Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D10076g3.488ON30530515740.0
TDEL0D055603.488ON3113097791e-103
TPHA0D042203.488ON3163167349e-96
TBLA0C044503.488ON3093097261e-94
Kpol_480.173.488ON3133117191e-93
NCAS0F035303.488ON3133146549e-84
YPR147C3.488ON3043086321e-80
Smik_16.4003.488ON3043086302e-80
Suva_16.4763.488ON3043086286e-80
CAGL0L08514g3.488ON3123136192e-78
Skud_16.4423.488ON3043086131e-77
SAKL0F02860g3.488ON3052766015e-76
NDAI0B058303.488ON3293316002e-75
Kwal_55.212193.488ON3022775921e-74
KLTH0F14740g3.488ON3022995391e-66
Ecym_12413.488ON3052845346e-66
AFR306C3.488ON3192835105e-62
Smik_2.3458.524ON3751621085e-05
Skud_2.3318.524ON3761631042e-04
YBR204C (LDH1)8.524ON375163970.001
Suva_4.4598.524ON375163950.002
KAFR0E03110singletonON356110880.016
TDEL0B032508.524ON348140850.036
TBLA0H035408.524ON378133780.24
Suva_11.1312.487ON313163740.70
NDAI0C054308.524ON362112731.0
KAFR0E031208.524ON346137731.1
NCAS0B022608.524ON363136721.6
ZYRO0F09064g8.524ON349110711.6
KLTH0D05742g2.487ON313148711.7
YKL094W (YJU3)2.487ON313163711.7
TPHA0L016008.524ON372127702.2
KNAG0A037708.524ON356133692.9
CAGL0M05467g8.524ON354114693.1
ADR190W5.535ON24167683.3
SAKL0H10450g8.524ON39273693.5
SAKL0G05104g5.535ON24851667.3
Kwal_27.119758.524ON33691658.6
Kpol_299.68.524ON349126659.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D10076g
         (305 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar...   610   0.0  
TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {...   304   e-103
TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON...   287   9e-96
TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {...   284   1e-94
Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON} (35641..36...   281   1e-93
NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON...   256   9e-84
YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON} P...   248   1e-80
Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {O...   247   2e-80
Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {O...   246   6e-80
CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} simila...   243   2e-78
Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {O...   240   1e-77
SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar...   236   5e-76
NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {...   235   2e-75
Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {O...   232   1e-74
KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa] ...   212   1e-66
Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to...   210   6e-66
AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON} Sy...   201   5e-62
Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON...    46   5e-05
Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON...    45   2e-04
YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}  ...    42   0.001
Suva_4.459 Chr4 complement(802339..803466) [1128 bp, 375 aa] {ON...    41   0.002
KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON}               39   0.016
TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {O...    37   0.036
TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.5...    35   0.24 
Suva_11.131 Chr11 (249525..250466) [942 bp, 313 aa] {ON} YKL094W...    33   0.70 
NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON} Anc_8...    33   1.0  
KAFR0E03120 Chr5 (623464..624504) [1041 bp, 346 aa] {ON} Anc_8.5...    33   1.1  
NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {O...    32   1.6  
ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} simila...    32   1.6  
KLTH0D05742g Chr4 (512469..513410) [942 bp, 313 aa] {ON} similar...    32   1.7  
YKL094W Chr11 (263349..264290) [942 bp, 313 aa] {ON}  YJU3Monogl...    32   1.7  
TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8....    32   2.2  
KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {O...    31   2.9  
CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa] ...    31   3.1  
ADR190W Chr4 (1035094..1035819) [726 bp, 241 aa] {ON} Syntenic h...    31   3.3  
SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {...    31   3.5  
SAKL0G05104g Chr7 complement(422194..422940) [747 bp, 248 aa] {O...    30   7.3  
Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR2...    30   8.6  
Kpol_299.6 s299 (14238..15287) [1050 bp, 349 aa] {ON} (14238..15...    30   9.3  

>ZYRO0D10076g Chr4 (850134..851051) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  610 bits (1574), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/305 (96%), Positives = 295/305 (96%)

Query: 1   MSIRYLAGARLPTSVLHIXXXXXXXXXXLFVWIPGNPGIVQYYEEFLNLLHEKYDSFEIL 60
           MSIRYLAGARLPTSVLHI          LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEIL
Sbjct: 1   MSIRYLAGARLPTSVLHIKPKSPSPSSPLFVWIPGNPGIVQYYEEFLNLLHEKYDSFEIL 60

Query: 61  AISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMAQHV 120
           AISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMAQHV
Sbjct: 61  AISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMAQHV 120

Query: 121 VLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKLSSI 180
           VLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKLSSI
Sbjct: 121 VLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKLSSI 180

Query: 181 MFTDQVISLFMGVDKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKKLIDH 240
           MFTDQVISLFMGVDKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKKLIDH
Sbjct: 181 MFTDQVISLFMGVDKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKKLIDH 240

Query: 241 CNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKHSKYI 300
           CNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKHSKYI
Sbjct: 241 CNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKHSKYI 300

Query: 301 VDEYF 305
           VDEYF
Sbjct: 301 VDEYF 305

>TDEL0D05560 Chr4 complement(1004217..1005152) [936 bp, 311 aa] {ON}
           Anc_3.488 YPR147C
          Length = 311

 Score =  304 bits (779), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 206/309 (66%), Gaps = 5/309 (1%)

Query: 1   MSIRYLAGARLPTSVLHIXXXXXXXXXX--LFVWIPGNPGIVQYYEEFLNLLHEKYDSFE 58
           M+ R       PTS++H             LFVWIPGNPG+++YYEEFL L+H ++  +E
Sbjct: 1   MAAREYIKCAYPTSIVHFKSISIRGKSECPLFVWIPGNPGLIEYYEEFLMLIHRQHPEWE 60

Query: 59  ILAISHAGMATEDPDLQKR--KATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYM 116
           +L ISHAGM+T      ++  +  +Y+L  QI HK+EII  FS+ +RPLI+MGHSVGAYM
Sbjct: 61  VLGISHAGMSTASVSKSEKSERNDVYSLKQQIDHKLEIIKDFSSTNRPLIIMGHSVGAYM 120

Query: 117 AQHVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNK 176
            QH+VL++KL+G+V K+GL+TPT++DIH S+KG  LT+  YW+K LP +A W S +LF  
Sbjct: 121 VQHIVLSDKLVGKVAKMGLLTPTILDIHTSKKGVVLTKVLYWLKDLPQLAGWFSSLLFGF 180

Query: 177 LSSIMFTDQVISLFMGVDKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKK 236
                    ++S FMG  + S  V T+  L++N E ++QALGL+  EM++IR  W FQ++
Sbjct: 181 FLPSFILRILLSFFMGCHRNSSGVLTTTVLLENGEFVKQALGLSVYEMEEIRSDWAFQRR 240

Query: 237 LIDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKH 296
           LI HCN   I T  +FS +D WV++ TRE L+ FYR++YR   ++I   + + HSF++ H
Sbjct: 241 LIVHCNERGISTWLLFSDSDHWVADTTREDLIKFYRDHYRADKIKIHTCK-IPHSFVLNH 299

Query: 297 SKYIVDEYF 305
           SKY++ EYF
Sbjct: 300 SKYLISEYF 308

>TPHA0D04220 Chr4 complement(912211..913161) [951 bp, 316 aa] {ON}
           Anc_3.488 YPR147C
          Length = 316

 Score =  287 bits (734), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 137/316 (43%), Positives = 202/316 (63%), Gaps = 11/316 (3%)

Query: 1   MSIRYLAGARLPTSVLHIX-----------XXXXXXXXXLFVWIPGNPGIVQYYEEFLNL 49
           M+I     ++ PTS+L I                     LFVWIPGNPG+++YYEEFL L
Sbjct: 1   MTITVFKDSKFPTSILSIKGTYVADELSVDLTKTDKLSPLFVWIPGNPGLLEYYEEFLKL 60

