Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D10098g3.487ON27627614860.0
Smik_6.2233.487ON3132646041e-76
Suva_7.4153.487ON3132615935e-75
SAKL0F02882g3.487ON2982695793e-73
Skud_7.4383.487ON3132615701e-71
YGR127W3.487ON3122605631e-70
TDEL0D055503.487ON3102765465e-68
CAGL0I10582g3.487ON3192655162e-63
KNAG0B008403.487ON3132605058e-62
KAFR0C019303.487ON3132784962e-60
NCAS0E008403.487ON3362704948e-60
Kpol_1017.93.487ON3102824901e-59
NDAI0G009703.487ON3322794624e-55
TPHA0D032603.487ON3142634605e-55
KLTH0F14718g3.487ON3002574447e-53
Kwal_55.212173.487ON3032534412e-52
KLLA0E04687g3.487ON3062803752e-42
Ecym_12423.487ON3112563752e-42
TBLA0D029903.487ON3182553701e-41
AFR305W3.487ON3092583393e-37
SAKL0B08646g3.395ON522177770.31
AFR722C1.26ON810155721.6
KAFR0B056408.304ON64358711.6
NDAI0A018007.368ON60231684.6
Skud_13.4328.813ON105568667.7
Kwal_23.3811singletonOFF1577103659.7
Kwal_YGOB_23.38053.401ON2353103659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D10098g
         (276 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {O...   577   0.0  
Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W (...   237   1e-76
Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W (...   233   5e-75
SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {O...   227   3e-73
Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W (...   224   1e-71
YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative pro...   221   1e-70
TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3....   214   5e-68
CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa] ...   203   2e-63
KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON...   199   8e-62
KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.48...   195   2e-60
NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {O...   194   8e-60
Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}...   193   1e-59
NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON...   182   4e-55
TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.48...   181   5e-55
KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} simil...   175   7e-53
Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W...   174   2e-52
KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {O...   149   2e-42
Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON} ...   149   2e-42
TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON...   147   1e-41
AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic hom...   135   3e-37
SAKL0B08646g Chr2 complement(734944..736512) [1569 bp, 522 aa] {...    34   0.31 
AFR722C Chr6 complement(1765861..1768293) [2433 bp, 810 aa] {ON}...    32   1.6  
KAFR0B05640 Chr2 (1161703..1163634) [1932 bp, 643 aa] {ON} Anc_8...    32   1.6  
NDAI0A01800 Chr1 complement(398650..400458) [1809 bp, 602 aa] {O...    31   4.6  
Skud_13.432 Chr13 complement(764153..767320) [3168 bp, 1055 aa] ...    30   7.7  
Kwal_23.3811 s23 complement(444027..448757) [4731 bp, 1577 aa] {...    30   9.7  
Kwal_YGOB_23.3805 s23 complement(441696..448757) [7062 bp, 2353 ...    30   9.9  

>ZYRO0D10098g Chr4 complement(851071..851901) [831 bp, 276 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 276

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/276 (100%), Positives = 276/276 (100%)

Query: 1   MLARRWIYPLPLRCTPEHRAHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGK 60
           MLARRWIYPLPLRCTPEHRAHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGK
Sbjct: 1   MLARRWIYPLPLRCTPEHRAHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGK 60

Query: 61  VPTAFLSQHDLDWEQWNSYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVL 120
           VPTAFLSQHDLDWEQWNSYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVL
Sbjct: 61  VPTAFLSQHDLDWEQWNSYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVL 120

Query: 121 TNNESQDDSSYMVVSNDVYRYQGEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVA 180
           TNNESQDDSSYMVVSNDVYRYQGEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVA
Sbjct: 121 TNNESQDDSSYMVVSNDVYRYQGEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVA 180

Query: 181 STSPGLDWQSEELLKSSDVTKQSIFVPPLKFPPDLNLGTTTHAGFYGTRSQIVLLVSKDR 240
           STSPGLDWQSEELLKSSDVTKQSIFVPPLKFPPDLNLGTTTHAGFYGTRSQIVLLVSKDR
Sbjct: 181 STSPGLDWQSEELLKSSDVTKQSIFVPPLKFPPDLNLGTTTHAGFYGTRSQIVLLVSKDR 240

Query: 241 QKVTFVERVLHNSDEQVSQRSPDHPAEQLKFQFDLN 276
           QKVTFVERVLHNSDEQVSQRSPDHPAEQLKFQFDLN
Sbjct: 241 QKVTFVERVLHNSDEQVSQRSPDHPAEQLKFQFDLN 276

>Smik_6.223 Chr6 (364603..365544) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  237 bits (604), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 124/264 (46%), Positives = 177/264 (67%), Gaps = 11/264 (4%)

Query: 20  AHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWNSY 79
             +FGTW GINK+G++ T+LNLKL  G++R   +   SRG +P  FLS H+ +++ W+SY
Sbjct: 53  GQEFGTWSGINKEGKLATILNLKL--GSERS-TIKSKSRGLLPYIFLSNHEANFKDWDSY 109

Query: 80  NKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVY 139
           +KF N +  L  TGDFNFFYGD    QYK+IDSL +T DVL++   +D  SYMV+SN  +
Sbjct: 110 SKFGNHYDGLKATGDFNFFYGDVIEKQYKVIDSLGRTFDVLSSTCRKDLDSYMVISNGRF 169

Query: 140 RYQG---EETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTS--PGLDWQSE--E 192
                  E+ W KV+LA+ +L  L+ DN+  D+++ IS CFQ+AS S  PG   + +  +
Sbjct: 170 YNTSSIPEKAWEKVKLARDSLEDLVSDNIGLDEETIISSCFQLASKSSLPGTVSKPDVLQ 229

Query: 193 LLKSSDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVLH 251
           +L   +VT  +I+VPPL+ PP  +LG +   G FYGTRSQIVLL+SKD  K TF+ER+++
Sbjct: 230 MLVDPNVTMSTIYVPPLRRPPGDDLGASIPDGDFYGTRSQIVLLISKDSTKATFIERIIY 289

