bits (68), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 14/23 (60%), Positives = 18/23 (78%), Gaps = 1/23 (4%)

Query: 3  VRDTKMSLDFDPSIPNTDTAVVQ 25
          +RDTK+ LDFD S PNT  A++Q
Sbjct: 14 LRDTKIELDFDAS-PNTLEAILQ 35

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.390 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 22,425,272
Number of extensions: 871860
Number of successful extensions: 1908
Number of sequences better than 10.0: 22
Number of HSP's gapped: 1911
Number of HSP's successfully gapped: 22
Length of query: 217
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 112
Effective length of database: 41,441,469
Effective search space: 4641444528
Effective search space used: 4641444528
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 63 (28.9 bits)