Query: 50  LHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMG 109
           LH K   ++IL ISHAGM++ + +L++ + ++YTLD+QI HK+EIIN+F+A  R LIVMG
Sbjct: 61  LHVKNPEWDILGISHAGMSSGNSNLKENECSVYTLDEQIHHKIEIINKFAAYGRELIVMG 120

Query: 110 HSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWV 169
           HSVGA+MAQ VV++ KL G+V K+GL+ PTV+DIH S+KGTQ++    W+  LP +A WV
Sbjct: 121 HSVGAFMAQKVVMSNKLEGKVKKIGLLMPTVIDIHLSEKGTQISTILNWIPNLPQLAGWV 180

Query: 170 SDMLFNKLSSIMFTDQVISLFMGVDKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRG 229
           S+ +F     I     +IS FM ++ E+     + + +++   + Q+LGLA  EMQ IR 
Sbjct: 181 SEKIFGGFLPITLVKFIISFFMELNNENKAAHATYTFLKDSNFVEQSLGLAKYEMQIIRH 240

Query: 230 CWPFQKKLIDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLA 289
            W FQ++L+  CN N+IE   +F+ +D WVSN TR  L+  YR +        S++  + 
Sbjct: 241 DWEFQRELVKMCNVNQIELWTLFAESDHWVSNQTRSELIELYRNSVNSDYYSYSITDQVP 300

Query: 290 HSFIVKHSKYIVDEYF 305
           H+F++K+S ++VD YF
Sbjct: 301 HAFVIKNSCHVVDNYF 316

>TBLA0C04450 Chr3 complement(1079139..1080068) [930 bp, 309 aa] {ON}
           Anc_3.488 YPR147C
          Length = 309

 Score =  284 bits (726), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 137/309 (44%), Positives = 199/309 (64%), Gaps = 4/309 (1%)

Query: 1   MSIRYLAGARLPTSVLHI---XXXXXXXXXXLFVWIPGNPGIVQYYEEFLNLLHEKYDSF 57
           M+I+    +R PTS++H              LF+WIPGNPG+++YY + L  LH+KY ++
Sbjct: 1   MTIQIYPDSRYPTSIVHFPPAKDYKITEDTPLFIWIPGNPGLLEYYTKMLRSLHDKYPTW 60

Query: 58  EILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMA 117
           EIL +SHAGM+  +         +YTLD+Q+ HKVE+IN FS+  R +I+MGHSVGAYMA
Sbjct: 61  EILGVSHAGMSNGNQIKNVLSTKVYTLDEQVSHKVEVINNFSSPKRNIIIMGHSVGAYMA 120

Query: 118 QHVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKL 177
           Q V++   L+G V+KLGL+TPTVVDIHRS KG ++TRAF   + LP     +S + F+KL
Sbjct: 121 QRVIMDSNLIGNVIKLGLVTPTVVDIHRSVKGIKMTRAFNLFRELPIFLGLLSTLAFSKL 180

Query: 178 SSIMFTDQVISLFMGV-DKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKK 236
              +FT  ++++ MG  + ++     S   + N   ++Q LGLA+ EM+ IR  W FQK+
Sbjct: 181 FPAIFTRWLLTIIMGCKNNDNHAADASTVFLTNGSFVKQCLGLASHEMKHIRDDWNFQKR 240

Query: 237 LIDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKH 296
           LID+CN   + T F+FS+ D WVS+ TR  L+ FYR N +   L++SVS  + HSF++  
Sbjct: 241 LIDYCNKENVSTWFLFSSTDHWVSDDTRNELINFYRTNCKSDILDVSVSNIIPHSFVINF 300

Query: 297 SKYIVDEYF 305
           S + V+ YF
Sbjct: 301 SDFTVNSYF 309

>Kpol_480.17 s480 (35641..36582) [942 bp, 313 aa] {ON}
           (35641..36582) [942 nt, 314 aa]
          Length = 313

 Score =  281 bits (719), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 132/311 (42%), Positives = 209/311 (67%), Gaps = 9/311 (2%)

Query: 3   IRYLAGARLPTSVLHI---XXXXXXXXXXLFVWIPGNPGIVQYYEEFLNLLHEKYDSFEI 59
           ++    +  PTS++H+             LFVWIPGNPG+++YY +FL L+H+K  ++E+
Sbjct: 4   VKVFEDSIYPTSIVHLDPLTKELSPEDSPLFVWIPGNPGLLEYYVDFLALVHKKNPTWEV 63

Query: 60  LAISHAGMATEDPDLQKRKAT-----IYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGA 114
           L ISHAGM+ +  + +K+ ++     ++ L++Q+QHKV+IIN+FS+K+RPLI+MGHSVGA
Sbjct: 64  LGISHAGMSYDGNEKKKKTSSNDKFKVFDLEEQVQHKVDIINKFSSKNRPLIIMGHSVGA 123

Query: 115 YMAQHVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLF 174
           Y+ Q V++  KL G+++K+G +TPTVVDIH S KG ++T+ F W   LP    W+S  +F
Sbjct: 124 YLTQRVIMTNKLNGKLIKVGYLTPTVVDIHLSDKGIKMTKVFNWTSNLPHHVGWISQFIF 183

Query: 175 NKLSSIMFTDQVISLFMGVDKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQ 234
           +KL  + F    IS  +   ++S  V  S +L++N  +I QALGLA  EM+ I   W F 
Sbjct: 184 HKLLPLFFVKFFISKMIKCSEDSNAVLASGTLLRNANLIEQALGLATYEMEAIHDDWGFH 243

Query: 235 KKLIDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIV 294
           KKLID+CN   ++T F+F+ +D WV+++TR+ ++ FY+ + +  N+ I +   + H+F++
Sbjct: 244 KKLIDYCNETGVKTWFLFAEDDHWVAHSTRKEVIDFYQYHNKPENIRIDIDT-IPHAFVI 302

Query: 295 KHSKYIVDEYF 305
           K SKYIVD+YF
Sbjct: 303 KKSKYIVDQYF 313

>NCAS0F03530 Chr6 complement(706175..707116) [942 bp, 313 aa] {ON}
           Anc_3.488 YPR147C
          Length = 313

 Score =  256 bits (654), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 133/314 (42%), Positives = 195/314 (62%), Gaps = 10/314 (3%)

Query: 1   MSIRYLAGARLPTSVLHIXXXXXXXXXXLFVWIPGNPGIVQYYEEFLNLLHEKYDSFEIL 60
           MS+        PT V+HI          +FVWIPGNPGI++YY+E L  LHEK+ ++EIL
Sbjct: 1   MSVEAYDDDEFPTCVVHILPIKTAEINPVFVWIPGNPGILEYYQEMLINLHEKHPTWEIL 60

Query: 61  AISHAGMATEDPDL----QKRKATIYTLDDQIQHKVEIINQFSAKDR--PLIVMGHSVGA 114
           AISH GM T+   L     +  + ++TL +QIQHK++IIN F  KD   P+ + GHSVGA
Sbjct: 61  AISHIGMNTKTTSLFKGSHQDNSRVFTLKEQIQHKIKIINNF-VKDSNVPIYISGHSVGA 119

Query: 115 YMAQHVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYW-VKYLPDIAAWVSDML 173
           YM Q +V +++L+G+V+K+GLITPT++DIH S+KG  +TR   W  + LP I +++  ++
Sbjct: 120 YMVQKIVASDELIGQVLKMGLITPTIIDIHLSEKGKSMTRYARWSCRQLPHILSFLCYIV 179

Query: 174 FNKLSSIMFTDQVISLFMGVDKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPF 233
           F  L   +    +I   MG   +S    +++  +  P  +RQ+LGLA  EM  I   W F
Sbjct: 180 FGWLVPGILRSYIIGYVMGCHHDSQAAISTELFLTGPNFVRQSLGLAQEEMDTIHDDWQF 239

Query: 234 QKKLIDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRN--LEISVSQDLAHS 291
           Q +LI++C  N I+ +F+FSA D WV  ATR+ ++ FY+E  +     L+I VS    HS
Sbjct: 240 QAELIEYCLKNSIKIQFLFSATDHWVREATRKEIIQFYQERCKGAKALLKIDVSDQFPHS 299