Query: 252 NSDEQVSQRSPDHPAEQLKFQFDL 275
           +SDE V Q S   P E+ +F+F+L
Sbjct: 290 SSDEDVRQYSVSAPKEEKRFEFEL 313

>Suva_7.415 Chr7 (716851..717792) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  233 bits (593), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 125/261 (47%), Positives = 167/261 (63%), Gaps = 11/261 (4%)

Query: 23  FGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWNSYNKF 82
           FGTW GINK+G++ T+LNLK+D   QR       SRG +P  FL+ H   ++ W+ YNKF
Sbjct: 56  FGTWSGINKEGKLATILNLKMDD--QRSCT-KSKSRGMLPFTFLTSHKARFQDWDDYNKF 112

Query: 83  ANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRYQ 142
              +  L  TGDFNFFYGD    +YK+IDSL  T DVL +   +D  SYMV+SN  Y   
Sbjct: 113 EKHYDGLRTTGDFNFFYGDVIEKRYKVIDSLGHTFDVLGSTCRRDPDSYMVISNGKYHNS 172

Query: 143 ---GEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSP----GLDWQSEELLK 195
               E+ W KV++A+ +L  LI DN+  D+++ IS CFQ+AS S     GL     ++L 
Sbjct: 173 SSISEQAWEKVKIARDSLETLILDNIESDEETLISNCFQLASKSSLPDTGLKPDLLQMLV 232

Query: 196 SSDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVLHNSD 254
             +VT  +I+VPPL+ PP  +LG +   G +YGTRSQIVLLVSKD  KVTF+ERVL++SD
Sbjct: 233 DPNVTMNTIYVPPLRRPPGDDLGASIPDGDYYGTRSQIVLLVSKDSSKVTFIERVLYSSD 292

Query: 255 EQVSQRSPDHPAEQLKFQFDL 275
           E VS  S   P E+ +F+F+L
Sbjct: 293 EDVSHYSASAPKEEKRFEFEL 313

>SAKL0F02882g Chr6 complement(243632..244528) [897 bp, 298 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 298

 Score =  227 bits (579), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 117/269 (43%), Positives = 173/269 (64%), Gaps = 17/269 (6%)

Query: 11  PLRCTPEHRAHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLS---SRGKVPTAFLS 67
           P   +   +   FGTWCG+NKDG+V  +LNL++   A  G+P ++    SRG VP  FL+
Sbjct: 43  PFDMSITTKGRNFGTWCGVNKDGKVAVILNLRI---ASCGNPKNVECPQSRGIVPMKFLA 99

Query: 68  QHDLDWEQWNSYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQD 127
             D+D+  W+SY KF++ +  ++ TG+FN FYGDC  G+YK+I SL +T D       Q+
Sbjct: 100 GKDVDFNNWDSYEKFSHHYPGIEKTGNFNLFYGDCSKGEYKLISSLSETTDGF-----QN 154

Query: 128 DSSYMVVSNDVYRYQGEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPGLD 187
           D  YMVVSND+     ++ W K+ LAK  LR L+E +V++ +DS + KCF++AS S    
Sbjct: 155 DDGYMVVSNDL--ISSKKKWGKISLAKNLLRNLVESSVDDTKDSILDKCFKLASHST--- 209

Query: 188 WQSEELLKSSDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFV 246
              + ++K   VT ++I+VPPL      +L  +   G +YGTRSQIV+LVSKD++K+TFV
Sbjct: 210 CSEKIVVKHESVTNETIYVPPLLVENGQDLDVSMPCGKYYGTRSQIVILVSKDQKKMTFV 269

Query: 247 ERVLHNSDEQVSQRSPDHPAEQLKFQFDL 275
           ERVL+  DE V +  P +P EQ++F+FD+
Sbjct: 270 ERVLYTCDEDVLKYGPKNPKEQIEFEFDI 298

>Skud_7.438 Chr7 (726003..726944) [942 bp, 313 aa] {ON} YGR127W
           (REAL)
          Length = 313

 Score =  224 bits (570), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 120/261 (45%), Positives = 172/261 (65%), Gaps = 11/261 (4%)

Query: 23  FGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWNSYNKF 82
           FGTW GIN++G++ T+LNLKLD   QR   +   SRG +P  FLS H  D++ W++Y+KF
Sbjct: 56  FGTWSGINREGKLATILNLKLD--GQR-DTIKSKSRGLLPFTFLSTHKADFQNWDNYDKF 112

Query: 83  ANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRYQ 142
              +  L+ TGDFNFFYGD    QYK+IDSL +T +VL +    + +SYM VSN  +   
Sbjct: 113 EMNYDGLNTTGDFNFFYGDVIEKQYKLIDSLGRTFNVLDSTCKSNLNSYMAVSNGEFYNS 172

Query: 143 ---GEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTS--PGLDWQ--SEELLK 195
               E+ W KV++A+  L KL+  N++ D+++ IS CFQ+AS S  PG   +  + ++L 
Sbjct: 173 PSISEQAWKKVKVARDGLEKLVLGNIDSDEETIISNCFQLASKSSVPGTASKPNALQMLA 232

Query: 196 SSDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVLHNSD 254
             +V   +I+VPPL+ PPD +LG +   G +YGTRSQIVLLVSK+  KVTF+ER+L++SD
Sbjct: 233 DPNVIMNTIYVPPLRRPPDDDLGASIPDGDYYGTRSQIVLLVSKNSSKVTFIERILYSSD 292

Query: 255 EQVSQRSPDHPAEQLKFQFDL 275
           E V+  S   P E+ +F+F L
Sbjct: 293 EDVNHYSVATPKEEKRFEFKL 313

>YGR127W Chr7 (746798..747736) [939 bp, 312 aa] {ON} Putative
           protein of unknown function; expression is regulated by
           Msn2p/Msn4p, indicating a possible role in stress
           response
          Length = 312

 Score =  221 bits (563), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 121/260 (46%), Positives = 165/260 (63%), Gaps = 10/260 (3%)

