Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D10142g5.350ON25525512321e-173
TDEL0E027705.350ON2582476082e-78
KLTH0H14828g5.350ON2512465742e-73
KAFR0C018605.350ON2592575526e-70
Kwal_34.159845.350ON2512475482e-69
NCAS0F028605.350ON2532505482e-69
NDAI0C043105.350ON2592585222e-65
Kpol_339.115.350ON2582575222e-65
Smik_4.5785.350ON2742644963e-61
Suva_2.4885.350ON2742644946e-61
CAGL0H07117g5.350ON2602494883e-60
Skud_4.5855.350ON2742644772e-58
SAKL0G08866g5.350ON2552424735e-58
YDR319C5.350ON2742644712e-57
TPHA0E011305.350ON2772554591e-55
Ecym_81835.350ON2652584302e-51
KNAG0C055105.350ON2642724267e-51
KLLA0B10153g5.350ON2672493902e-45
TBLA0A031105.350ON2752733902e-45
AGR350C5.350ON2612443727e-43
TBLA0F025006.117ON3271021041e-04
SAKL0A07062g6.117ON429163978e-04
Skud_7.1466.117ON316104960.001
KLTH0H06556g6.117ON363161930.002
CAGL0I00330g6.117ON371151930.003
KAFR0A046406.117ON237140910.003
TPHA0J018106.117ON39076910.004
KNAG0F025106.117ON246118860.017
TDEL0G035306.117ON368171860.019
AAR165W6.117ON36241820.054
Kwal_14.17966.117ON363161790.13
Ecym_30686.117ON36738790.16
NCAS0D031606.117ON39053750.40
KLLA0F09526g6.117ON33741750.49
YGL126W (SCS3)6.117ON38037740.64
Smik_7.1456.117ON38037730.77
NDAI0I017506.117ON38138730.87
Kpol_461.26.117ON39768711.3
ZYRO0A09240g6.117ON37234674.6
SAKL0H24794g8.143ON23647665.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D10142g
         (255 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {O...   479   e-173
TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.35...   238   2e-78
KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa] ...   225   2e-73
KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.35...   217   6e-70
Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C...   215   2e-69
NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON...   215   2e-69
NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON...   205   2e-65
Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON} ...   205   2e-65
Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {O...   195   3e-61
Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}...   194   6e-61
CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar...   192   3e-60
Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {O...   188   2e-58
SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly ...   186   5e-58
YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON} ...   186   2e-57
TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.35...   181   1e-55
Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to...   170   2e-51
KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5....   168   7e-51
KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {O...   154   2e-45
TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON...   154   2e-45
AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON} ...   147   7e-43
TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.11...    45   1e-04
SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {...    42   8e-04
Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W (...    42   0.001
KLTH0H06556g Chr8 complement(577648..578739) [1092 bp, 363 aa] {...    40   0.002
CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly s...    40   0.003
KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON...    40   0.003
TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6....    40   0.004
KNAG0F02510 Chr6 complement(472542..473282) [741 bp, 246 aa] {ON...    38   0.017
TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {O...    38   0.019
AAR165W Chr1 (639331..640419) [1089 bp, 362 aa] {ON} Syntenic ho...    36   0.054
Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {O...    35   0.13 
Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}...    35   0.16 
NCAS0D03160 Chr4 complement(593886..595058) [1173 bp, 390 aa] {O...    33   0.40 
KLLA0F09526g Chr6 (875250..876263) [1014 bp, 337 aa] {ON} simila...    33   0.49 
YGL126W Chr7 (270997..272139) [1143 bp, 380 aa] {ON}  SCS3Protei...    33   0.64 
Smik_7.145 Chr7 (264891..265812,265963..266183) [1143 bp, 380 aa...    33   0.77 
NDAI0I01750 Chr9 (412262..413407) [1146 bp, 381 aa] {ON} Anc_6.1...    33   0.87 
Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON} co...    32   1.3  
ZYRO0A09240g Chr1 complement(741195..742313) [1119 bp, 372 aa] {...    30   4.6  
SAKL0H24794g Chr8 (2157080..2157115,2157369..2158043) [711 bp, 2...    30   5.3  

>ZYRO0D10142g Chr4 complement(853192..853959) [768 bp, 255 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  479 bits (1232), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 233/255 (91%), Positives = 233/255 (91%)

Query: 1   MRLTPLDWKKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQ 60
           MRLTPLDWKKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQ
Sbjct: 1   MRLTPLDWKKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQ 60

Query: 61  IWTILFCGLAGLQVYMKTHVPDVIPRDARTIVRKPMTSLLKEYAVXXXXXXXXXXXXXXX 120
           IWTILFCGLAGLQVYMKTHVPDVIPRDARTIVRKPMTSLLKEYAV               
Sbjct: 61  IWTILFCGLAGLQVYMKTHVPDVIPRDARTIVRKPMTSLLKEYAVKIILKNLLLAIIFLF 120

Query: 121 XXXXXXXTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLES 180
                  TGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLES
Sbjct: 121 IDNIFILTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLES 180

Query: 181 WLIEEDMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIM 240
           WLIEEDMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIM
Sbjct: 181 WLIEEDMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIM 240

Query: 241 YWLIPNHDIVRKVLY 255
           YWLIPNHDIVRKVLY
Sbjct: 241 YWLIPNHDIVRKVLY 255

>TDEL0E02770 Chr5 (534173..534949) [777 bp, 258 aa] {ON} Anc_5.350
           YDR319C
          Length = 258

 Score =  238 bits (608), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 158/247 (63%)

Query: 9   KKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCG 68
           K AA +YP+ELV+GC +A+++G +RLE QR+ +Y L   N IN IFAY+GN +WT+ F  
Sbjct: 11  KIAASIYPLELVLGCVIAWILGEDRLELQRRTYYLLESKNIINGIFAYKGNLVWTVDFVC 70

Query: 69  LAGLQVYMKTHVPDVIPRDARTIVRKPMTSLLKEYAVXXXXXXXXXXXXXXXXXXXXXXT 128
           LA +Q+Y+K     ++PRDART    P+ SLLK+Y                        T
Sbjct: 71  LALVQIYVKCRNHALLPRDARTNSSGPLKSLLKQYTSKIILKNVLLAITFFIIDSIFVLT 130

Query: 129 GGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWLIEEDMV 188
           GGSC +   T SAE+C  +GG W+GGFDISGHFCFLV+ISMILWLEL    S++  E +V
Sbjct: 131 GGSCLNGDVTRSAERCRISGGQWQGGFDISGHFCFLVNISMILWLELSQFRSYMERESVV 190

Query: 189 KRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLIPNHD 248
             ++     ++ ++   L  W  +LMVT++YYHT+LEK+LGCA+GY+C ++MYWLIP   
Sbjct: 191 FPVSKVVNGVLVVSSGVLGIWVLMLMVTAVYYHTVLEKVLGCALGYVCVLVMYWLIPRSR 250

Query: 249 IVRKVLY 255
               +LY
Sbjct: 251 RFNGLLY 257

>KLTH0H14828g Chr8 complement(1286533..1287288) [756 bp, 251 aa]
           {ON} similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 251

 Score =  225 bits (574), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 114/246 (46%), Positives = 150/246 (60%), Gaps = 3/246 (1%)