Query: 292 FIVKHSKYIVDEYF 305
           F+V+ SKY+V+ YF
Sbjct: 300 FVVRRSKYVVEHYF 313

>YPR147C Chr16 complement(825645..826559) [915 bp, 304 aa] {ON}
           Putative protein of unknown function; green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           and is induced in response to the DNA-damaging agent MMS
          Length = 304

 Score =  248 bits (632), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 124/308 (40%), Positives = 190/308 (61%), Gaps = 7/308 (2%)

Query: 1   MSIRYLAGARLPTSVLHIXXXXXXXX--XXLFVWIPGNPGIVQYYEEFLNLLHEKYDSFE 58
           M+++    ++LP S+L+I            L VWIPGNPG++ YY+E L+ LH K+  +E
Sbjct: 1   MTVKEYTKSKLPCSILNIKPTVTKSGEDAPLLVWIPGNPGLLYYYQEMLHHLHLKHPDWE 60

Query: 59  ILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMAQ 118
           IL ISHAGM             I++L DQ+ H+VE+IN FS K+R +I+MGHSVGAY+ Q
Sbjct: 61  ILGISHAGMTLN----AHSNTPIFSLQDQVDHQVEVINNFSCKNRKIIIMGHSVGAYIVQ 116

Query: 119 HVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKLS 178
            V L+ KL+G V K+GL+TPTV+DIH S+ G ++T A  ++  L  + +  S + F  + 
Sbjct: 117 KVCLSNKLVGSVQKVGLVTPTVMDIHTSEMGIKMTAALRYIPPLAHVVSLFSYIFFYWIL 176

Query: 179 SIMFTDQVISLFMGVDKESV-PVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKKL 237
           S  F+  +I  FMG        V +++  + + + +RQ+LGLAA EM++I   W FQ + 
Sbjct: 177 SEGFSRFIIDKFMGCGSTGYQAVLSTRIFLTHRQFVRQSLGLAAQEMEEITTNWEFQDRF 236

Query: 238 IDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKHS 297
           I++C  N I   F+FS+ND WVS  TR  L  +Y++  +   L+I V+  + HSF+VKH+
Sbjct: 237 INYCEENGISIWFLFSSNDHWVSGKTRSHLSDYYKDKVKQERLKIDVTDKIPHSFVVKHA 296

Query: 298 KYIVDEYF 305
           +Y ++ +F
Sbjct: 297 EYAINAFF 304

>Smik_16.400 Chr16 complement(697593..698507) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  247 bits (630), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 125/308 (40%), Positives = 186/308 (60%), Gaps = 7/308 (2%)

Query: 1   MSIRYLAGARLPTSVLHI--XXXXXXXXXXLFVWIPGNPGIVQYYEEFLNLLHEKYDSFE 58
           M I+    ++ P S+L+I            L VWIPGNPG++ YY+E L  LH K+  +E
Sbjct: 1   MPIQEYTKSKFPCSILNIKPTITRSDEDAALLVWIPGNPGLLYYYQEMLQYLHSKHPDWE 60

Query: 59  ILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMAQ 118
           IL ISHAGM             +Y+L DQ+ H+VE+IN FS ++R +I+MGHSVGAY+ Q
Sbjct: 61  ILGISHAGMTLN----AHSNTPVYSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQ 116

Query: 119 HVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKLS 178
            V L+  L+G V K+GL+TPTV+DIH S+ G +LT A +++  L  + +  S + F  + 
Sbjct: 117 KVCLSHNLVGTVQKVGLVTPTVMDIHTSEMGVKLTTALHYIPPLAHVVSLFSYIFFYWIL 176

Query: 179 SIMFTDQVISLFMGVDKESV-PVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKKL 237
           S  F+  +I  FMG    S   V +++  + + + +RQ+LGLA+ EM++I   W FQ K 
Sbjct: 177 SEGFSRFIIDKFMGCGSTSCQAVLSTRIFLTHKQFVRQSLGLASQEMEEITTNWEFQDKF 236

Query: 238 IDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKHS 297
           I++C  N     F+FS+ND WVS  TR  L  +Y++      LEI V+  + HSF+VKH+
Sbjct: 237 INYCEQNGTLIWFLFSSNDHWVSGKTRSHLSHYYKDKVDQNRLEIDVTDKIPHSFVVKHA 296

Query: 298 KYIVDEYF 305
           KY ++ +F
Sbjct: 297 KYAINTFF 304

>Suva_16.476 Chr16 complement(822104..823018) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  246 bits (628), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 122/308 (39%), Positives = 194/308 (62%), Gaps = 7/308 (2%)

Query: 1   MSIRYLAGARLPTSVLHI--XXXXXXXXXXLFVWIPGNPGIVQYYEEFLNLLHEKYDSFE 58
           MSI+    ++LP S+L+I            L VWIPGNPG++ YY+E ++ LH K+  +E
Sbjct: 1   MSIQEYTKSKLPCSILNIKPTVTTDNEDAPLLVWIPGNPGLLHYYQEMIHHLHLKHPDWE 60

Query: 59  ILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMAQ 118
           IL ISHAGM++      +    I++L DQ+ H+V++IN FS  +R +I+MGHSVGAY+ Q
Sbjct: 61  ILGISHAGMSSN----ARSNTPIFSLQDQVDHQVKVINNFSHDNRKIIIMGHSVGAYIVQ 116

Query: 119 HVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKLS 178
            V L+ +L+G V K+GLITPTV+DIH S+ G ++T AF++V  L  + +++S + F  + 
Sbjct: 117 KVCLSNELVGSVTKVGLITPTVMDIHASEMGVKMTTAFHYVPALAHVLSFISYVFFYWVL 176

Query: 179 SIMFTDQVISLFMGVDKES-VPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKKL 237
           S   +  +I  FMG        V +++  + + + +RQ+LGLA+ E+++I   W FQ K 
Sbjct: 177 SEGLSKLIIDKFMGCGTAGRRAVLSTRLFLTHRQFVRQSLGLASQELKEITTNWEFQDKF 236

Query: 238 IDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKHS 297
           I+HC    I T F+FS  D WV++ TR+ L  +Y +  +  +L I V+  + HSF+VKH+
Sbjct: 237 INHCEEKGIFTWFLFSTKDHWVNDETRKHLSHYYHDKVKQEHLRIDVTDKMPHSFVVKHA 296

Query: 298 KYIVDEYF 305
           +Y ++ +F
Sbjct: 297 EYAINAFF 304

>CAGL0L08514g Chr12 (932629..933567) [939 bp, 312 aa] {ON} similar
           to uniprot|Q06522 Saccharomyces cerevisiae YPR147c
          Length = 312

 Score =  243 bits (619), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 133/313 (42%), Positives = 189/313 (60%), Gaps = 9/313 (2%)

Query: 1   MSIRYLAGARLPTSVLHI--XXXXXXXXXXLFVWIPGNPGIVQYYEEFLNLLHEKYDSFE 58
           MS++    + LPT ++HI            LFVWIPGNPG+++YY+EFL  +H+K  ++E
Sbjct: 1   MSVQGYHDSALPTCIIHIKPTVTNNDESSPLFVWIPGNPGLLEYYQEFLAKVHDKNPTWE 60

Query: 59  ILAISHAGMATEDPDLQKRKAT---IYTLDDQIQHKVEIINQFSAK-DRPLIVMGHSVGA 114
           IL ISHAG   E   L+K +     IY L  Q QHK++IIN+ +   +R L++MGHSVGA
Sbjct: 61  ILGISHAGTVIESSQLKKFRKNPLPIYDLKQQTQHKIDIINKINNDPNRELVIMGHSVGA 120

Query: 115 YMAQHVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLF 174
           Y+AQHVV +  L+GRV KLGLITPT+ DIH+S  G   TR F ++  + +  +++S  +F
Sbjct: 121 YIAQHVVSSPDLVGRVSKLGLITPTIRDIHKSSHGLIFTRVFNYISNVNEYLSFISSNIF 180