Query: 23  FGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWNSYNKF 82
           FGTW GINK+G++ T+LNLKLD            SRG +P  FLS H  D+E W++Y KF
Sbjct: 56  FGTWSGINKEGKLATILNLKLDNEQNNTKS---RSRGLLPFIFLSIHKADFEDWDNYKKF 112

Query: 83  ANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRYQ 142
              +  L +TGDFNFFYGD    QYK+IDSL +T DVL++   +D  SYMVVSN  +   
Sbjct: 113 EGHYDGLKSTGDFNFFYGDVIKKQYKVIDSLGRTFDVLSSTCRKDLDSYMVVSNGKFYDS 172

Query: 143 GE---ETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTS--PGLDWQSEEL-LKS 196
                + W KV++A+ +L  L+ +N+  D++  IS CFQ+AS S  P      + L +  
Sbjct: 173 SSIPGQAWEKVKVARDSLENLVLENIESDEEKIISSCFQLASKSSLPSTISNPDVLQMVD 232

Query: 197 SDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVLHNSDE 255
            +VT  +I+VPPL+ PP  +LG +   G +YGTRSQIVLLVSKD  +VTF+ERVL++SDE
Sbjct: 233 PNVTMNTIYVPPLRRPPRDDLGASIPDGDYYGTRSQIVLLVSKDSTRVTFIERVLYSSDE 292

Query: 256 QVSQRSPDHPAEQLKFQFDL 275
            V + S   P E+ +F+F L
Sbjct: 293 DVRKYSVTSPKEEKRFKFKL 312

>TDEL0D05550 Chr4 (1003288..1004220) [933 bp, 310 aa] {ON} Anc_3.487
           YGR127W
          Length = 310

 Score =  214 bits (546), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 120/276 (43%), Positives = 170/276 (61%), Gaps = 21/276 (7%)

Query: 11  PLRCTPEHRAHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHP-LHLSSRGKVPTAFLSQH 69
           PL    +      GTW G N+DG++GTVLNLKL     RG P +   SRGK+P +FLS  
Sbjct: 43  PLDKGLDSSGEDLGTWIGANRDGKIGTVLNLKLFSDP-RGRPAVCPESRGKIPVSFLSSR 101

Query: 70  DLDWEQWNSYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDS 129
             +++ W++Y+KF +QF  L+ T DFNFFYGDC  G Y++IDSL  T  VL     + + 
Sbjct: 102 GANFKDWDTYDKFCHQFQGLEFTRDFNFFYGDCSIGDYRVIDSLGNTTKVL----GKTNE 157

Query: 130 SYMVVSNDVYRYQGE----ETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPG 185
            Y+VVSND+  +QGE      W K+ LA + L  L+ +  + D+D FI +CF +AS +P 
Sbjct: 158 KYIVVSNDI--FQGESNKNRVWDKISLADQALHHLVREFNDTDEDKFIQECFGIASINP- 214

Query: 186 LDWQSEE-----LLKSSDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKD 239
             + S+       +K+ +++ Q++FVPPLK   D  LG +   G +YGTRSQ V+LVSKD
Sbjct: 215 --FHSKHDHGNYYMKAVELSMQTVFVPPLKTSCDDGLGASVPIGEYYGTRSQTVILVSKD 272

Query: 240 RQKVTFVERVLHNSDEQVSQRSPDHPAEQLKFQFDL 275
           R  +T+VER++H+SD    Q S DH  EQ ++ FDL
Sbjct: 273 RSHITYVERIIHDSDLDALQYSRDHYKEQKRYDFDL 308

>CAGL0I10582g Chr9 complement(1046028..1046987) [960 bp, 319 aa]
           {ON} similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127w
          Length = 319

 Score =  203 bits (516), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 105/265 (39%), Positives = 163/265 (61%), Gaps = 16/265 (6%)

Query: 23  FGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWNSYNKF 82
           FGTW G+N+ GRV TVLNL++         +   SRG +P  FL+    ++E W++Y KF
Sbjct: 58  FGTWTGVNRKGRVATVLNLRICDELDMKRMIGERSRGALPFVFLNDRQGNFEDWDTYAKF 117

Query: 83  ANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRY- 141
              + ++  TGDFN FYGD K G+Y +IDSL  TH +     S+    Y+V+SN+++   
Sbjct: 118 CKCYPDIKRTGDFNLFYGDFKEGRYALIDSLGNTHPLF----SKPGKGYLVISNNIHDKL 173

Query: 142 --------QGEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPGLDWQSEE- 192
                    G E W K++  K+ + + ++ N N  ++  I  CF++AST+  LD  +EE 
Sbjct: 174 HLQSQDINSGPEEWGKIKKGKQIMEEFVKTNTNLGKEDVIENCFKLASTNLILDKITEEF 233

Query: 193 -LLKSSDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVL 250
            L+KS  VTK++I+V PL  PP   +G+   AG +YGTRSQIVLLV K + K TF+ER++
Sbjct: 234 DLVKSLGVTKETIYVQPLLTPPHEEIGSPLTAGQYYGTRSQIVLLVDKSKTKATFIERII 293

Query: 251 HNSDEQVSQRSPDHPAEQLKFQFDL 275
           ++SD+ +S  S  +P E+L++++D+
Sbjct: 294 YSSDQDISLYSTSNPKEELRYEYDI 318

>KNAG0B00840 Chr2 complement(153939..154880) [942 bp, 313 aa] {ON}
           Anc_3.487 YGR127W
          Length = 313

 Score =  199 bits (505), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 115/260 (44%), Positives = 154/260 (59%), Gaps = 13/260 (5%)

Query: 24  GTWCGINKDGRVGTVLNLKLDQGAQRGH---PLHLSSRGKVPTAFLSQHDLDWEQWNSYN 80
           GTW G+N+ GRV TVLNLKL+  A R H   P+   SRG +P  FLS      +QW+S+ 
Sbjct: 59  GTWMGLNRAGRVSTVLNLKLEGEALRKHSKNPVKRRSRGLIPFMFLSDRGF-IDQWDSFE 117