Query: 10  KAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCGL 69
           + A VYP+ L+ G  +  L     L+ Q+  +Y L+PNN IN +FAY+GN IWTILF  L
Sbjct: 9   RFAFVYPVVLICGLVVHLLANGSTLQHQKDTYYLLSPNNVINLVFAYKGNLIWTILFVSL 68

Query: 70  AGLQVYMKTHVPDVIPRDARTIVRKPMTSLLKEYAVXXXXXXXXXXXXXXXXXXXXXXTG 129
           A  Q+ ++    D++PRDART        L KEYAV                      TG
Sbjct: 69  AAYQIKIRVSRSDLLPRDARTTYPARWHRLGKEYAVKIILKNLLLYVIFFVIDCVFVWTG 128

Query: 130 GSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWLIEEDMVK 189
           GSCS  S T SAE+C K GG WE GFDISGHFCFL ++S+ILWLEL  ++ +L  ++   
Sbjct: 129 GSCSS-SATKSAERCRKEGGKWENGFDISGHFCFLTNVSLILWLELSSIQKYLNSDERTP 187

Query: 190 RLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLIPNHDI 249
              +W + ++   V  L  W F+L VT+IYYHT LEKILG  MGYICP+IMYWL+P+H  
Sbjct: 188 S-KLW-RVLLYSNVSVLVIWAFVLSVTAIYYHTTLEKILGLLMGYICPVIMYWLVPSHTA 245

Query: 250 VRKVLY 255
           +R++LY
Sbjct: 246 LRQLLY 251

>KAFR0C01860 Chr3 (371806..372585) [780 bp, 259 aa] {ON} Anc_5.350
           YDR319C
          Length = 259

 Score =  217 bits (552), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 111/257 (43%), Positives = 151/257 (58%), Gaps = 2/257 (0%)

Query: 1   MRLTPLDWKKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQ 60
           M+L+ L     +++YP  L +G  L+ ++  E    Q+   Y L  +N IN+IFAY GN 
Sbjct: 1   MKLSLLPPLIISLIYPCILFLGLFLSAVISDETKSYQKDRIYLLRSSNIINEIFAYNGNL 60

Query: 61  IWTILFCGLAGLQVYMKTHVPDVIPRDARTIVRKP--MTSLLKEYAVXXXXXXXXXXXXX 118
           +W ILF  +A LQ+Y+++H   ++P D   +  K      LLKEY V             
Sbjct: 61  VWFILFSFVASLQIYIRSHTFILLPHDIVDVDSKENVRAKLLKEYMVKFLLKVFILFVCF 120

Query: 119 XXXXXXXXXTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHL 178
                    TGGSC+    T SAE+C   GG W GGFDISGHFCFL +IS+ILW+EL H 
Sbjct: 121 LIIDNIFILTGGSCAPGGATRSAEQCKALGGDWLGGFDISGHFCFLTNISLILWIELHHY 180

Query: 179 ESWLIEEDMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPI 238
             +  EE++  R+N W K  + +    L  W F+L+VTSIYYHT+LEKILGC MGY CP+
Sbjct: 181 SKYTEEEELQSRINKWIKRSLIVVEVVLYIWMFLLLVTSIYYHTILEKILGCIMGYACPL 240

Query: 239 IMYWLIPNHDIVRKVLY 255
           +MYWLIPN   ++ +LY
Sbjct: 241 VMYWLIPNQPRMKSLLY 257

>Kwal_34.15984 s34 (145158..145913) [756 bp, 251 aa] {ON} YDR319C -
           Hypothetical ORF [contig 272] FULL
          Length = 251

 Score =  215 bits (548), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 113/247 (45%), Positives = 147/247 (59%), Gaps = 9/247 (3%)

Query: 12  AIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCGLAG 71
            +VYP  L  G  +  L+   RLE QR  +Y L+  N +N++FAYRGN  WTILF  LA 
Sbjct: 11  TLVYPSILAYGSLINLLVDASRLERQRSSYYLLSSGNIVNKLFAYRGNLTWTILFTLLAV 70

Query: 72  LQVYMKTHVPDVIPRDARTIVRKPMTSLLKEYAVXXXXXXXXXXXXXXXXXXXXXXTGGS 131
            QV++     D++PRDAR++ R     L K+Y V                      TGGS
Sbjct: 71  FQVWLHAEQSDLLPRDARSVHRVGGVRLAKQYTVKLILKNVLLYLAFLFIDNLFVWTGGS 130

Query: 132 CSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWLIEEDMVKRL 191
           CS  S T SAE+C K GG W+ GFDISGHFCFL +IS+ILW EL+ ++  +  +D+    
Sbjct: 131 CST-SSTRSAERCRKEGGSWDNGFDISGHFCFLTNISLILWYELRSIQKKISSDDISP-- 187

Query: 192 NVWGKTIIGI---TVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLIPNHD 248
               KT I +   T+  L TW FIL VT++YYHTLLEK+LG  MGY+CP IMY +IPNH 
Sbjct: 188 ---TKTWIVLRWSTLIVLITWSFILSVTAVYYHTLLEKVLGLTMGYLCPTIMYLVIPNHS 244

Query: 249 IVRKVLY 255
            +R +LY
Sbjct: 245 GLRSLLY 251

>NCAS0F02860 Chr6 complement(572100..572861) [762 bp, 253 aa] {ON}
           Anc_5.350 YDR319C
          Length = 253

 Score =  215 bits (548), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 107/250 (42%), Positives = 152/250 (60%), Gaps = 2/250 (0%)

Query: 6   LDWKKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTIL 65
             W    +VYP  LV+G  +  ++  E L+ Q+ E+Y L+  N +N++FAY GN IW +L
Sbjct: 5   FKWPNVCLVYPTILVLGTIINTIVREETLDRQKHEYYILSSKNILNRVFAYNGNLIWAML 64

Query: 66  FCGLAGLQVYMKTHVPDVIPRDARTIVRKPMTSLLKEYAVXXXXXXXXXXXXXXXXXXXX 125
           F  +A  QV+++    D++PRDA+ I R+ +  L+K+Y V                    
Sbjct: 65  FGMMAYFQVWIRIRTQDLLPRDAQIINRQRLQRLIKQYIVKFVLKYLLLFITFLFIDGLF 124

Query: 126 XXTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWLIEE 185
             TGG C+   G  SAEKC   GG+WEGGFDISGHFCFL+++S+ILW EL  LE +L +E
Sbjct: 125 LFTGGQCTYGLGIWSAEKCKNEGGHWEGGFDISGHFCFLMNVSLILWCELSILERYLRDE 184

Query: 186 DMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLIP 245
           ++     +   +++   +  L  W  +L VT+IYYHTLLEKILGC +GY CP+IMYWLIP
Sbjct: 185 ELEMETIITNYSVLLKCILYL--WMSMLCVTAIYYHTLLEKILGCLLGYCCPLIMYWLIP 242

Query: 246 NHDIVRKVLY 255
           NH  +  +LY
Sbjct: 243 NHYKLNHILY 252

>NDAI0C04310 Chr3 complement(982580..983359) [780 bp, 259 aa] {ON}
           Anc_5.350 YDR319C
          Length = 259

 Score =  205 bits (522), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 101/258 (39%), Positives = 155/258 (60%), Gaps = 3/258 (1%)

Query: 1   MRLTPLDWKKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQ 60
           M++ P+ W +   +YP  L +G  +  L+ +E L+S +  +Y LN  N  NQ+ AY GN+
Sbjct: 1   MKILPIPWPQICYIYPTILFIGVLINSLLPNETLQSHKSNYYVLNSKNIFNQVMAYNGNK 60