Query: 175 NKLSSIMFTDQVISLFMGV--DKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWP 232
           NKL    +T  +IS  MG   D+  + + T   L Q  E +RQ LGLAA EM +IR  W 
Sbjct: 181 NKLIPAYWTKLLISFAMGCSFDEYHIILGTFLLLTQR-ETLRQVLGLAAHEMLEIRDDWA 239

Query: 233 FQKKLIDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSF 292
           FQ+ L+  C  N  +   +FS ND WVS  T+  L+ F ++ Y +  L + V +D+ HSF
Sbjct: 240 FQENLLTKCKDNGTKLWLLFSDNDHWVSQHTQAELIKFLKDRYPELLLRVDVDKDIKHSF 299

Query: 293 IVKHSKYIVDEYF 305
           +VK    +   YF
Sbjct: 300 VVKDVDLVTRRYF 312

>Skud_16.442 Chr16 complement(779364..780278) [915 bp, 304 aa] {ON}
           YPR147C (REAL)
          Length = 304

 Score =  240 bits (613), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 122/308 (39%), Positives = 189/308 (61%), Gaps = 7/308 (2%)

Query: 1   MSIRYLAGARLPTSVLHIXXXXXXXX--XXLFVWIPGNPGIVQYYEEFLNLLHEKYDSFE 58
           M ++    + LP S+L+I            L VWIPGNPG++ YY+E L  LH K+  +E
Sbjct: 1   MPVQEYTKSTLPCSILNIKPSVATENEDAPLLVWIPGNPGLLYYYQEMLQHLHSKHPDWE 60

Query: 59  ILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMAQ 118
           IL +SHAGM             I++L DQ+ H+VE+IN FS ++R +I+MGHSVGAY+ Q
Sbjct: 61  ILGVSHAGMTLN----AHSNTPIFSLQDQVDHQVEVINNFSHENRKIIIMGHSVGAYILQ 116

Query: 119 HVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKLS 178
            V L++KL+G V K+GLITPTV+DIH S+ G ++T   +++  L  + + +S + F  + 
Sbjct: 117 KVCLSDKLVGSVRKIGLITPTVMDIHTSEMGVKMTAVLHYIPPLAHVVSLLSYVFFYWIL 176

Query: 179 SIMFTDQVISLFMGVDKESV-PVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKKL 237
           S   +  VI  FMG        V +++ L+ + + +RQ+LGLA+ EM++I   W FQ + 
Sbjct: 177 SEGLSRFVIDKFMGCGSTGYQAVLSTRILLTHKQFVRQSLGLASQEMKEITTNWEFQDEF 236

Query: 238 IDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKHS 297
           I++C  NEI   F+FS  D WV++ TR  L  +Y++  +   L+I V+  + HSF+VKH+
Sbjct: 237 INYCQENEIFIWFLFSTKDHWVADKTRTHLSHYYKDKIKQERLKIDVTDKIPHSFVVKHA 296

Query: 298 KYIVDEYF 305
           +Y V+ +F
Sbjct: 297 EYAVNTFF 304

>SAKL0F02860g Chr6 (242683..243600) [918 bp, 305 aa] {ON} similar to
           uniprot|Q06522 Saccharomyces cerevisiae YPR147C
           Hypothetical ORF
          Length = 305

 Score =  236 bits (601), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 117/276 (42%), Positives = 178/276 (64%), Gaps = 2/276 (0%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDDQI 88
           LFV+IPGNPG++++Y+ FL+ + +K+ ++EIL ISHAGM T+   L K+   +Y+L DQ+
Sbjct: 31  LFVFIPGNPGLIEFYKSFLDQIQKKHGNWEILGISHAGMITKCKGL-KKPTKVYSLKDQV 89

Query: 89  QHKVEIINQFSAKDRPLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIHRSQK 148
           QHK+ +IN F + +RPLI+ GHS+GAY+ Q + L   L+G V K+ L+TPTV+DIH S+K
Sbjct: 90  QHKIYVINDFCSSNRPLIIAGHSIGAYIVQKIALDVSLMGTVKKIMLLTPTVIDIHLSEK 149

Query: 149 GTQLTRAFYWVKYLPDIAAWVSDMLFNKLSSIMFTDQVISLFMGVDKESVPVATSKSLVQ 208
           G +L     W        A  S ++F K+     T++++SLF+G ++  V  A +K LV 
Sbjct: 150 GRKLNWINEWCPNFHSYVATASWLVFEKMLPQTITEKILSLFVGSEQTCVREA-AKLLVT 208

Query: 209 NPEIIRQALGLAALEMQQIRGCWPFQKKLIDHCNSNEIETKFVFSANDPWVSNATREALM 268
           N E ++Q+LGLA  EMQ++R  W FQ   +  C S E+E +F+F+  D WV++ TR  L 
Sbjct: 209 NYEFVQQSLGLAREEMQKVRDDWNFQLSFLQFCKSQEVELQFLFAFKDHWVNSQTRFDLA 268

Query: 269 VFYRENYRDRNLEISVSQDLAHSFIVKHSKYIVDEY 304
            FY  NY    L I   + ++HSF++  +K +VD Y
Sbjct: 269 EFYNSNYYKDFLTIDEDEKISHSFVLNDTKSVVDRY 304

>NDAI0B05830 Chr2 complement(1415309..1416298) [990 bp, 329 aa] {ON}
           Anc_3.488 YPR147C
          Length = 329

 Score =  235 bits (600), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 125/331 (37%), Positives = 196/331 (59%), Gaps = 28/331 (8%)

Query: 1   MSIRYLAGARLPTSVLHIXXXXXX----XXXXLFVWIPGNPGIVQYYEEFLNLLHEKYDS 56
           M ++  + ++ PTS++HI              LF+WIPGNPGI+QYY++FL  LH+K+  
Sbjct: 1   MLVKSYSESKYPTSIIHIEAEKLIENDPSLNPLFIWIPGNPGILQYYQQFLCSLHKKHPH 60

Query: 57  FEILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSA---------KDRPLIV 107
           +EILAI HAGM T  P  +     IY L++QI+HK+E+I  F           K RPL++
Sbjct: 61  WEILAIPHAGMDTSLPVYRHPNDRIYHLNEQIEHKIEVITTFLTKANSSDGIMKKRPLVI 120

Query: 108 MGHSVGAYMAQHVVLAEKLLGRVV-------KLGLITPTVVDIHRSQKGTQLTRAFYWVK 160
           MGHSVG YM Q +VL ++    ++       K+G ITPT++DI+ S KG  ++       
Sbjct: 121 MGHSVGTYMIQRMVLTKEFQDTILHNSFYLKKIGFITPTIIDINLSSKGILISHGLQLTH 180

Query: 161 -YLPDIAAWVSDMLFNKLSSIMFTDQV----ISLFMGVDKESVPVATSKSLVQNPEIIRQ 215
            YLP I +++S  +F+ +  + + D +    I+  MG          ++ L+ N  +++Q
Sbjct: 181 GYLPYILSYLSYFVFSLI--LKYFDNIRRRLIAYIMGCQMTDFAAIGTEILLTNSVLVKQ 238

Query: 216 ALGLAALEMQQIRGCWPFQKKLIDHCNSNEIETKFVFSANDPWVSNATREALMVFYRENY 275
           +LGLA++EMQ+IR  W  QK+ +++CN N+I+   +F   D WV+N TR  L+ FY+ NY
Sbjct: 239 SLGLASIEMQEIRKNWDVQKQFVENCNHNDIQLWLLFCETDHWVNNVTRTDLIKFYQSNY 298

Query: 276 RD-RNLEISVSQDLAHSFIVKHSKYIVDEYF 305
           +D   L+I VS +  HSF+V HS ++V+ +F
Sbjct: 299 KDISRLQIEVSSEFPHSFVVNHSDWVVERFF 329

>Kwal_55.21219 s55 complement(734903..735811) [909 bp, 302 aa] {ON}
           YPR147C - Hypothetical ORF [contig 131] FULL
          Length = 302