Query: 81  KFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYR 140
           KF +++ +L+ +GDFN F GD +   YK++DS   T  VL      +    MVVSND Y+
Sbjct: 118 KFRDRYPDLEKSGDFNLFIGDIRQQDYKVLDSSGNTFSVLNETTGMN----MVVSNDTYK 173

Query: 141 YQGE---ETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPGLDWQSEELLKSS 197
              E     W KV+L K  L +L+   VN D+ SFI KCF  AS    ++   E++ K+ 
Sbjct: 174 EFNENDISEWNKVKLGKLKLHELVNTAVNLDKSSFIDKCFHAASFC-SIEKSHEDISKTP 232

Query: 198 DVTKQSIFVPPLKFPPDLNLGTTTHAGFY-GTRSQIVLLVSKDRQKVTFVERVLHNSDEQ 256
           +V   +IFVPPLK  P  ++G T   G Y GTRSQ+V LVSKDR++VT  ER+LH SD  
Sbjct: 233 EVISNTIFVPPLKCQPQQDVGLTKSGGLYFGTRSQLVTLVSKDRRQVTVAERILHTSDLD 292

Query: 257 VSQRSPDHPAEQLKFQFDLN 276
               SP +P E  +F FDL+
Sbjct: 293 RDFNSPHNPKEVKQFTFDLS 312

>KAFR0C01930 Chr3 (386752..387693) [942 bp, 313 aa] {ON} Anc_3.487
           YGR127W
          Length = 313

 Score =  195 bits (496), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 104/278 (37%), Positives = 161/278 (57%), Gaps = 19/278 (6%)

Query: 9   PLPLRCTPEHRAHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQ 68
           P  +     H    FGTW G+NK G++ T+LNL+          +   SRG +P  FL  
Sbjct: 43  PYDMSREENHGNKIFGTWLGMNKKGKIATILNLRRFSSIDLKELVKPRSRGLIPFTFLYS 102

Query: 69  HDLDW------EQWNSYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTN 122
              DW      E+W ++ KF +++  L ++GDFNFFYGD K G Y+IIDSL  T  VL N
Sbjct: 103 ---DWTNEDSFEEWETFEKFKSKYPFLQSSGDFNFFYGDIKEGNYRIIDSLGNTFKVLDN 159

Query: 123 NESQDDSSYMVVSNDVYR----YQGEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQ 178
           N        M++SND+Y+    Y+G+ TW K+++  + L K +++    ++D  ++KCF+
Sbjct: 160 NNRN-----MIISNDLYQHKDEYEGKPTWGKIKIGAERLNKFLKETERSNEDEVLAKCFE 214

Query: 179 VASTSPGLDWQSEELLKSSDVTKQSIFVPPLKFPPDLNLG-TTTHAGFYGTRSQIVLLVS 237
           +AS        + E   + ++  ++I+VPPLK  PD ++G T T+  +YGTR+QIV+LV 
Sbjct: 215 LASYCSIDSSITREENPNKELAAETIYVPPLKVCPDEDIGLTKTNGKYYGTRTQIVVLVH 274

Query: 238 KDRQKVTFVERVLHNSDEQVSQRSPDHPAEQLKFQFDL 275
           KDR+ VT VE  +HNSDE++ + S  +P E  +  F +
Sbjct: 275 KDRKHVTLVEHTIHNSDEEIYKYSGLNPKEVQRLDFTI 312

>NCAS0E00840 Chr5 complement(154182..155192) [1011 bp, 336 aa] {ON}
           Anc_3.487 YGR127W
          Length = 336

 Score =  194 bits (494), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 159/270 (58%), Gaps = 17/270 (6%)

Query: 18  HRAHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWN 77
           H    FGTW GIN+D ++ T+LNLKL+        +   SRG +P  FLS+HD D+ +W+
Sbjct: 69  HEKKIFGTWIGINRDAKIATILNLKLESQLDLKQLVKPQSRGMIPFVFLSEHDSDFNKWD 128

Query: 78  SYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSND 137
           +Y KF  +++ L  TGDFNFFYGD  N +Y+IIDS   T  VL+ +       Y+ VSND
Sbjct: 129 TYEKFDGKYNYLRKTGDFNFFYGDPLNDEYRIIDSKGNTFKVLSGD------PYLTVSND 182

Query: 138 VYRYQGEET----------WPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPGLD 187
           ++   G             W K++  K  L+ L+E++ + D+D  I KCF++AST     
Sbjct: 183 MFATGGITVERASNNRIAEWRKIKFGKILLQDLVEESKSLDEDMLIEKCFKLASTCSVQP 242

Query: 188 WQSEELLKSSDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFV 246
            ++ +  ++S +  ++IFVPPL+   + ++GT+   G +YGTRSQIV+L+SK+ ++V  V
Sbjct: 243 KENTKFNQNSTLPMETIFVPPLECEVNDDIGTSLSVGKYYGTRSQIVILISKNHERVKLV 302

Query: 247 ERVLHNSDEQVSQRSPDHPAEQLKFQFDLN 276
           E +L+ SD  +   S  +P E   F+F  N
Sbjct: 303 EHILYTSDNDIQHYSSTNPKEVKSFEFKPN 332

>Kpol_1017.9 s1017 complement(28899..29831) [933 bp, 310 aa] {ON}
           complement(28899..29831) [933 nt, 311 aa]
          Length = 310

 Score =  193 bits (490), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 114/282 (40%), Positives = 165/282 (58%), Gaps = 23/282 (8%)

Query: 5   RWIYPLPLRCTPEHRAHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTA 64
           R + P  +  + E   +K GTWCGIN+ GRV T+LNLK D   Q   P    SRG +P  
Sbjct: 41  RILCPYDMSKSNEKNVNKIGTWCGINEFGRVSTILNLKNDDSFQSSVPSTKKSRGALPIK 100

Query: 65  FLSQHDLD-WEQWNSYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNN 123
           FL   + D    W+SY KF  ++  +  TGDFNFFYGD + G+Y +IDS+  T++VLT  
Sbjct: 101 FLDNKETDSLLNWDSYEKFVKEYPFVKETGDFNFFYGDVRIGKYNVIDSIGSTNEVLTV- 159