Query: 61  IWTILFCGLAGLQVYMKTHVPDVIPR--DARTIVRKPMTSLLKEYAVXXXXXXXXXXXXX 118
           +W+ILF  L+ +Q+ +++   +++PR  D+    R+ + SL+K+Y +             
Sbjct: 61  VWSILFILLSVIQIRLQSTNINLLPRHVDSAASKRRHVNSLIKQYVIKFVLKNVLLAFLF 120

Query: 119 XXXXXXXXXTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHL 178
                    TGG C+      SAE C   GG WEGGFDISGHFCFL++IS+ILW EL  L
Sbjct: 121 LIIDSLFILTGGECNLIEDIWSAEHCKAKGGRWEGGFDISGHFCFLINISLILWSELSLL 180

Query: 179 ESWLIE-EDMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICP 237
              L + E+   +++ W + +I I +  L  W  IL VT++YYHTLLEKILGC +G++CP
Sbjct: 181 NKVLEDREETFTKIDKWMEGVIVIILGCLYLWMGILFVTAVYYHTLLEKILGCILGFVCP 240

Query: 238 IIMYWLIPNHDIVRKVLY 255
           I+MY+ IPN+  +++ LY
Sbjct: 241 IVMYYFIPNNVKLKQTLY 258

>Kpol_339.11 s339 complement(17930..18706) [777 bp, 258 aa] {ON}
           complement(17930..18706) [777 nt, 259 aa]
          Length = 258

 Score =  205 bits (522), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 103/257 (40%), Positives = 156/257 (60%), Gaps = 12/257 (4%)

Query: 7   DWKKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILF 66
           + +  +++YP E+++G  L+ ++G  +LESQR   Y L  +N +N++FAY GNQ+W +LF
Sbjct: 5   ELRVVSLIYPFEVLIGWALSKIIGDLKLESQRNNFYILRSSNIVNELFAYHGNQVWLVLF 64

Query: 67  CGLAGLQVYMKTHVPDVI-------PRDARTIVRKPMTSLLKEYAVXXXXXXXXXXXXXX 119
             L  +Q+Y ++    ++        RD      KP   L+K+Y                
Sbjct: 65  IFLCLVQIYYRSKRFSLLISSESFNGRDQLIARGKP---LVKQYICKLILKNLMLILVFS 121

Query: 120 XXXXXXXXTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLE 179
                   +GG C+  SGT S+++C    G+WEGGFDISGHFCFLV+ISMILW+EL   +
Sbjct: 122 VIDNVFIFSGGECTSGSGTRSSQRCRHENGHWEGGFDISGHFCFLVTISMILWIELHQFK 181

Query: 180 SWLIEEDMVKRLNVWGKTIIGITVFT-LATWCFILMVTSIYYHTLLEKILGCAMGYICPI 238
             +  E +  +L+++ K I+ +TVFT L  W FIL +TS+YYHT +EK+LGCAMGYI P 
Sbjct: 182 KHVDLEGLSGQLSLYSKIIL-MTVFTVLCIWVFILFITSVYYHTFMEKVLGCAMGYITPY 240

Query: 239 IMYWLIPNHDIVRKVLY 255
           +MY +IPN++ +  +LY
Sbjct: 241 VMYHIIPNNEFLYSILY 257

>Smik_4.578 Chr4 complement(1031477..1032301) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  195 bits (496), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 105/264 (39%), Positives = 144/264 (54%), Gaps = 17/264 (6%)

Query: 9   KKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCG 68
           +KA ++YP +++VG  ++ L+  + L+ Q+K H  L  +N  N IFAY+ NQ+W ILF  
Sbjct: 10  RKAYLIYPFQVLVGALISILVSPKTLDHQKKTHVLLKSSNLFNTIFAYKANQLWPILFFS 69

Query: 69  LAGLQVYMKTHVP-DVIPRDARTIVRKP----------------MTSLLKEYAVXXXXXX 111
           LA LQVY       DV+P    +   +P                   ++ +YA       
Sbjct: 70  LAFLQVYFHYLARMDVLPLPISSSQTRPSYLTYPNRWLLLKNRVTIIMIAQYACKFILKY 129

Query: 112 XXXXXXXXXXXXXXXXTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMIL 171
                           TGG CS  SGT SAEKC    G W GGFDISGHFCFLV+ISMIL
Sbjct: 130 MLLFLSFQFIDHVFIWTGGECSSGSGTRSAEKCRLENGKWHGGFDISGHFCFLVNISMIL 189

Query: 172 WLELQHLESWLIEEDMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCA 231
           W+EL     ++  EDMV  +N W +  + +    L  W  IL VT+IYYHT+LEKILGC 
Sbjct: 190 WMELHMFCRFIQSEDMVWVVNKWVRACLAVICTVLIIWICILWVTAIYYHTILEKILGCL 249

Query: 232 MGYICPIIMYWLIPNHDIVRKVLY 255
           MGYICPI +Y ++P  +++   ++
Sbjct: 250 MGYICPIFIYHILPKIELLHNYIH 273

>Suva_2.488 Chr2 complement(862400..863221) [822 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  194 bits (494), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 108/264 (40%), Positives = 148/264 (56%), Gaps = 17/264 (6%)

Query: 9   KKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCG 68
           +KA +VYPI+++VG  ++ L+  E L  Q+K +  L  +N +N IFAY+ N+IW I F  
Sbjct: 10  RKAYLVYPIQVLVGAVISILVSEETLNHQKKTYTLLKSSNLLNIIFAYKANKIWPIFFFS 69

Query: 69  LAGLQVYMKTHVP-DVIP-----RDARTIV-----RKPM------TSLLKEYAVXXXXXX 111
           LA LQ+Y       DV+P      D  +       R+P+      T++  +YA       
Sbjct: 70  LALLQIYFHYLARLDVLPLPISSSDTGSTYLSYGNRRPLLKDRVITTMAAQYACKFVLKN 129

Query: 112 XXXXXXXXXXXXXXXXTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMIL 171
                           TGG CS  SGT SAEKC    G W GGFDISGHFCFLV+ISMIL
Sbjct: 130 LLLFLSFQFIDHVFVWTGGQCSSGSGTTSAEKCRLEKGKWYGGFDISGHFCFLVNISMIL 189

Query: 172 WLELQHLESWLIEEDMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCA 231
           W+EL     ++  EDM+  +N W +  + I    L  W  IL VT+IYYHT+LEK+LGC 
Sbjct: 190 WMELHLFSRFVQAEDMLWVVNKWVRACLVIISVVLLIWIGILWVTAIYYHTILEKMLGCL 249

Query: 232 MGYICPIIMYWLIPNHDIVRKVLY 255
           MGYICP+ +Y ++P  +++   LY
Sbjct: 250 MGYICPVFIYHILPRIELLHDYLY 273

>CAGL0H07117g Chr8 (702520..703302) [783 bp, 260 aa] {ON} similar to
           uniprot|Q06676 Saccharomyces cerevisiae YDR319c
          Length = 260

 Score =  192 bits (488), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 142/249 (57%), Gaps = 2/249 (0%)

Query: 9   KKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCG 68
           K+ ++ YP+ L++GC L+ L+  E   +QR  +Y LN  N  NQI AY+GN +W  LF G
Sbjct: 7   KQVSLAYPVILILGCFLSVLLSEEAKINQRANYYLLNSKNVFNQILAYKGNWVWLFLFMG 66