 Score =  232 bits (592), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 180/277 (64%), Gaps = 5/277 (1%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDDQI 88
           LFV+IPGNPG++++YE FL  +HEK  ++EIL ISHAGM +   ++    + +Y+L+ QI
Sbjct: 31  LFVFIPGNPGLIEFYEPFLAQIHEKNPAWEILGISHAGMNSCSEEV----SPVYSLEQQI 86

Query: 89  QHKVEIINQFSAKDRPLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIHRSQK 148
            HK+EIIN++    +P+I+MGHSVGA+M Q +  + +L  +V+++GL+TPTV+DIH+S+K
Sbjct: 87  DHKIEIINRYCLDGKPIIIMGHSVGAFMVQKITTSRRLKSKVIRVGLLTPTVIDIHKSEK 146

Query: 149 GTQLTRAFYWVKYLPDIAAWVSDMLFNKLSSIMFTDQVISLFMGVDKESVPVATSKSLVQ 208
           G +LT    W     ++ + ++  LF KL     T  +ISL +  D +S   AT++ LV 
Sbjct: 147 GVKLTSITRWCPSFHNVVSTLNWALFEKLLPTKITKSIISLLVD-DPQSCLGATTELLVT 205

Query: 209 NPEIIRQALGLAALEMQQIRGCWPFQKKLIDHCNSNEIETKFVFSANDPWVSNATREALM 268
           N   ++QALGLAA E++ IR  W +QK+ +  C  N+ +  ++FS  D WVS  TR  ++
Sbjct: 206 NSRFVKQALGLAAEEVRVIRSDWAYQKEFLLLCQENDTKIWWLFSEKDHWVSPTTRNDII 265

Query: 269 VFYRENYRDRNLEISVSQDLAHSFIVKHSKYIVDEYF 305
            FYR++      +I VS  + H+F+ +H+  ++ +YF
Sbjct: 266 DFYRQHSSPALSQIDVSSTIEHAFVRRHADLVIKQYF 302

>KLTH0F14740g Chr6 complement(1208120..1209028) [909 bp, 302 aa]
           {ON} similar to uniprot|Q06522 Saccharomyces cerevisiae
           YPR147C Hypothetical ORF
          Length = 302

 Score =  212 bits (539), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 116/299 (38%), Positives = 175/299 (58%), Gaps = 13/299 (4%)

Query: 12  PTSVLHIXXXXXX--XXXXLFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMAT 69
           P+S+LH+            LFV+IPGNPG+++YY  FL  +HEK   +EIL ISHAGM +
Sbjct: 12  PSSILHLKSGVSSLGSDACLFVFIPGNPGLIEYYVPFLQQVHEKNPDWEILGISHAGMNS 71

Query: 70  EDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMAQHVVLAEKLLGR 129
                      +YTL +QI HKV++IN ++  ++ + +MGHSVGA++AQ VV +  L   
Sbjct: 72  ----CNDIACPVYTLQEQINHKVDVINSYAQGNKKITIMGHSVGAFIAQKVVTSGLLNDE 127

Query: 130 VVKLGLITPTVVDIHRSQKG---TQLTRAFYWVKYLPDIAAWVSDMLFNKLSSIMFTDQV 186
           V ++GL+TPTV+DIH+S+KG   T +T  F     L     W++   F KL     T  +
Sbjct: 128 VARVGLLTPTVIDIHKSEKGLKLTAITERFPRFHQLVSALDWIA---FEKLFPDFLTSWI 184

Query: 187 ISLFMGVDKESVPVATSKSLVQNPEIIRQALGLAALEMQQIRGCWPFQKKLIDHCNSNEI 246
           IS F   D ++   A ++ L+ N   ++QALGLA  EMQ IR  W +QK  + +C +   
Sbjct: 185 ISHFAD-DPKTCLGAATRLLLTNSRFVKQALGLATEEMQVIRSDWEYQKDFLHYCETKGA 243

Query: 247 ETKFVFSANDPWVSNATREALMVFYRENYRDRNLEISVSQDLAHSFIVKHSKYIVDEYF 305
           +  ++FS ND WVS+ TR+ L+ FY  +     + I VS  + H+F+ +H++ +V  YF
Sbjct: 244 KIWWLFSDNDHWVSSETRKDLIQFYERHSSPELVSIDVSTAIEHAFVRRHAQVVVQHYF 302

>Ecym_1241 Chr1 (494505..495422) [918 bp, 305 aa] {ON} similar to
           Ashbya gossypii AFR306C
          Length = 305

 Score =  210 bits (534), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 174/284 (61%), Gaps = 11/284 (3%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMAT--EDPDLQKRKATIYTLDD 86
           L ++IPGNPG++ +YEEFL  +HE+  ++E++ I H GM++  E+  L  R   ++TLD+
Sbjct: 26  LLLFIPGNPGLINFYEEFLKCIHERNPTWEVVGIGHTGMSSLRENNSLSGR---VHTLDE 82

Query: 87  QIQHKVEIINQF--SAKDRPLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIH 144
           QI+ KV++IN+F  +  DR + ++GHS+GAYM Q + L + L G++  + L+TPT++DIH
Sbjct: 83  QIEDKVKVINEFVDAGGDRCIKLIGHSIGAYMVQKIALHKGLRGKIDMVMLLTPTIIDIH 142

Query: 145 RSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKLSSIMFTDQVISLFMGVDKESVPVATSK 204
           RS KG QLTR   W     + A  V  +LF  +    + + +    +G   E V + +++
Sbjct: 143 RSSKGVQLTRISDWFPKFYEYAYVVDRVLFKWILPTSWIEWIARKLIGGSDECV-LQSAQ 201

Query: 205 SLVQNPEIIRQALGLAALEMQQIRGCWPFQKKLIDHCNSNEIETKFVFSANDPWVSNATR 264
            LV  PE ++QALGLA +EM Q+R  W FQ + I  C +N+I+ +F+FS +D WV   T 
Sbjct: 202 KLVSTPEFVKQALGLAQIEMYQVRNQWDFQDEFISFCQANKIKVRFLFSGHDHWVHPDTM 261

Query: 265 EALMVFYRENYRDRN---LEISVSQDLAHSFIVKHSKYIVDEYF 305
           + ++  Y   Y       L I++   + HSF+VK +  +V+ YF
Sbjct: 262 KDIIELYEAKYSSDEKDLLNITIDGHINHSFVVKDTTKVVNIYF 305

>AFR306C Chr6 complement(996001..996960) [960 bp, 319 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR147C
          Length = 319

 Score =  201 bits (510), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 166/283 (58%), Gaps = 10/283 (3%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGM-ATEDPDLQKRKATIYTLDDQ 87
           + +++PGNPG++ +Y EFL  +HEK  ++EI+ ISH GM A   P+  KR   +YTL +Q
Sbjct: 41  ILIFLPGNPGLINFYREFLRSIHEKNPTWEIVGISHTGMSAKTGPEDLKR---VYTLVEQ 97

Query: 88  IQHKVEIINQFSAKDRPLIV--MGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIHR 145
           ++HKV+ IN F      L V  +GHS+GAYMAQ VV+   L   V  +GL+TPT++DIHR
Sbjct: 98  VEHKVKAINDFVENRGNLAVKLVGHSIGAYMAQKVVVHPALRVNVEMVGLLTPTIIDIHR 157

Query: 146 SQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKLSSIMFTDQVISLFMGVDKESVPVATSKS 205
           S KG QLTR   W     +  + V  +L   L    +   +    +G   E V + +++ 
Sbjct: 158 SPKGVQLTRISEWFPRFYEYVSIVDRVLLEWLLPATWISWLARKIIGGSDECV-LQSAEK 216

Query: 206 LVQNPEIIRQALGLAALEMQQIRGCWPFQKKLIDHCNSNEIETKFVFSANDPWVSNATRE 265
           LV+NP  +RQALG+A LEM Q+R  W FQ++ I  C         +FS +D WV + T +
Sbjct: 217 LVKNPSYVRQALGMAQLEMHQVRNQWDFQEEFIKTCQERRSSLWLLFSGHDHWVHSDTMK 276