Query: 124 ESQDDSSYMVVSNDVY-RYQGEET--WPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVA 180
               D+ Y+V+SND + +  G+ T  W K+ LAK  L+ L    + E +D  I KCF +A
Sbjct: 160 ----DNPYLVISNDKFGKSNGKSTKEWEKITLAKNLLKHL---PLCETEDDLIHKCFDIA 212

Query: 181 STSPGLDWQSEELLKSSDVTK---QSIFVPPLKF---PPDLNLGTTTHAG-FYGTRSQIV 233
           ST+      +E+L+K  DV +   ++I VPPL          +G +   G +YGTRSQIV
Sbjct: 213 STNT----LNEDLIKDVDVRELMTETILVPPLNVMTKEEKEKIGASLPIGQYYGTRSQIV 268

Query: 234 LLVSKDRQKVTFVERVLHNSDEQVSQRSPDHPAEQLKFQFDL 275
           +LV+K+R KV F+ER+L+NSD+ V+ +    P + L + F +
Sbjct: 269 ILVNKNRTKVKFIERILYNSDDDVTTQKLSSPIQDLTYNFTI 310

>NDAI0G00970 Chr7 complement(202186..203184) [999 bp, 332 aa] {ON}
           Anc_3.487 YGR127W
          Length = 332

 Score =  182 bits (462), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 156/279 (55%), Gaps = 30/279 (10%)

Query: 23  FGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLD-WEQWNSYNK 81
           FGTW GINKDG++ TVLNLKL++       +   SRG +P  +LS    D + +W+ Y+ 
Sbjct: 58  FGTWLGINKDGKIATVLNLKLNKSLSLKQLVAPKSRGMLPFVYLSDMTEDSFAEWDGYDN 117

Query: 82  FANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRY 141
           F  ++  L +TGDFN FYGD K  QY+I+DS+  T   L +N       Y+VVSNDV+  
Sbjct: 118 FTKKYPGLQSTGDFNLFYGDVKRKQYRIMDSIGNTVSTLNSN-----CQYLVVSNDVFTC 172

Query: 142 QGE---------------------ETWPKVQLAKKNLRKLIEDNVNE--DQDSFISKCFQ 178
            G+                     ETW KV+L    L+ L+  ++ E  D+D+ IS+CF+
Sbjct: 173 NGQLGELQSNIKREGKQPCLQSKIETWGKVKLGTALLQSLVNKSIVEKQDEDTIISECFK 232

Query: 179 VASTSPGLDWQSEELLKSSDVTKQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVS 237
           ++ST         +  ++S +  ++I VPPL+     ++GT+   G +YGTRSQIV+L+ 
Sbjct: 233 LSSTCSVTVEDHCKFHQNSTLPNETILVPPLRCKITDDVGTSLPIGEYYGTRSQIVILIK 292

Query: 238 KDRQKVTFVERVLHNSDEQVSQRSPDHPAEQLKFQFDLN 276
           +   +V F E V++ SD  +   SP +P E ++F F LN
Sbjct: 293 RGTYEVKFAEHVIYTSDSDIKTFSPANPKETVRFDFTLN 331

>TPHA0D03260 Chr4 (672002..672946) [945 bp, 314 aa] {ON} Anc_3.487
           YGR127W
          Length = 314

 Score =  181 bits (460), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 101/263 (38%), Positives = 157/263 (59%), Gaps = 15/263 (5%)

Query: 22  KFGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFL-SQHDLDWEQWNSYN 80
           KFGTWCGIN+ GRV +VLNLK+D+       +   SRG +P  FL ++ +  +  WNSY+
Sbjct: 57  KFGTWCGINEFGRVSSVLNLKMDENKVEDKNVRKKSRGYLPVKFLDNRKENSFNDWNSYS 116

Query: 81  KFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYR 140
           KF  Q+ +L+ TG FN F GD K  +Y +IDS  QT  +L   +    SS +V+SN  + 
Sbjct: 117 KFLKQYPDLEKTGSFNLFIGDVKKQEYALIDSFGQTKRILDGKDENGKSS-VVISNSEFI 175

Query: 141 YQGEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPGLDWQSEELLKSS--- 197
              +E W K+   +K + + +  ++  D++S I  CF++ASTS      + E L S    
Sbjct: 176 SNDKERWHKISNGEKLMDEFLSKDI-RDENSVIESCFKIASTSE----LTNEYLHSHDDI 230

Query: 198 -DVTKQSIFVPPLKFPPDL---NLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVLHN 252
            D+  +++FVPP+K    +   N+G +   G FYGTRSQIV+LV+K+R  V ++ERVL+ 
Sbjct: 231 LDLMTETVFVPPIKLENPVEKDNIGASLPVGKFYGTRSQIVILVNKERTTVRYMERVLYE 290

Query: 253 SDEQVSQRSPDHPAEQLKFQFDL 275
            D+ VS+   + P  +L F++++
Sbjct: 291 CDDDVSKAGIEKPINELNFEYNI 313

>KLTH0F14718g Chr6 (1207203..1208105) [903 bp, 300 aa] {ON} similar
           to uniprot|P53275 Saccharomyces cerevisiae YGR127W
           Hypothetical ORF
          Length = 300

 Score =  175 bits (444), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 150/257 (58%), Gaps = 17/257 (6%)

Query: 23  FGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWNSYNKF 82
            GTWCG+N+ GRV  +LNL+  + A+R       SRG VP  +L       + WNS+ KF
Sbjct: 56  LGTWCGVNRKGRVAVILNLRNKEPAKRIPVKSPISRGSVPMKYLMDRGPSTD-WNSFEKF 114

Query: 83  ANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRYQ 142
            +++ ++    +FN FYGDC  G+Y  IDSL  + + LT N+       +V+SND     
Sbjct: 115 VSKYPQITEC-EFNMFYGDCIAGEYTCIDSLGYSSEALTANKPN-----LVLSND--HID 166