Query: 69  LAGLQVYMKTHVPDVIPRDARTIVRKPMTSL--LKEYAVXXXXXXXXXXXXXXXXXXXXX 126
           +A +Q  ++T    ++P D R +V    T L  +KEY                       
Sbjct: 67  VAAVQYNLRTKSQSLLPTDTRALVVSNKTKLQIIKEYFCKYFLKLFILDVIFLVIDGVFI 126

Query: 127 XTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWLIEED 186
            TGGSC+  + + SAE C   GG W GGFDISGHFCFLV+ISMILW+EL  +   +   D
Sbjct: 127 MTGGSCTVPNRSISAELCKSLGGKWIGGFDISGHFCFLVNISMILWMELIAIAEHVCGYD 186

Query: 187 MVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLIPN 246
            V  L+   K +I + V  L  W  +L+VT+ YYHT+ EK++GC  GYICP +MY LIPN
Sbjct: 187 TVISLSSLQKHVITVAVVVLVAWMGMLLVTATYYHTIAEKLIGCVFGYICPFVMYGLIPN 246

Query: 247 HDIVRKVLY 255
              + K+ Y
Sbjct: 247 SHDLNKLFY 255

>Skud_4.585 Chr4 complement(1041303..1042127) [825 bp, 274 aa] {ON}
           YDR319C (REAL)
          Length = 274

 Score =  188 bits (477), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 139/264 (52%), Gaps = 17/264 (6%)

Query: 9   KKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCG 68
           +KA ++YP +++VG  ++ L+  E L  Q+K +  L  +N  N +FAY+ NQ+W  LF  
Sbjct: 10  RKAYLIYPFQVLVGAIISILVSSETLGHQKKTYALLKSSNLFNILFAYKANQLWPFLFFS 69

Query: 69  LAGLQVYMKTHVP-DVIPRDARTIVRKPMTS----------------LLKEYAVXXXXXX 111
           LA LQ+Y       DV+P    +    P  S                +  +YA       
Sbjct: 70  LAFLQIYFHYLARMDVLPLPISSSETGPTYSSYINRWPLLKDRVIGIMFAQYACKFILKS 129

Query: 112 XXXXXXXXXXXXXXXXTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMIL 171
                           TGG CS  SGT SAEKC    G W+GGFDISGHFCFLV+ISMIL
Sbjct: 130 LLLYVCFQFIDHVFIWTGGECSSGSGTTSAEKCRLENGKWQGGFDISGHFCFLVNISMIL 189

Query: 172 WLELQHLESWLIEEDMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCA 231
           W+EL     ++  EDM    N W +  + +    L  W  IL VT+IYYHT+LEKILGC 
Sbjct: 190 WMELHLFSKFVQAEDMFWVANKWVRACLAVISSILVIWICILWVTAIYYHTVLEKILGCF 249

Query: 232 MGYICPIIMYWLIPNHDIVRKVLY 255
           MGYICPI +Y ++P   ++   +Y
Sbjct: 250 MGYICPIFIYHVLPKIGLLHDYIY 273

>SAKL0G08866g Chr7 (759588..760355) [768 bp, 255 aa] {ON} weakly
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C Hypothetical ORF
          Length = 255

 Score =  186 bits (473), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 99/242 (40%), Positives = 146/242 (60%), Gaps = 5/242 (2%)

Query: 15  YPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCGLAGLQV 74
           YP+ L++G  +  L+  + L+ Q+ E+Y L+  N IN++FAY+GNQI+ I F  LA LQ+
Sbjct: 18  YPLVLLLGLLVNLLVSAQELDRQKHEYYLLSSRNVINKVFAYQGNQIFLITFILLAALQI 77

Query: 75  YMKTHVPDVIPRDARTIVRKPMTSLLKEYAVXXXXXXXXXXXXXXXXXXXXXXTGGSCSD 134
           ++ +   D++PR++ +  R     L ++YA+                      TGG CS 
Sbjct: 78  HIHSKNQDLLPRNSSSSPRTEAAGLARQYAIKFLLKQLLLYVVFYIIDHVFIWTGGVCSI 137

Query: 135 HSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWLIEEDM-VKRLNV 193
            S T SAE+C   GG WEGGFDISGHFCFL ++S+ILW EL H + ++ + ++ V R   
Sbjct: 138 -SKTRSAERCRVLGGSWEGGFDISGHFCFLTNVSLILWYELYHYQKYISDNELRVNRKFA 196

Query: 194 WGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLIPNHDIVRKV 253
           W K    +T+F L  W F+L VT+ YYHT+ EK+LG  MGY CP +MY LIP+   + K+
Sbjct: 197 WIKY---LTLFVLVVWLFVLSVTATYYHTVGEKVLGLVMGYTCPTVMYILIPSTTKLNKL 253

Query: 254 LY 255
           +Y
Sbjct: 254 MY 255

>YDR319C Chr4 complement(1105003..1105827) [825 bp, 274 aa] {ON}
           Putative protein of unknown function, identified as an
           ortholog of the highly conserved FIT family of proteins
           involved in triglyceride droplet biosynthesis; interacts
           with Sst2p and Hsp82p in high-throughput two-hybrid
           screens
          Length = 274

 Score =  186 bits (471), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 100/264 (37%), Positives = 140/264 (53%), Gaps = 17/264 (6%)

Query: 9   KKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCG 68
           +KA ++YP ++ VG  L+ ++  E L  Q++    L  +N  N IFAY+ NQ+W  LF  
Sbjct: 10  RKAYLIYPFQVFVGALLSIVVSSETLNHQKETCALLKSSNIFNVIFAYKANQLWPFLFFS 69

Query: 69  LAGLQVYMKTHVP-DVIPRDART----------------IVRKPMTSLLKEYAVXXXXXX 111
           LA LQ+Y       D++P    +                +  + ++ ++ +YA       
Sbjct: 70  LAFLQIYFHYLARMDILPLPISSTETSSSYLTYTNHWPLLKNRIISIMITQYACKFVLKY 129

Query: 112 XXXXXXXXXXXXXXXXTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMIL 171
                           TGG CS  S T SAEKC    G W+GGFDISGHFCFLVSISMIL
Sbjct: 130 LLLFLNFQFIDHVFIWTGGECSSGSKTTSAEKCRLENGKWDGGFDISGHFCFLVSISMIL 189

Query: 172 WLELQHLESWLIEEDMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCA 231
           W+EL     ++  EDM   +N W +  + I    L  W  IL VT+IYYHT+LEK+LGC 
Sbjct: 190 WMELHLFSRFVQAEDMFWVVNKWVRACLAIVCAVLVIWICILWVTAIYYHTILEKVLGCL 249

Query: 232 MGYICPIIMYWLIPNHDIVRKVLY 255
           MG+ICP+ +Y ++P   I+   LY
Sbjct: 250 MGFICPVFIYHILPKIGILHNYLY 273

>TPHA0E01130 Chr5 (232942..233775) [834 bp, 277 aa] {ON} Anc_5.350
           YDR319C
          Length = 277

 Score =  181 bits (459), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 139/255 (54%), Gaps = 11/255 (4%)

Query: 12  AIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCGLAG 71
           +I Y   L+ G  L  ++G E LE  +   YFLN  N INQIFAY GN +W +LFC +  
Sbjct: 22  SISYIFVLLFGEFLHLILGTETLEYHKTSFYFLNSKNTINQIFAYNGNLVWFLLFCLVFY 81