Query: 266 ALMVFYRENY---RDRNLEISVSQDLAHSFIVKHSKYIVDEYF 305
            ++ FY   Y    D  L I++ + ++HSF+VK +  +V+ YF
Sbjct: 277 DIVEFYEAKYGTNADSLLRITIDEHISHSFVVKDTTKVVNIYF 319

>Smik_2.345 Chr2 complement(618817..619944) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 46.2 bits (108), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 42/162 (25%), Positives = 76/162 (46%), Gaps = 15/162 (9%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATE---DPDLQKRKATIYTLD 85
           +FV++PG  G ++ +E  L L+     +F  L +   G ++E    P L+  +     L 
Sbjct: 88  VFVFVPGLAGNLEQFEPLLKLVDSDRKAFLALDLPGFGDSSEWSDYPMLKVVELIFILLC 147

Query: 86  DQIQHKVEII------NQFSAKDRPLIVMGHSVGAYMAQHVVLAEKLLGRVVK-LGLITP 138
           D ++ +  ++      N F+     L+++GHS+G ++A H+     +  +VVK L L+TP
Sbjct: 148 DVLKGRPAVLSKDDNLNFFNG--HKLVLVGHSMGCFLACHLYEQHLVDAKVVKTLVLLTP 205

Query: 139 TVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKLSSI 180
               I +  K     R + WV Y      W+ D+  NK   +
Sbjct: 206 PKAHIEQLSKD---KRIYQWVLYGVFKMPWLLDIYRNKFDQV 244

>Skud_2.331 Chr2 complement(599967..601097) [1131 bp, 376 aa] {ON}
           YBR204C (REAL)
          Length = 376

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 74/163 (45%), Gaps = 17/163 (10%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKAT--IYTLDD 86
           +F+++PG  G ++ +E  L L+     +F  L +   G ++E  D    K    I+ L  
Sbjct: 89  VFLFVPGLAGNLEQFEPLLKLIDSDQKAFLALDLPGFGHSSEWADYPMLKVVELIFVLVC 148

Query: 87  QIQHKVEI-------INQFSAKDRPLIVMGHSVGAYMAQHVVLAEKLLGRVV-KLGLITP 138
            +  K          +N F   +R +++ GHS+G ++A H+        +VV K+ L+TP
Sbjct: 149 DVLKKWPAAVPKDREVNPFD--NRKIVLTGHSMGCFLACHLYEQHLAALKVVEKMVLLTP 206

Query: 139 TVVDIHRSQKGTQLTR-AFYWVKYLPDIAAWVSDMLFNKLSSI 180
               I +  K   L + A Y V  LP    W+ D+  NK   +
Sbjct: 207 PKAHIEQLSKDRHLIQWALYGVFKLP----WLFDIYRNKFDQV 245

>YBR204C Chr2 complement(632254..633381) [1128 bp, 375 aa] {ON}
           LDH1Serine hydrolase; exhibits active esterase plus weak
           triacylglycerol lipase activities; proposed role in
           lipid homeostasis, regulating phospholipid and non-polar
           lipid levels and required for mobilization of LD-stored
           lipids; localizes to the lipid droplet (LD) surface;
           contains a classical serine containing catalytic triad
           (GxSxG motif)
          Length = 375

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/163 (25%), Positives = 73/163 (44%), Gaps = 17/163 (10%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKAT--IYTLDD 86
           +FV++PG  G ++ +E  L L+     +F  L +   G ++E  D    K    I+ L  
Sbjct: 88  VFVFVPGLAGNLEQFEPLLELVDSDQKAFLTLDLPGFGHSSEWSDYPMLKVVELIFVLVC 147

Query: 87  QIQHKVEI-------INQFSAKDRPLIVMGHSVGAYMAQHVVLAEKLLGRVVK-LGLITP 138
            +  K          +N F+     ++++GHS+G ++A H+        + V+ L L+TP
Sbjct: 148 DVLRKWSTAVPNNDNVNPFNG--HKIVLVGHSMGCFLACHLYEQHMADTKAVQTLVLLTP 205

Query: 139 TVVDIHRSQKGTQLTR-AFYWVKYLPDIAAWVSDMLFNKLSSI 180
               I +  K   + + A Y V  LP    W+ D+  NK   +
Sbjct: 206 PKAHIEQLSKDKHIIQWALYGVFKLP----WLFDVYRNKFDQV 244

>Suva_4.459 Chr4 complement(802339..803466) [1128 bp, 375 aa] {ON}
           YBR204C (REAL)
          Length = 375

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 73/163 (44%), Gaps = 17/163 (10%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATE--DPDLQKRKATIYTLDD 86
           +FV++PG  G ++ +E  L LL  +  +F        G ++E  D  + K    I+ L  
Sbjct: 88  VFVFVPGLGGNLEQFEPLLKLLDSERKAFLAFDSPGFGQSSEWNDYPMLKVVELIFVLVC 147

Query: 87  QIQHKVEIINQFSAKD-------RPLIVMGHSVGAYMAQHVVLAEKLLGRVVK-LGLITP 138
            +  K       S  D       R ++++GHS+G ++A H+      +  VVK   L+TP
Sbjct: 148 DVLKKWP--TAVSKDDDTNLLNGRKIVLVGHSMGCFLACHLYEQHLAILNVVKRFVLLTP 205

Query: 139 TVVDIHRSQKGTQLTR-AFYWVKYLPDIAAWVSDMLFNKLSSI 180
               I +  K  +L + A Y +  LP    W+ D+  NK   +
Sbjct: 206 PKAHIEQLSKDRRLFQWALYGIFKLP----WLFDIYRNKFDQV 244

>KAFR0E03110 Chr5 (621949..623019) [1071 bp, 356 aa] {ON} 
          Length = 356

 Score = 38.5 bits (88), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 5/110 (4%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDDQI 88
           LF+ IPG  G ++ +E  + L+     +F  LAI   G    +         I TL DQ+
Sbjct: 82  LFLCIPGLGGNLEQFEPLVRLIDASNKNF--LAIDLPGFGKSEDYSNYSMTHIATLIDQM 139

Query: 89  QHKVEIINQFSAKDRPLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITP 138
              +E +   +  +  + VMGHS+G ++A H          V KL L++P
Sbjct: 140 ---LETVIGTAPDNYKINVMGHSMGTHLALHFYELFNKKYTVEKLILVSP 186

>TDEL0B03250 Chr2 complement(575015..576061) [1047 bp, 348 aa] {ON}
           Anc_8.524 YBR204C
          Length = 348

 Score = 37.4 bits (85), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 62/140 (44%), Gaps = 17/140 (12%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDDQI 88
           LF++I G  G ++ +E  L  L ++  SF  LA    G    D   Q      Y + D +
Sbjct: 80  LFLFIHGLGGTLEQFEPVLRELDQRNKSF--LAFDLPGFGKSDEWDQ------YPMLDVV 131

Query: 89  QHKVEIINQFSA--KDRPLIVMGHSVGAYMAQHVVL---AEKLLGRVVKLGLITPTVVDI 143
           +    +I+Q +   K   L ++GHS+G Y+A H  L       + R+V L    P V  +
Sbjct: 132 KSIDWLIHQLTNNLKFEKLNLIGHSMGCYLAVHFYLLFHESWCISRLVLLAPPKPNVDQL 191

Query: 144 HRS----QKGTQLTRAFYWV 159
            +S    Q G Q    F W+
Sbjct: 192 SKSKYLIQFGLQTGFRFPWM 211

>TBLA0H03540 Chr8 (863267..864403) [1137 bp, 378 aa] {ON} Anc_8.524
           YBR204C
          Length = 378

 Score = 34.7 bits (78), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 62/133 (46%), Gaps = 11/133 (8%)

Query: 29  LFVWIPGNPGIVQYYEEFLNL---LHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLD 85
           ++V++PG  G +  YE  L L   L+EK+  F++     +   T +      K   + ++
Sbjct: 96  IYVFLPGLGGSLDQYEPLLRLMDILNEKFIGFDLPGFGGSEEDTSEGGYNMIKVC-HIIN 154