Query: 143 GEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVAS-TSPG-LDWQSEELLKSSDVT 200
               WPKVQ A   L++L++ + ++ ++  I KCF +AS T P  +D   +E     + T
Sbjct: 167 SSSRWPKVQKADILLQELVQSSQHDSEEELIEKCFALASNTEPAEIDNSDKE-----EFT 221

Query: 201 KQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVLHNSDEQVSQ 259
             SIF+PP++ P  +++G +   G FYGTRSQIV+LV +  + ++F ERVLH+SD +V  
Sbjct: 222 CSSIFIPPVEIPEKVDVGASLPCGRFYGTRSQIVILVKRHERTISFTERVLHDSDFEVPL 281

Query: 260 RSPDHPAEQLKFQFDLN 276
            S  HP E+L+F   ++
Sbjct: 282 HSEKHPKEKLQFNLHVD 298

>Kwal_55.21217 s55 (733995..734906) [912 bp, 303 aa] {ON} YGR127W -
           Hypothetical ORF [contig 131] FULL
          Length = 303

 Score =  174 bits (441), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 95/253 (37%), Positives = 150/253 (59%), Gaps = 14/253 (5%)

Query: 23  FGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQHDLDWEQWNSYNKF 82
            GTWCG N++GR+  +LNL+     Q      + SRG V   +L+        WNSY KF
Sbjct: 56  LGTWCGANRNGRIAVILNLRTGNTNQTKTK-RIVSRGNVTMRYLTDKQ-PASDWNSYAKF 113

Query: 83  ANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRYQ 142
           A++  ++  + +FN FYGDCK+G Y  IDS   + +VL     +  + Y+V+SND    +
Sbjct: 114 ASKCPDI-KSCEFNMFYGDCKSGDYTAIDSSGHSFEVL-----RSQNPYLVISND--SIE 165

Query: 143 GEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPGLDWQSEELLKSSDVTKQ 202
               WPK++LA+K +R L+ D+VN+ +D  +++CF +AS     D+  + + K   VT  
Sbjct: 166 SATKWPKIELAEKLMRDLVRDSVNDSEDDLLARCFSLASHKQ--DYNVDHMDKEK-VTSS 222

Query: 203 SIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVLHNSDEQVSQRS 261
           +IFVPPL+ P   +LG +   G FYGTRSQIV+LVSK+ + + FVE VL++SD + +   
Sbjct: 223 NIFVPPLEVPKSEDLGASVPCGRFYGTRSQIVVLVSKEDKSIRFVEHVLYDSDPETTHFC 282

Query: 262 PDHPAEQLKFQFD 274
             +P + + ++ +
Sbjct: 283 AANPKKCVSYKIN 295

>KLLA0E04687g Chr5 complement(416178..417098) [921 bp, 306 aa] {ON}
           similar to uniprot|P53275 Saccharomyces cerevisiae
           YGR127W Hypothetical ORF
          Length = 306

 Score =  149 bits (375), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/280 (35%), Positives = 144/280 (51%), Gaps = 33/280 (11%)

Query: 11  PLRCTPEHRAHKFGTWCGINKDGRVGTVLNLKLDQGAQ------RGHPLHLSSRGKVPTA 64
           P     E +   +GTW GIN+ GR+  +LNLK+D           G P    SRG VP  
Sbjct: 43  PYDMAIEKKGQGYGTWLGINRRGRIAVILNLKIDSPLDSESVLVNGEP---RSRGIVPLQ 99

Query: 65  FLSQHD-LDWEQWNSYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNN 123
           FL Q D   ++ W+S+ KF  Q   L  TG F  FYGD K+ +Y +ID L+ + +     
Sbjct: 100 FLQQEDNAPFDNWDSWEKFNGQHGNLRRTGPFTLFYGDAKSDEYNVIDYLKHSTNPFEKM 159

Query: 124 ESQDDSSYMVVSNDVYRYQ-GEET--WPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVA 180
           E      +MV+SND++    GE T  W K +     L  L ++     ++  + KCF++ 
Sbjct: 160 E------HMVISNDIFHCAVGEHTSRWNKTEYGYVLLDALAKNTTGIAKEELLQKCFELL 213

Query: 181 ST---SPGLDWQSEELLKSSDVTKQSIFVPPLKFPPDLN-LGTTTHAG-FYGTRSQIVLL 235
           S    + G D  S        VT  SI+VPPL+     + +GT+   G +YGTRSQIV+L
Sbjct: 214 SNHTFNEGEDVDS--------VTTSSIYVPPLRITKGADAIGTSLPIGDYYGTRSQIVIL 265

Query: 236 VSKDRQKVTFVERVLHNSDEQVSQRSPDHPAEQLKFQFDL 275
           V KD  +VT+ E V++ SDE     S   P E ++FQF++
Sbjct: 266 VDKD-NRVTYEEHVIYESDEDCETYSFMDPKEVIQFQFNM 304

>Ecym_1242 Chr1 complement(495583..496518) [936 bp, 311 aa] {ON}
           similar to Ashbya gossypii AFR305W
          Length = 311

 Score =  149 bits (375), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/256 (33%), Positives = 146/256 (57%), Gaps = 10/256 (3%)

Query: 23  FGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQ-HDLDWEQWNSYNK 81
           +GTW GIN+ G V  +LNLK    A      +  SRG V  AFL    + +W++WN+Y K
Sbjct: 62  YGTWLGINRVGHVSVLLNLKEVSEAVNPGAGNRKSRGNVTVAFLRDLSNGNWDKWNNYEK 121

Query: 82  FANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVYRY 141
           F+  F+ LD+T  F  FYGD K G + +IDS +++ +  ++ +      Y+V+SN     
Sbjct: 122 FSEHFAALDDTQSFTLFYGDIKTGDFGLIDSYKRSMNPFSSKQ-----PYVVISNSRVNC 176

Query: 142 QGE-ETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPGLDWQSEELLKSSDVT 200
           + E   W KV   ++ L++L++ N+N  ++  + KCF++A TS   D      +  + + 
Sbjct: 177 EDEGPRWKKVVEGEQLLKELVKGNLNVSKEHLLQKCFELAGTSQ-FDVNGVIQVTDTSLP 235