Query: 72  LQVYMKT-HVPDVIPRDARTIV----------RKPMTSLLKEYAVXXXXXXXXXXXXXXX 120
           L ++ +T +  +++P  A   V          ++    L K+Y                 
Sbjct: 82  LHLHFETVNSKELLPTSADVPVGLHSRVCQYTQRANYYLFKQYFFKYCVKSASLFVIFFA 141

Query: 121 XXXXXXXTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLES 180
                  +GGSC D SGT  +E C  N G WEGGFDISGHFCFL++IS+ILW EL  L  
Sbjct: 142 IDTLFVLSGGSCDDGSGTTFSETCRSNKGKWEGGFDISGHFCFLITISLILWCELYKLHK 201

Query: 181 WLIEEDMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIM 240
            +  E     LNV    +IG+ V  +  W  +L +T+IYYHT  EK+LGC +G++ P++M
Sbjct: 202 RMESESFEVELNVVFTVMIGLIVGVIMVWFGLLWITAIYYHTFFEKVLGCMLGFVTPLLM 261

Query: 241 YWLIPNHDIVRKVLY 255
           Y+ IP+++ +  +LY
Sbjct: 262 YYTIPSNEFLNGLLY 276

>Ecym_8183 Chr8 (381845..382642) [798 bp, 265 aa] {ON} similar to
           Ashbya gossypii AGR350C
          Length = 265

 Score =  170 bits (430), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 95/258 (36%), Positives = 145/258 (56%), Gaps = 19/258 (7%)

Query: 9   KKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCG 68
           ++  +VYP  +  G  +  L G ERLES RK  Y L   N +N +F   GN +W +L+  
Sbjct: 16  QRYILVYPSLVFGGAVMRLLAGSERLESVRKSWYLLTEGNMVNYLFVINGNNVWLVLYIL 75

Query: 69  LAGLQVYMKTHVPDVIP----------RDARTIVRKPMTSLLKEYAVXXXXXXXXXXXXX 118
           +AG+Q Y++T   D +P          R+  TI       L+K++ V             
Sbjct: 76  MAGVQCYIRTKESDSLPLGGSVPGSSSRERYTI----FLCLVKQFIVKLALKMVLLDRIF 131

Query: 119 XXXXXXXXXTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHL 178
                    TGG C+  S T S+ +C +  G W GGFDISGHFCF+ ++S+ILW EL  L
Sbjct: 132 WLIDHVFIWTGGRCTV-SDTKSSMECYRLHGKWVGGFDISGHFCFVTNLSLILWCELFSL 190

Query: 179 ESWLIEEDM-VKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICP 237
           E +L   ++ +++  +W K +I   +  L TW FIL VT+++YHTLLEK+LG  +GY+CP
Sbjct: 191 EQYLSANEIRLRKRLIWIKYMI---LLALVTWIFILWVTALFYHTLLEKVLGLILGYVCP 247

Query: 238 IIMYWLIPNHDIVRKVLY 255
           ++MY +IP +  ++++LY
Sbjct: 248 VVMYAIIPYYPKLQRILY 265

>KNAG0C05510 Chr3 (1071528..1072322) [795 bp, 264 aa] {ON} Anc_5.350
           YDR319C
          Length = 264

 Score =  168 bits (426), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 100/272 (36%), Positives = 141/272 (51%), Gaps = 26/272 (9%)

Query: 1   MRLTPLDWKKAAIVYPIELVVGCTLAFLMGHERLESQRKEH-YFLNPNNFINQIFAYRGN 59
           M L  L W    ++YP  L +G  L  L+  E+++ Q K+H YF N  N +NQ+FAY+GN
Sbjct: 1   MLLDKLIWPNVVLLYPFVLSIGLILHVLVP-EQVQDQLKQHVYFFNSKNVLNQVFAYKGN 59

Query: 60  QIWTILFCGLAGLQVYMKTHVPDVIPRDARTIVRKPMTSLLKEYAVXXXXXXXXXXXXXX 119
            +WT+LF  +A L  ++KT   D  P + R   R+    ++++Y                
Sbjct: 60  LVWTVLFLYIAVLSYFIKTMSRD--PLEQRAGGRQVDWQIVRQYCWKLLLKNGLLYLCFL 117

Query: 120 XXXXXXXXTGGSCSDHSGT----HSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLEL 175
                   TGG C+   G      SAE C  NGG WE GFDISGHFCFL++IS+ILW EL
Sbjct: 118 VIDGVFIATGGVCTTMGGEMRKIRSAESCKWNGGQWENGFDISGHFCFLMNISLILWAEL 177

Query: 176 QHLESWLIEEDMVKRLNV------------WGKTIIGITVFTLATWCFILMVTSIYYHTL 223
           Q L      +D ++R  +            W +  +     TL  W F+L VT+ +YHT 
Sbjct: 178 QLL------QDAIRREELGEEELNLWICYKWLRHGLTAVKITLYIWLFLLFVTASFYHTS 231

Query: 224 LEKILGCAMGYICPIIMYWLIPNHDIVRKVLY 255
            EK++GCA GY+CP +MY LIP    + +  Y
Sbjct: 232 SEKLIGCAFGYVCPFVMYHLIPTSPRLNEFFY 263

>KLLA0B10153g Chr2 complement(888468..889271) [804 bp, 267 aa] {ON}
           similar to uniprot|Q06676 Saccharomyces cerevisiae
           YDR319C
          Length = 267

 Score =  154 bits (390), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 92/249 (36%), Positives = 138/249 (55%), Gaps = 12/249 (4%)

Query: 14  VYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCGLAGLQ 73
           +YP  ++ G  ++ L+G + LE +RKE Y++   N +N +FAY+G  I+ +LF  L GLQ
Sbjct: 21  IYPALVIFGYFISVLIGEDELERERKEWYWIGGRNVVNHLFAYKGIYIFDVLFGLLIGLQ 80

Query: 74  VYMK-THVPDVIP-------RDARTIVRKPMTSLLKEYAVXXXXXXXXXXXXXXXXXXXX 125
           VY++  H   ++P       R++  ++++ +  +LK Y++                    
Sbjct: 81  VYVRMKHEESLLPTSNGEQDRNSPDLLKQ-VGKVLKVYSIKFVLVYLVLWACFLFIDHLF 139

Query: 126 XXTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWLIEE 185
             TGG+C D S T SAEKC   GG W GGFDISGHFCFL +IS+ LW EL+ L  +  + 
Sbjct: 140 VWTGGNC-DLSDTKSAEKCRSLGGSWVGGFDISGHFCFLTNISLTLWQELKLLLQYANQH 198

Query: 186 DMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLIP 245
            +    N        I +  L  W  +L +TSIYYHT  EK+LGCA GY C +++Y+++P
Sbjct: 199 TI--SWNSPSSKYQWIVLLVLCIWINVLTITSIYYHTFPEKVLGCAFGYSCLLVIYYILP 256

Query: 246 NHDIVRKVL 254
               V K L
Sbjct: 257 RIKHVNKFL 265

>TBLA0A03110 Chr1 complement(741449..742276) [828 bp, 275 aa] {ON}
           Anc_5.350 YDR319C
          Length = 275

 Score =  154 bits (390), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 95/273 (34%), Positives = 138/273 (50%), Gaps = 20/273 (7%)