Query: 86  DQIQHKVEIINQ-FSAKDR-PLIVMGHSVGAYMAQHVV--LAEKLLGRVVKLGLITPTVV 141
           + +Q    II Q +S +D   L ++GHS+G Y+  H       K   ++ +L L +P   
Sbjct: 155 EALQ---SIITQNYSTRDTIELRLVGHSMGCYLVLHFFNSFQTKTEYKISQLILTSPPKK 211

Query: 142 DIHRSQKGTQLTR 154
            I    K  +L +
Sbjct: 212 KIEPLDKNNRLNQ 224

>Suva_11.131 Chr11 (249525..250466) [942 bp, 313 aa] {ON} YKL094W
           (REAL)
          Length = 313

 Score = 33.1 bits (74), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 38/163 (23%), Positives = 67/163 (41%), Gaps = 11/163 (6%)

Query: 45  EFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEI-INQFSAKDR 103
           +F  + H   + +E       G     P   K     Y + + ++H VE  +++  AK  
Sbjct: 56  QFRLMDHLSLNGYESFTFDQRGAGVTSPGKLKGITNEYQVFNDLEHFVERNLSECKAKGI 115

Query: 104 PLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIHRS---QKGTQLTRAFYWVK 160
           PL + GHS+G  +  +     K    +       P ++ +H      K TQ+  A    K
Sbjct: 116 PLFMWGHSMGGGICLNYACQGKHKNEISGYIGSGPLII-LHPHTMYSKPTQIA-APLLAK 173

Query: 161 YLPDIAAWVSDMLFNKLSSIMFTDQVISLFMGVDKESVPVATS 203
           +LP +    + +  N ++S    D+    F+G D  SVP+  S
Sbjct: 174 FLPKVRI-DTGLDLNGMTS----DKAYRDFLGNDPMSVPLYGS 211

>NDAI0C05430 Chr3 (1259106..1260194) [1089 bp, 362 aa] {ON}
           Anc_8.524 YBR204C
          Length = 362

 Score = 32.7 bits (73), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 54/112 (48%), Gaps = 10/112 (8%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATE--DPDLQKRKATIYTLDD 86
           L+++I G  G+++ +E  L LL    + F  L +   G + E  D ++    + I+T+ D
Sbjct: 91  LYLFIHGLGGVLEQFEPLLRLLDLNENKFLALDLPGFGKSDEYEDYNMFDVISIIHTIVD 150

Query: 87  QIQHKVEIINQFSAKDRPLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITP 138
           ++  +    N        ++++GHS+G Y++ H+           KL  ++P
Sbjct: 151 RLIPERTTSN--------IVLVGHSMGCYISLHLFYKSYTRFSFKKLVFLSP 194

>KAFR0E03120 Chr5 (623464..624504) [1041 bp, 346 aa] {ON} Anc_8.524
           YBR204C
          Length = 346

 Score = 32.7 bits (73), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 61/137 (44%), Gaps = 16/137 (11%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKA-TIYTLDDQ 87
           +++ +PG  G +  Y + L L+ +   SF         ++ + PD    KA + Y++ + 
Sbjct: 84  VYLMLPGLGGNMDQYIQLLRLIDKCNQSF---------VSIDPPDFTSDKALSNYSMYNI 134

Query: 88  IQHKVEIINQFSAKDR-PLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVD---- 142
            +   E +++     +  L ++GHS+G Y++ H          V KL L+TP + D    
Sbjct: 135 AKLYEETLSRLVGTSKFKLNIVGHSLGTYISIHFYHLFNYKYNVEKLILLTPPMSDRDLP 194

Query: 143 -IHRSQKGTQLTRAFYW 158
              R  + T L   F W
Sbjct: 195 IYTRVIRSTALYAIFTW 211

>NCAS0B02260 Chr2 complement(374788..375879) [1092 bp, 363 aa] {ON}
           Anc_8.524 YBR204C
          Length = 363

 Score = 32.3 bits (72), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 34/136 (25%), Positives = 58/136 (42%), Gaps = 12/136 (8%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDDQI 88
           L ++I G  G +  +E  L L H K   F  L +   G + E  +    K+ I T+   +
Sbjct: 83  LHLFIHGLGGSLGQFEPLLRLTHLKGKKFLTLDLPGFGQSDE-LESYSMKSVIETIRSVV 141

Query: 89  QHKVEIINQFSAKDR---PLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIHR 145
              +   NQ S  +     LI+ GHS+G Y+  H          + K+ L++P    +  
Sbjct: 142 D--LATGNQKSLGENTQLKLILTGHSMGCYLCLHFFETYSKNYDIRKIALLSPPKPIM-- 197

Query: 146 SQKGTQLTRAFYWVKY 161
               T L++  YW ++
Sbjct: 198 ----TSLSKRNYWTQW 209

>ZYRO0F09064g Chr6 (735162..736211) [1050 bp, 349 aa] {ON} similar
           to uniprot|P38139 Saccharomyces cerevisiae YBR204C
           Hypothetical ORF
          Length = 349

 Score = 32.0 bits (71), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 52/110 (47%), Gaps = 10/110 (9%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDDQI 88
           LF++I G  G ++ +E  L L+      F  LA+   G    D      +   Y +   +
Sbjct: 85  LFLFIHGLGGELEQFEPLLRLVDAMDQRF--LALDLPGFGKSD------EWDEYPMLKVV 136

Query: 89  QHKVEIINQFSAKDRPLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITP 138
           +   EI  +F+A    ++++GHS+G Y+  H   A   +  + ++ L++P
Sbjct: 137 ETIEEIAAKFNAAK--IVLVGHSMGCYLTSHFYEAYHKVHSINRIVLLSP 184

>KLTH0D05742g Chr4 (512469..513410) [942 bp, 313 aa] {ON} similar to
           uniprot|P28321 Saccharomyces cerevisiae YKL094W YJU3
           Protein of unknown function localizes to lipid particles
          Length = 313

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 30/148 (20%), Positives = 60/148 (40%), Gaps = 8/148 (5%)

Query: 58  EILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMA 117
           E  A    G     P  Q+ +   Y   + + H +E   +    + PL + GHS+G  + 
Sbjct: 80  ESFAFDQRGSGETSPGKQRGRTNEYHTFNDLDHFIEWNLEDKDPETPLFLFGHSMGGGIV 139

Query: 118 QHVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFYWVKYLPDIAAWVSDMLFNKL 177
            +   A +   ++  + + T  ++++H     ++L  A       P +AA + +   +  
Sbjct: 140 LNYGCAGRFRDQIAGI-VCTGPLIELHPHSAPSRLVTALS-----PLLAACLPNFRIDTG 193

Query: 178 SSIMFT--DQVISLFMGVDKESVPVATS 203
             I  T  D+    F+  D  +VP+  S
Sbjct: 194 LDIDATTSDERYRNFLSRDPLTVPLYGS 221

>YKL094W Chr11 (263349..264290) [942 bp, 313 aa] {ON}
           YJU3Monoglyceride lipase (MGL), functional ortholog of
           mammalian MGL, localizes to lipid particles and
           membranes, also member of the eukaryotic serine
           hydrolase family
          Length = 313

 Score = 32.0 bits (71), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 39/163 (23%), Positives = 66/163 (40%), Gaps = 11/163 (6%)

Query: 45  EFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDDQIQHKVEI-INQFSAKDR 103
           +F  + H   + +E       G     P   K     Y + + ++H VE  +++  AK  
Sbjct: 56  QFRLMDHLSLNGYESFTFDQRGAGVTSPGRSKGVTDEYHVFNDLEHFVEKNLSECKAKGI 115

Query: 104 PLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIHRS---QKGTQLTRAFYWVK 160
           PL + GHS+G  +  +     K    +       P ++ +H      K TQ+  A    K
Sbjct: 116 PLFMWGHSMGGGICLNYACQGKHKNEISGYIGSGPLII-LHPHTMYNKPTQII-APLLAK 173