Query: 201 KQSIFVPPLKFPPDLNLGTTTHAG-FYGTRSQIVLLVSKDRQKVTFVERVLHNSDEQVSQ 259
           +++IFVP LK   + ++G +   G +YGTR+ IV+LV  +   VT  E V+H+SD+ +  
Sbjct: 236 EKTIFVPTLKAAGNSSMGVSKIVGEYYGTRTTIVILVD-NFNHVTMHEHVIHDSDKDIGL 294

Query: 260 RSPDHPAEQLKFQFDL 275
            S  +P  ++ ++FD+
Sbjct: 295 SSAMNPKTKVAYEFDI 310

>TBLA0D02990 Chr4 complement(725170..726126) [957 bp, 318 aa] {ON}
           Anc_3.487 YGR127W
          Length = 318

 Score =  147 bits (370), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 97/255 (38%), Positives = 137/255 (53%), Gaps = 34/255 (13%)

Query: 24  GTWCGINKDGRVGTVLNLKLDQGAQRGHPLH--LSSRGKVPTAFLSQHDLDWEQWNSYNK 81
           GTWCG+NKDG++ TVLNL  ++ A+R    +  L SRG +P  +L   D  ++ WN+Y+K
Sbjct: 65  GTWCGLNKDGKICTVLNLLKEEEARRDGDCNNSLQSRGLIPIKYLCDFDHGFQDWNTYDK 124

Query: 82  FANQFSELDN-TGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSNDVY- 139
           F  Q   +D   G FN F GD K+ +Y II+S+ Q+  VL      +++ YMVVSN  + 
Sbjct: 125 FIEQNGSIDGKVGLFNLFLGDLKSNEYSIINSMGQSQRVL-----DEENPYMVVSNINWG 179

Query: 140 --RYQGEETWPKVQLAKKNLRKLIED---NVNEDQDSFISKCFQVAST----SPGLDWQS 190
             +  GE  W K++   K L  LI D   N N+D+   +  CFQ++ST       +D   
Sbjct: 180 DPKKMGE--WSKIKNGIKLLETLINDKLDNSNKDELEILEDCFQISSTINLSGKKIDGNI 237

Query: 191 EELLKSSDVTKQSIFVPPLKFPPD----------LNLGTTTHAGFYGTRSQIVLLVSKDR 240
           E L ++ D+    IFVPPLK                        +YGTRSQIV+L  +  
Sbjct: 238 ERLEQTKDL----IFVPPLKRSEGEVRGDAGGDAGGDAGGESVKYYGTRSQIVVLCERKS 293

Query: 241 QKVTFVERVLHNSDE 255
            KVTFVER+LH  +E
Sbjct: 294 NKVTFVERILHCKNE 308

>AFR305W Chr6 (995054..995983) [930 bp, 309 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR127W
          Length = 309

 Score =  135 bits (339), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 95/258 (36%), Positives = 136/258 (52%), Gaps = 18/258 (6%)

Query: 24  GTWCGINKDGRVGTVLNLK-LDQGAQRGHPLHLSSRGKVPTAFLSQHDLD-WEQWNSYNK 81
           GTW GIN+ G V  +LNL   D     G+  H  SRG V   +L   D + W+ WN+Y K
Sbjct: 61  GTWIGINRAGHVSVLLNLAPKDADGDHGYS-HRHSRGAVTMEYLKDFDHNNWDSWNTYEK 119

Query: 82  FANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMVVSN---DV 138
           F   F  L  T  F  FYGD  N Q+ +I+SL QT D  +       S Y VVSN   D 
Sbjct: 120 FGAHFPTLYKTKLFTHFYGDVVNSQFSVINSLGQTLDPFSQ------SPYYVVSNGPSDG 173

Query: 139 YRYQGEETWPKVQLAKKNLRKLIEDNVNEDQDSFISKCFQVASTSPGLDWQSEELLKSSD 198
            +  G+  WPKV    +  +K+I+++++  ++  + +CF +AS S  +  Q   +   S 
Sbjct: 174 AKALGQ--WPKVVEGNQLFKKMIQESLDVSEEELLQRCFNLASYSQYVSNQPIGVHDDS- 230

Query: 199 VTKQSIFVPPL-KFPPDLNLGTTTHAGFYGTRSQIVLLVSKDRQKVTFVERVLHNSDEQV 257
           + K++IFVP L       NL       +YGTRS IV+LVS+D   VT  E V+H+SD+ +
Sbjct: 231 IPKRTIFVPALYNLSGQANLSFAA-GMYYGTRSTIVMLVSEDGNVVT-REHVIHDSDQDL 288

Query: 258 SQRSPDHPAEQLKFQFDL 275
              S  +P EQ+  +F L
Sbjct: 289 DSYSILNPKEQVTHRFSL 306

>SAKL0B08646g Chr2 complement(734944..736512) [1569 bp, 522 aa] {ON}
           highly similar to uniprot|P20424 Saccharomyces
           cerevisiae YPR088C SRP54 Signal recognition particle
           (SRP) subunit (homolog of mammalian SRP54) contains the
           signal sequence-binding activity of SRP interacts with
           the SRP RNA and mediates binding of SRP to signal
           receptor contains GTPase domain
          Length = 522

 Score = 34.3 bits (77), Expect = 0.31,   Method: Compositional matrix adjust.
 Identities = 35/177 (19%), Positives = 74/177 (41%), Gaps = 18/177 (10%)

Query: 36  GTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLS--QHDLDWEQWN------------SYNK 81
           G ++  K+D  A+ G  +   +  K P  F+   +H  D+E+++                
Sbjct: 246 GAIILTKMDGHAKGGGAISAVAATKTPIIFIGTGEHIHDFEKFSPKSFVSKLLGIGDIES 305

Query: 82  FANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVLTNNESQDDSSYMV-VSNDVYR 140
              QF  + NT D      + + G++ ++D  +Q   ++      + ++ +  +SN + +
Sbjct: 306 LMEQFQTVSNTEDTKATMKNIQQGKFTLLDFQKQMQTIMKMGPLSNIANMIPGMSNMMNQ 365