Query: 2   RLTPLDWKKAAIVYPIELVVGCTLAFLMGHER-----------LESQRKEHYFL-NPNNF 49
           +L P +W     +YP  ++ G     L G+ +           L S+  + ++L   N++
Sbjct: 3   QLAP-NWIVLVCLYPSIMLFGSLTGSLGGYNKSNGNGHNDIDDLPSEPSDKFWLIRSNSW 61

Query: 50  INQIFAYRGNQIWTILFCGLAGLQVYMKTHVPDV-IPRDARTIVR------KPMTSLLKE 102
            NQ+FAY GN ++  LF  +  LQVY       + +P + RTI R      K    + KE
Sbjct: 62  FNQLFAYNGNTVFLGLFLIIVSLQVYFSREDARLSLPIEIRTISRIKQFQTKHYLRIAKE 121

Query: 103 YAVXXXXXXXXXXXXXXXXXXXXXXTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFC 162
           Y                        TGG C++ SGT  A  C    G W GGFDISGHFC
Sbjct: 122 YICKLILKYFFLYLEFLFIDHLFVLTGGYCTNGSGTRDAMICRSGNGEWVGGFDISGHFC 181

Query: 163 FLVSISMILWLELQHLESWLIEEDMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHT 222
           FLV++S+I+WLEL  LE ++   D+   +      ++   V  L  W  +L VTS+YYHT
Sbjct: 182 FLVTLSLIIWLELFKLEEFIRSRDLKSNVTNEVIFMVFFIVSILILWIVMLCVTSLYYHT 241

Query: 223 LLEKILGCAMGYICPIIMYWLIPNHDIVRKVLY 255
            +EK+LGC MGYICPI+MY ++P + I  + +Y
Sbjct: 242 FVEKLLGCIMGYICPIVMYRVLPRNTIFTRYIY 274

>AGR350C Chr7 complement(1380552..1381337) [786 bp, 261 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR319C
          Length = 261

 Score =  147 bits (372), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 131/244 (53%), Gaps = 10/244 (4%)

Query: 9   KKAAIVYPIELVVGCTLAFLMGHERLESQRKEHYFLNPNNFINQIFAYRGNQIWTILFCG 68
           ++   +YP  L+ G  +  ++G E +E  RK  Y LN  NF+NQ+F + G  +WT+L   
Sbjct: 14  RRYCYLYPALLLGGEVIKLILGEETIEHDRKTWYLLNGGNFVNQLFVHHGVLLWTLLMGL 73

Query: 69  LAGLQVYMKTHVPDVIPRDART---IVRKPMT---SLLKEYAVXXXXXXXXXXXXXXXXX 122
           +  LQ +++T   D +P DAR    + R P+    S+  +  +                 
Sbjct: 74  VLALQYHVRTTEFDPLPLDARELGPVKRHPLKMLGSMAVQTVIKVLLVVTVLQALFWFMD 133

Query: 123 XXXXXTGGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWL 182
                TGG C+  S T  +  C + GG W GGFDISGHFC ++++S++LWLEL  L+ ++
Sbjct: 134 HLFVWTGGRCTV-SDTKDSVACRRLGGEWVGGFDISGHFCLVMNLSLVLWLELTELQRYM 192

Query: 183 IEEDMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYW 242
             +++  R   W +T +   +  L  W  +L +T+IYYHT +EK+LG   GY   +++Y+
Sbjct: 193 HSQEIQLRKFAWARTTV---LGALGVWLALLAITAIYYHTFVEKLLGTIFGYSTSLVIYY 249

Query: 243 LIPN 246
           ++P 
Sbjct: 250 VLPR 253

>TBLA0F02500 Chr6 (606934..607917) [984 bp, 327 aa] {ON} Anc_6.117
           YGL126W
          Length = 327

 Score = 44.7 bits (104), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 14/102 (13%)

Query: 134 DHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWLIEEDMVKRLNV 193
           D +  +S++KC K GG W GG D SGH  FL+++ ++ +L +            + + N 
Sbjct: 230 DPTVENSSQKCRKIGGAWSGGHDPSGH-MFLLTLMIMTFLTIS-----------ISKDNY 277

Query: 194 WGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYI 235
               +I      ++++ F  MVT   +HT  E+I G    YI
Sbjct: 278 LFVRLIAAMFGLMSSYSF--MVTIFNFHTFAEQITGFMAAYI 317

>SAKL0A07062g Chr1 complement(628851..630140) [1290 bp, 429 aa] {ON}
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126W SCS3 Protein required for inositol prototrophy
          Length = 429

 Score = 42.0 bits (97), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 65/163 (39%), Gaps = 58/163 (35%)

Query: 140 SAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQH---------LESW------LIE 184
           S++KC   GG+W GG D SGH   +  + M L  ELQ          +E+W       ++
Sbjct: 266 SSQKCKSLGGHWSGGHDPSGHIFLITLMCMFLLGELQMFWSKSRYILVETWSNWYWSFLK 325

Query: 185 EDMVKRLNVWG---------------------------KTIIGITVFTLA---------- 207
           +++ + LN  G                           K +  I+VFT+           
Sbjct: 326 KNIFRLLNNGGLWNVINNDSKDTNIFIQIFLVPPLQCFKCLAKISVFTMRFVAWENPIIL 385

Query: 208 ------TWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLI 244
                  W +  +VT+I +HT+ E++ G    Y+   ++YW +
Sbjct: 386 LVSLVFVWWWNFLVTTIVFHTISEQLSGLICAYVVAGLVYWKV 428

>Skud_7.146 Chr7 (275376..276326) [951 bp, 316 aa] {ON} YGL126W
           (REAL)
          Length = 316

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 50/104 (48%), Gaps = 12/104 (11%)

Query: 140 SAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWLIEEDMVKRLNVWGKTII 199
           ++ +C + GG+W GG D SGH      + M L  EL+      +     ++ ++ G    
Sbjct: 213 TSAQCRRFGGHWAGGHDPSGHVFLTTLMCMFLLGELRVFGRRALAHLYAQKWHLLG---- 268

Query: 200 GITVFTLATWCFILMVTSI--YYHTLLEKILGCAMGYICPIIMY 241
                 + TW + L++T++  ++HT+ E I G    Y+   ++Y
Sbjct: 269 ------MVTWLWQLLLTAVASHFHTVREHISGLLAAYLVTGVVY 306

>KLTH0H06556g Chr8 complement(577648..578739) [1092 bp, 363 aa] {ON}
           weakly similar to uniprot|P53012 Saccharomyces
           cerevisiae YGL126W SCS3 Protein required for inositol
           prototrophy
          Length = 363

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 59/161 (36%), Gaps = 58/161 (36%)

Query: 139 HSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQ------------HLESW----- 181
           +S+  C   GGYW GG D SGH   +  + M L  ELQ            H + W     
Sbjct: 201 NSSNLCRSMGGYWIGGHDPSGHIFLITLMCMFLLGELQAIGKRALRVLKTHNKYWQQLRE 260

Query: 182 ------------------------------LIEEDMVKRLN----------VWGKTIIGI 201
                                         LI  D+ + L           VW   ++ +
Sbjct: 261 HGTSVLTLGGLWNLVAHPPATKKQLFKQLGLIPLDISQHLTQLFGATAKFIVWENPVVLL 320