Query: 161 YLPDIAAWVSDMLFNKLSSIMFTDQVISLFMGVDKESVPVATS 203
           +LP +   +   L   L  I  +D+    F+G D  SVP+  S
Sbjct: 174 FLPRVR--IDTGL--DLKGIT-SDKAYRAFLGSDPMSVPLYGS 211

>TPHA0L01600 Chr12 (338450..339568) [1119 bp, 372 aa] {ON} Anc_8.524
           YBR204C
          Length = 372

 Score = 31.6 bits (70), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 57/127 (44%), Gaps = 4/127 (3%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDDQI 88
           ++++I G  G ++ +   L L      SF  +A+   G    + + +   A  Y++   I
Sbjct: 91  IYIFIHGLGGSLEQFLPLLKLTDLSNKSF--IAVDLPGFGQSEFNDEYNIAN-YSMSSII 147

Query: 89  QH-KVEIINQFSAKDRPLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIHRSQ 147
              K ++ +++   +  +I+ GHS+G Y+A H     K   ++ K+ L+ P      R  
Sbjct: 148 GFLKSQVFSRYLTTNTKIILTGHSMGCYLALHFYQQYKTEYQIQKIVLLAPPNPHETRLD 207

Query: 148 KGTQLTR 154
           K    TR
Sbjct: 208 KSNYSTR 214

>KNAG0A03770 Chr1 complement(494021..495091) [1071 bp, 356 aa] {ON}
           Anc_8.524 YBR204C
          Length = 356

 Score = 31.2 bits (69), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 32/133 (24%), Positives = 64/133 (48%), Gaps = 19/133 (14%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLL--HEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDD 86
           L ++I G  G +  +   L LL   EKY     +AI   G    D      + T Y +  
Sbjct: 84  LSIFIHGLGGSLDQFFPLLKLLDLSEKY----FVAIDLPGFGKSD------EHTDYPMIQ 133

Query: 87  QIQHKVEIINQFSAKDR----PLIVMGHSVGAYMAQH--VVLAEKL-LGRVVKLGLITPT 139
            ++H   +I++   + R     + ++GHS+G Y+  H   + ++K  +G+VV L    P 
Sbjct: 134 VVKHIDAVISELLNEARLAFDTVRLIGHSMGCYLTLHFMTLFSKKYRIGKVVLLAPPKPE 193

Query: 140 VVDIHRSQKGTQL 152
           ++++++ ++  Q+
Sbjct: 194 MIELNKDKRLVQV 206

>CAGL0M05467g Chr13 complement(583722..584786) [1065 bp, 354 aa]
           {ON} weakly similar to uniprot|P38139 Saccharomyces
           cerevisiae YBR204c peroxisomal serine-active lipase
          Length = 354

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 27/114 (23%), Positives = 51/114 (44%), Gaps = 13/114 (11%)

Query: 29  LFVWIPGNPGIVQYYE---EFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKATIY-TL 84
           +F+ I G  G +  ++   + L LL  +  + ++     +G +T   D+    + +   +
Sbjct: 77  VFLLIHGLGGSMDQFQPLMKLLTLLKYRVIALDLPGFGQSGSSTNGYDMLYVTSVVKKVV 136

Query: 85  DDQIQHKVEIINQFSAKDRPLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITP 138
           D+ I++K +I            V+GHS+G Y+A H V        + KL L  P
Sbjct: 137 DNNIENKTDI---------DFKVVGHSMGCYIASHFVQMYHEEYNIDKLVLTCP 181

>ADR190W Chr4 (1035094..1035819) [726 bp, 241 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR428C
          Length = 241

 Score = 30.8 bits (68), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 8/67 (11%)

Query: 65  AGMATEDPDLQKRKATIYTLDDQIQHKVEI------INQFSAKD--RPLIVMGHSVGAYM 116
           A    ED  L  + A  Y L  ++QH V +      I+Q   +   R L ++GHSVGA +
Sbjct: 41  AARVREDAPLASQYAVTYRLSPEVQHPVHVADCVEHISQLIVEKGIRKLHLLGHSVGATL 100

Query: 117 AQHVVLA 123
              ++ A
Sbjct: 101 CWQILTA 107

>SAKL0H10450g Chr8 complement(897598..898776) [1179 bp, 392 aa] {ON}
           similar to uniprot|P38139 Saccharomyces cerevisiae
           YBR204C Hypothetical ORF
          Length = 392

 Score = 31.2 bits (69), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 36/73 (49%), Gaps = 6/73 (8%)

Query: 92  VEIINQFSAK---DRPLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVD---IHR 145
           V I+ +  AK    R L+++GHS+G Y+A H   A +      +L L+ P  +D   + R
Sbjct: 182 VAIVQKTFAKLTPSRNLVLIGHSMGCYLAIHFCSAFQEQYSFQELVLLAPPSLDLPQVER 241

Query: 146 SQKGTQLTRAFYW 158
           +     ++  F W
Sbjct: 242 TSTRVLMSLLFRW 254

>SAKL0G05104g Chr7 complement(422194..422940) [747 bp, 248 aa] {ON}
           similar to uniprot|Q04066 Saccharomyces cerevisiae
           YDR428C Hypothetical ORF
          Length = 248

 Score = 30.0 bits (66), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 9/51 (17%)

Query: 107 VMGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIHRSQKGTQLTRAFY 157
           ++GHSVGA +A  V    K L      GLI    VD+ RS    +LT+ ++
Sbjct: 101 ILGHSVGATLAWQVATCNKELD-----GLIDREKVDVIRS----KLTKCYF 142

>Kwal_27.11975 s27 (1028242..1029252) [1011 bp, 336 aa] {ON} YBR204C
           - Hypothetical ORF [contig 26] FULL
          Length = 336

 Score = 29.6 bits (65), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 46/91 (50%), Gaps = 9/91 (9%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDDQI 88
           ++V+I G  G +  +E  L +L    + F  L I   G    D      +   Y++ D  
Sbjct: 80  VYVFIHGLGGTLTQFEPLLRVLDVLNEGF--LTIDLPGFGHSD------ELDSYSMLDIA 131

Query: 89  QHKVEIINQFSAKDRPLIVMGHSVGAYMAQH 119
           +   E++ + + K++ +IV+GHS+G ++A H
Sbjct: 132 KIIREVLVE-TTKNKKVIVVGHSMGCHIALH 161

>Kpol_299.6 s299 (14238..15287) [1050 bp, 349 aa] {ON}
           (14238..15287) [1050 nt, 350 aa]
          Length = 349

 Score = 29.6 bits (65), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 27/126 (21%), Positives = 53/126 (42%), Gaps = 8/126 (6%)

Query: 29  LFVWIPGNPGIVQYYEEFLNLLHEKYDSFEILAISHAGMATEDPDLQKRKATIYTLDDQI 88
           ++++I G  G  + +E  L L+      F  + +   G + E           Y + D I
Sbjct: 84  VYLFIHGLGGNFEQFEPLLRLVDASDKKFLTMDLPGFGKSDE--------LESYGMFDII 135

Query: 89  QHKVEIINQFSAKDRPLIVMGHSVGAYMAQHVVLAEKLLGRVVKLGLITPTVVDIHRSQK 148
           +    +  +F    + + V+GHS+G  ++ H +        + +L L+TP   +  R  +
Sbjct: 136 EVINYVAKKFIKDGKSINVIGHSMGCLLSIHFMEKFSKELNITQLVLLTPPNPEDTRLSR 195

Query: 149 GTQLTR 154
              LTR
Sbjct: 196 SNYLTR 201

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.323    0.136    0.405 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 29,412,590
Number of extensions: 1174209
Number of successful extensions: 3216
Number of sequences better than 10.0: 44
Number of HSP's gapped: 3269
Number of HSP's successfully gapped: 44
Length of query: 305
Length of database: 53,481,399
Length adjustment: 109
Effective length of query: 196
Effective length of database: 40,982,805
Effective search space: 8032629780
Effective search space used: 8032629780
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 65 (29.6 bits)