Query: 141 YQGEETWPKVQLAKKNLRKLIEDNVNEDQDSFI---SKCFQVASTSPGLDWQSEELL 194
              EET  K++     L  +  + +  D   FI   S+  +VA  S    ++ E +L
Sbjct: 366 VSEEETTKKMKKIVYVLDSMTREELESDGRIFIEQPSRLIRVARGSGTTVFEVEMIL 422

>AFR722C Chr6 complement(1765861..1768293) [2433 bp, 810 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR520C
          Length = 810

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 33/155 (21%), Positives = 60/155 (38%), Gaps = 12/155 (7%)

Query: 9   PLPLRCTPEHRAHKFGTWCGINKDGRVGTVLNLKLDQGAQRGHPLHLSSRGKVPTAFLSQ 68
           P   +C   HR H     C + KD +      L+  +G+    P  L    +  ++  +Q
Sbjct: 117 PTAGKC---HRCHVLNLECSLTKDRQADI---LRAAEGSGEEGPYRLPHVAQSNSS--NQ 168

Query: 69  HDLDWEQWNSYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSL--RQTHDVLTNNESQ 126
             L  +Q        NQ S L N  DF        N      +++  R T   +   +S+
Sbjct: 169 RGLGMDQ--RLQILENQISGLSNKLDFILLLLQGSNTAILNANAMGGRSTRAYMGAKDSE 226

Query: 127 DDSSYMVVSNDVYRYQGEETWPKVQLAKKNLRKLI 161
              +    S+D   Y+G+  WP ++   + L +++
Sbjct: 227 ASPAVSNASDDEANYKGQLGWPPLETGAEKLTRIL 261

>KAFR0B05640 Chr2 (1161703..1163634) [1932 bp, 643 aa] {ON}
           Anc_8.304 YDR137W
          Length = 643

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 29/58 (50%), Gaps = 4/58 (6%)

Query: 144 EETWPKVQLAKKNLRKLIEDNVNE--DQDSFISKCFQVASTSPGLDWQSEELLKSSDV 199
           +E+  K++  KKN  KLIE N NE  D D  I    QVA   P LD  S+     S V
Sbjct: 368 KESTEKIEFLKKNFIKLIESNENEAKDVDELIE--LQVAEQFPKLDELSDNEYSVSSV 423

>NDAI0A01800 Chr1 complement(398650..400458) [1809 bp, 602 aa] {ON}
           Anc_7.368 YER087W
          Length = 602

 Score = 30.8 bits (68), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 21/31 (67%)

Query: 145 ETWPKVQLAKKNLRKLIEDNVNEDQDSFISK 175
           + WPKV++  +N+ K   DN  +D+ SF++K
Sbjct: 531 KNWPKVEVEMRNIPKYYNDNDGKDEKSFLAK 561

>Skud_13.432 Chr13 complement(764153..767320) [3168 bp, 1055 aa]
           {ON} YML100W (REAL)
          Length = 1055

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 16/68 (23%), Positives = 33/68 (48%), Gaps = 8/68 (11%)

Query: 154 KKNLRKLIEDNVNEDQDSFISKCFQVAS--------TSPGLDWQSEELLKSSDVTKQSIF 205
           ++  +KL +  +  D D++I+KCF+  +        TS   +  SE+       +K+ +F
Sbjct: 738 RRRWKKLFKSVIEHDSDNWIAKCFEYVNNAWESNQETSTVFNLASEKFCADYKASKKHLF 797

Query: 206 VPPLKFPP 213
           +  +  PP
Sbjct: 798 IFKISEPP 805

>Kwal_23.3811 s23 complement(444027..448757) [4731 bp, 1577 aa] {OFF}
            YBR136W (MEC1) - similar to
            phosphatidylinositol(PI)3-kinases required for DNA damage
            induced checkpoint responses in G1, S/M, intra S, and
            G2/M in mitosis [contig 255] PARTIAL
          Length = 1577

 Score = 29.6 bits (65), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 49/103 (47%), Gaps = 17/103 (16%)

Query: 31   KDGRVGTVLNLKLD---QGAQRGHPLHL-SSRGKVPTAFLSQHDLDW---------EQWN 77
            K+G  G + NL LD    G + GHPLH+ SS  +    FLS++ L +         E+ +
Sbjct: 1235 KEGYKGWLKNLTLDLLKTGTEEGHPLHVFSSLIREDDGFLSENLLPYVVMDILIKAEEHS 1294

Query: 78   SYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVL 120
             Y  + N   +++    F F +    + Q   IDS++  ++ +
Sbjct: 1295 VYQGYVNNI-KVEFVSIFEFDHSSLNHYQ---IDSIKMCYETV 1333

>Kwal_YGOB_23.3805 s23 complement(441696..448757) [7062 bp, 2353 aa]
            {ON} ANNOTATED BY YGOB -
          Length = 2353

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 28/103 (27%), Positives = 49/103 (47%), Gaps = 17/103 (16%)

Query: 31   KDGRVGTVLNLKLD---QGAQRGHPLHL-SSRGKVPTAFLSQHDLDW---------EQWN 77
            K+G  G + NL LD    G + GHPLH+ SS  +    FLS++ L +         E+ +
Sbjct: 1235 KEGYKGWLKNLTLDLLKTGTEEGHPLHVFSSLIREDDGFLSENLLPYVVMDILIKAEEHS 1294

Query: 78   SYNKFANQFSELDNTGDFNFFYGDCKNGQYKIIDSLRQTHDVL 120
             Y  + N   +++    F F +    + Q   IDS++  ++ +
Sbjct: 1295 VYQGYVNNI-KVEFVSIFEFDHSSLNHYQ---IDSIKMCYETV 1333

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.411 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,773,016
Number of extensions: 1507105
Number of successful extensions: 4901
Number of sequences better than 10.0: 45
Number of HSP's gapped: 4971
Number of HSP's successfully gapped: 45
Length of query: 276
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 168
Effective length of database: 41,097,471
Effective search space: 6904375128
Effective search space used: 6904375128
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 65 (29.6 bits)