Query: 202 TVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYW 242
            +FT   W + L++T+I +HTL E++ G    YI    +YW
Sbjct: 321 VLFTFL-WWWSLLITTIAFHTLWEQLSGLLCAYIVAGFVYW 360

>CAGL0I00330g Chr9 (24968..26083) [1116 bp, 371 aa] {ON} weakly
           similar to uniprot|P53012 Saccharomyces cerevisiae
           YGL126w SCS3 inositol phospholipid synthesis protein
          Length = 371

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/151 (23%), Positives = 61/151 (40%), Gaps = 38/151 (25%)

Query: 129 GGSCSDHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQH----------- 177
           G S   +S   ++  C  NGGYW+GG D SGH   L  + + L  E +            
Sbjct: 220 GNSSGANSTLDNSFACRLNGGYWQGGHDPSGHIFLLTLMILFLVGESKQFIVGAVMRVVD 279

Query: 178 ----------------LESWLIEEDMVKRLN----------VWGKTIIGITVFTLATWCF 211
                           + +  + E  V++L           +W   +I + +  LA W +
Sbjct: 280 TRKYVMDKIKKICNEPMANASVYERRVRKLMRCLSFSASYILWENPVI-LLLLLLAIWVW 338

Query: 212 ILMVTSIYYHTLLEKILGCAMGYICPIIMYW 242
             ++T I +HTL E++ G    Y+   ++Y+
Sbjct: 339 NFVITVIVFHTLTEQLSGLFFAYVVGALLYY 369

>KAFR0A04640 Chr1 complement(920274..920987) [714 bp, 237 aa] {ON}
           Anc_6.117 YGL126W
          Length = 237

 Score = 39.7 bits (91), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 60/140 (42%), Gaps = 22/140 (15%)

Query: 128 TGGSCSD----HSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSI---------SMILWLE 174
           TGG C           S++ C K GG W  G D SGH  FL+SI         S I  + 
Sbjct: 99  TGGKCDGGSTSSKLLKSSKHCKKIGGNWINGHDPSGH-IFLLSIMTTFMINEFSKIRRVS 157

Query: 175 LQHLESWLIEEDM-------VKRLNVWGKTIIGITVFTLATWCFILMVTSI-YYHTLLEK 226
           +  L    +E D        VK +       + I +  +  W   L++TSI YYHTL E+
Sbjct: 158 MTQLRQDFVETDWNLDRQLPVKIILFISNNPVIIMLSFILLWWHSLVITSINYYHTLSEQ 217

Query: 227 ILGCAMGYICPIIMYWLIPN 246
           + G    YI    +Y  +P+
Sbjct: 218 LSGLLFAYIIMGPLYLFLPS 237

>TPHA0J01810 Chr10 (415838..417010) [1173 bp, 390 aa] {ON} Anc_6.117
           YGL126W
          Length = 390

 Score = 39.7 bits (91), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 24/76 (31%), Positives = 43/76 (56%), Gaps = 8/76 (10%)

Query: 141 AEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHL-----ESWLIEED-MVKRLNVW 194
           + KC +NGG+W GG D SGH   L  + M++  EL  +     ++ + ++D  ++R+N+ 
Sbjct: 222 SSKCKRNGGHWVGGHDPSGHIFLLTLMMMMIIAELPKINRIRKQNMIYQKDSKIRRVNIV 281

Query: 195 GK--TIIGITVFTLAT 208
            K   IIG  + T+ +
Sbjct: 282 EKISKIIGEIIGTIPS 297

 Score = 35.8 bits (81), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 14/39 (35%), Positives = 23/39 (58%)

Query: 206 LATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLI 244
           L  WC+  ++T I +HT  E++ G    YI  +I+Y L+
Sbjct: 351 LGMWCYSFLITIIVFHTFYEQVTGFLSAYIVAVIIYRLV 389

>KNAG0F02510 Chr6 complement(472542..473282) [741 bp, 246 aa] {ON}
           Anc_6.117 YGL126W
          Length = 246

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 51/118 (43%), Gaps = 17/118 (14%)

Query: 128 TGGSC----SDHSGT---HSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLES 180
           +GGSC    +   GT    ++  C ++GG W+GG D SGH   L  + M L  EL    S
Sbjct: 115 SGGSCLLDPATTPGTLWLSTSAACRRHGGLWQGGHDPSGHMFLLSLMLMFLLSELPAGSS 174

Query: 181 ---------WLIEEDMVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILG 229
                             R  +W +  +     T A W + L+VT+  +HTL E+  G
Sbjct: 175 GGRRRGKHAAFASAAAAARFILWDEPGVLALALT-ACWTWALLVTAARFHTLPEQTSG 231

>TDEL0G03530 Chr7 complement(652945..654051) [1107 bp, 368 aa] {ON}
           Anc_6.117 YGL126W
          Length = 368

 Score = 37.7 bits (86), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 40/171 (23%), Positives = 65/171 (38%), Gaps = 56/171 (32%)

Query: 139 HSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLEL----QHLESWLIEE--------- 185
           +S+  C   GGYW GG D SGH   +  + M L  EL    +   S ++ E         
Sbjct: 200 NSSAVCRTLGGYWVGGHDPSGHIFLITLMIMYLLGELHIFGKRAFSRILREKNMSFKPFI 259

Query: 186 DMVKRLNVWG--------------KTII--------GITVFTLA---------------- 207
           D+     +W                T++          TVF+L                 
Sbjct: 260 DLFDNGAIWNVLSKKPETYSQLFFMTVVQPPLTFANSFTVFSLQLIKFVVLENPVILLVG 319

Query: 208 ---TWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLIPNHDIVRKVLY 255
               W +  +VTS+ +HTL E++ G A  Y+   ++YW   +H  +R  ++
Sbjct: 320 LFLMWWWSFLVTSVVFHTLSEQVSGLAFAYLVAGVIYW--NDHWFIRNAMH 368

>AAR165W Chr1 (639331..640419) [1089 bp, 362 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL126W (SCS3)
          Length = 362

 Score = 36.2 bits (82), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 17/41 (41%), Positives = 23/41 (56%)

Query: 136 SGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQ 176
           S   S+  CS+ GG+W GG D SGH   +  + M +  ELQ
Sbjct: 198 SAIRSSHACSRLGGHWMGGHDPSGHVFLITLMCMFMLGELQ 238

 Score = 30.0 bits (66), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 12/37 (32%), Positives = 21/37 (56%)

Query: 208 TWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYWLI 244
           TW + L+VT + +H+  E + G    Y+  + +YW I
Sbjct: 326 TWTWSLLVTILSFHSFAEHLTGLLFAYLLVLALYWYI 362

>Kwal_14.1796 s14 complement(473935..475026) [1092 bp, 363 aa] {ON}
           YGL126W (SCS3) - involved in inositol biosynthesis
           [contig 237] FULL
          Length = 363

 Score = 35.0 bits (79), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/161 (22%), Positives = 60/161 (37%), Gaps = 58/161 (36%)

Query: 139 HSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLEL------------------QHLES 180
           +S+  C   GG W GG D SGH   +  + M L  EL                  Q + S
Sbjct: 201 NSSNLCRSLGGNWVGGHDPSGHIFLITLMCMFLLGELQVLGKRALRVLRSDRKFWQEVSS 260

Query: 181 WLIE------------------EDMVKRLN---------------------VWGKTIIGI 201
             +E                  ++++++L                      VW   +I +
Sbjct: 261 CFVEIAKLGGIRSVISNSAIDKKEVIRQLGQMPLFFAKQLLALAGATLKFVVWRNPVILL 320

Query: 202 TVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYW 242
            +FT   W + L++T+I +HTL E++ G    Y+    +YW
Sbjct: 321 VLFTF-LWWWSLLITTIAFHTLWEQLSGLLCAYVVAGFVYW 360

>Ecym_3068 Chr3 complement(130025..131128) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii AAR165W
          Length = 367

 Score = 35.0 bits (79), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 22/38 (57%)

Query: 139 HSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQ 176
            + + C K GGYW GG D SGH   +  ++M L  EL+
Sbjct: 203 DNGQMCRKLGGYWTGGHDPSGHVFLITLMTMFLIGELR 240

>NCAS0D03160 Chr4 complement(593886..595058) [1173 bp, 390 aa] {ON}
           Anc_6.117 YGL126W
          Length = 390

 Score = 33.5 bits (75), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 29/53 (54%), Gaps = 4/53 (7%)

Query: 140 SAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLESWLIEEDMVKRLN 192
           ++  C  +GGYW  G D SGH   +  ++M +  ELQ    + I++ M + L+
Sbjct: 226 TSAMCRSHGGYWTMGHDPSGHIFLITLMTMFILGELQ----FFIQDAMARLLH 274

 Score = 33.1 bits (74), Expect = 0.54,   Method: Compositional matrix adjust.
 Identities = 15/56 (26%), Positives = 30/56 (53%), Gaps = 1/56 (1%)

Query: 187 MVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMYW 242
           +  R  +W   II + +  L  W +  ++T++ +HT+ E++ G    Y+   I+YW
Sbjct: 333 LTGRFIIWDNPII-LLITLLVVWLWSFLITTLVFHTVSEQLSGLFFAYMVAGILYW 387

>KLLA0F09526g Chr6 (875250..876263) [1014 bp, 337 aa] {ON} similar
           to uniprot|Q75EB2 Ashbya gossypii AAR165W AAR165Wp and
           weakly similar to YGL126W uniprot|P53012 Saccharomyces
           cerevisiae SCS3 Protein required for inositol
           prototrophy
          Length = 337

 Score = 33.5 bits (75), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%)

Query: 140 SAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLES 180
           S+  CS  GG+W GG D SGH   +  + M+++ EL   +S
Sbjct: 174 SSAGCSYAGGHWVGGHDPSGHIFLITLMLMLMFGELSLYQS 214

 Score = 30.8 bits (68), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 15/55 (27%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 187 MVKRLNVWGKTIIGITVFTLATWCFILMVTSIYYHTLLEKILGCAMGYICPIIMY 241
           ++ R  +W   I+ +   T A W +  +VT + +HT  E++ G    Y+  I++Y
Sbjct: 281 LILRFIIWENPILLLFTLT-ALWSYSFVVTVMLFHTFWEQLSGFVAAYLVCILVY 334

>YGL126W Chr7 (270997..272139) [1143 bp, 380 aa] {ON}  SCS3Protein
           required for inositol prototrophy, identified as an
           ortholog of the FIT family of proteins involved in
           triglyceride droplet biosynthesis; disputed role in the
           synthesis of inositol phospholipids from inositol
          Length = 380

 Score = 33.1 bits (74), Expect = 0.64,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 140 SAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQ 176
           ++ +C + GG+W GG D SGH      + M L  EL+
Sbjct: 215 TSAQCRRFGGHWAGGHDPSGHVFLATLMCMFLLGELR 251

>Smik_7.145 Chr7 (264891..265812,265963..266183) [1143 bp, 380 aa]
           {ON} YGL126W (REAL)
          Length = 380

 Score = 32.7 bits (73), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 21/37 (56%)

Query: 140 SAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQ 176
           ++ +C + GG+W GG D SGH      + M L  EL+
Sbjct: 215 TSAQCRRFGGHWAGGHDPSGHVFLATLMCMFLLGELR 251

>NDAI0I01750 Chr9 (412262..413407) [1146 bp, 381 aa] {ON} Anc_6.117
           YGL126W
          Length = 381

 Score = 32.7 bits (73), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 21/38 (55%)

Query: 139 HSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQ 176
           +++ +C  +GGYW  G D SGH   L  + M L  EL 
Sbjct: 219 NTSAQCRMHGGYWTKGHDPSGHIFLLTLMVMFLSGELS 256

>Kpol_461.2 s461 complement(1735..2928) [1194 bp, 397 aa] {ON}
           complement(1735..2928) [1194 nt, 398 aa]
          Length = 397

 Score = 32.0 bits (71), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 6/68 (8%)

Query: 141 AEKCSKNGGYWEGGFDISGHFCFLVSISMILWLEL------QHLESWLIEEDMVKRLNVW 194
           +  C  +GG+W GG D SGH   L  + M++  E+      ++L S    ED  K+ + +
Sbjct: 230 SSNCRAHGGHWVGGHDPSGHMFILTLMIMLISSEIPRIIKFKYLRSNGRIEDESKKESSF 289

Query: 195 GKTIIGIT 202
            +  I IT
Sbjct: 290 KRICISIT 297

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (60%)

Query: 209 WCFILMVTSIYYHTLLEKILGCAMGYICPIIMY 241
           W +  +VT I +HT+ E+I G    YI  +I+Y
Sbjct: 362 WAYSFLVTIIVFHTISEQITGFLSAYIMAVIIY 394

>ZYRO0A09240g Chr1 complement(741195..742313) [1119 bp, 372 aa] {ON}
           weakly similar to uniprot|P53012 Saccharomyces
           cerevisiae YGL126W SCS3 Protein required for inositol
           prototrophy
          Length = 372

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 22/34 (64%)

Query: 209 WCFILMVTSIYYHTLLEKILGCAMGYICPIIMYW 242
           W + L+VT++ +HT+ E++ G A  Y+    +YW
Sbjct: 327 WWYSLIVTTLVFHTVSEQLSGLACAYLVAGGLYW 360

 Score = 30.4 bits (67), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 14/37 (37%), Positives = 19/37 (51%)

Query: 140 SAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQ 176
           ++  C   GG+W+GG D SGH      + M L  EL 
Sbjct: 204 TSAACRATGGHWKGGHDPSGHIFLNTLMIMFLLGELD 240

>SAKL0H24794g Chr8 (2157080..2157115,2157369..2158043) [711 bp, 236
           aa] {ON} similar to uniprot|P53102 Saccharomyces
           cerevisiae YGL183C MND1 Protein required for
           recombination and meiotic nuclear division forms a
           complex with Hop2p which is involved in chromosome
           pairing and repair of meiotic double-strand breaks
          Length = 236

 Score = 30.0 bits (66), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 10/47 (21%)

Query: 134 DHSGTHSAEKCSKNGGYWEGGFDISGHFCFLVSISMILWLELQHLES 180
           D  G  S EKC     YW          CF   I+M L+ EL++L+S
Sbjct: 69  DEDGVISVEKCGNINVYW----------CFKNQITMSLYKELRNLQS 105

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.142    0.472 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,921,116
Number of extensions: 915587
Number of successful extensions: 2508
Number of sequences better than 10.0: 45
Number of HSP's gapped: 2519
Number of HSP's successfully gapped: 61
Length of query: 255
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 148
Effective length of database: 41,212,137
Effective search space: 6099396276
Effective search space used: 6099396276
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 64 (29.3 bits)