Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D10054g3.489ON66466434280.0
TDEL0D055703.489ON64966618360.0
Kpol_480.163.489ON65566916290.0
NCAS0E008303.489ON67168215880.0
SAKL0F02838g3.489ON65467215490.0
TPHA0D042303.489ON65266915460.0
Suva_7.4163.489ON71371915300.0
TBLA0C044603.489ON69871115250.0
KLTH0F14762g3.489ON65067115180.0
Smik_6.2243.489ON70571015070.0
Skud_7.4393.489ON71372114630.0
YGR128C (UTP8)3.489ON71372014490.0
AFR307C3.489ON65067114350.0
NDAI0G009603.489ON70071813491e-178
KLLA0E04665g3.489ON64766913341e-176
CAGL0I10560g3.489ON67870213101e-172
Kwal_55.212223.489ON3733898811e-112
KAFR0C019403.489ON6096848031e-97
KNAG0B008303.489ON6076817971e-96
Kwal_55.21225singletonOFF2152144793e-55
KAFR0F023803.225ON312102800.40
KNAG0A074603.408ON1040140733.4
Kpol_1054.422.25ON308104714.6
SAKL0E01694g6.36ON20578695.6
TBLA0C036305.206ON238780708.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D10054g
         (664 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} simila...  1325   0.0  
TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa] ...   711   0.0  
Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON} (33288..3...   632   0.0  
NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.4...   616   0.0  
SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} simila...   601   0.0  
TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {O...   600   0.0  
Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON...   593   0.0  
TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa] ...   592   0.0  
KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]...   589   0.0  
Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON...   585   0.0  
Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON...   568   0.0  
YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}  ...   562   0.0  
AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON} S...   557   0.0  
NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.4...   524   e-178
KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} simila...   518   e-176
CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} simi...   509   e-172
Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {...   343   e-112
KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {O...   313   1e-97
KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.4...   311   1e-96
Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {O...   189   3e-55
KAFR0F02380 Chr6 complement(462858..463796) [939 bp, 312 aa] {ON...    35   0.40 
KNAG0A07460 Chr1 (1170179..1173301) [3123 bp, 1040 aa] {ON} Anc_...    33   3.4  
Kpol_1054.42 s1054 complement(100453..101379) [927 bp, 308 aa] {...    32   4.6  
SAKL0E01694g Chr5 complement(131246..131863) [618 bp, 205 aa] {O...    31   5.6  
TBLA0C03630 Chr3 (860550..867713) [7164 bp, 2387 aa] {ON} Anc_5....    32   8.4  

>ZYRO0D10054g Chr4 (847992..849986) [1995 bp, 664 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 664

 Score = 1325 bits (3428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 652/664 (98%), Positives = 652/664 (98%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60
           MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP
Sbjct: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60

Query: 61  KLLSNISIPSTNVVSACDVATLADDKEIWCYCVKSGKSHFLNASVKPVDADTVLDTDGGD 120
           KLLSNISIPSTNVVSACDVATLADDKEIWCYCVKSGKSHFLNASVKPVDADTVLDTDGGD
Sbjct: 61  KLLSNISIPSTNVVSACDVATLADDKEIWCYCVKSGKSHFLNASVKPVDADTVLDTDGGD 120

Query: 121 KTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYF 180
           KTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYF
Sbjct: 121 KTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYF 180

Query: 181 SENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQSG 240
           SENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQSG
Sbjct: 181 SENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQSG 240

Query: 241 KLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQVYLLDL 300
           KLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQVYLLDL
Sbjct: 241 KLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQVYLLDL 300

Query: 301 VHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALEVI 360
           VHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALEVI
Sbjct: 301 VHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALEVI 360

Query: 361 NVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSDEVVAFAYEDIFKEL 420
           NVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSDEVVAFAYEDIFKEL
Sbjct: 361 NVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSDEVVAFAYEDIFKEL 420

Query: 421 SKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQEYPRAXXXX 480
           SKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQEYPRA    
Sbjct: 421 SKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQEYPRALTFL 480

Query: 481 XXXXXXXXDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISLRI 540
                   DCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISLRI
Sbjct: 481 LTHPLFPTDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISLRI 540

Query: 541 LQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQLLSLVIDAIGLFA 600
           LQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQLLSLVIDAIGLFA
Sbjct: 541 LQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQLLSLVIDAIGLFA 600

Query: 601 LDGALLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYTVE 660
           LDGALLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYTVE
Sbjct: 601 LDGALLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYTVE 660

Query: 661 YLEL 664
           YLEL
Sbjct: 661 YLEL 664

>TDEL0D05570 Chr4 complement(1005376..1007325) [1950 bp, 649 aa]
           {ON} Anc_3.489 YGR128C
          Length = 649

 Score =  711 bits (1836), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/666 (55%), Positives = 490/666 (73%), Gaps = 19/666 (2%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60
           MPS+ Q F+L+VLPR+ +LSN+  Q+++L+V+ DI P SN+ITIGISESAISQY+LNPTP
Sbjct: 1   MPSLSQSFKLAVLPRVASLSNFAFQTNFLQVADDIEPTSNRITIGISESAISQYVLNPTP 60

Query: 61  KLLSNISIPSTNVVSACDVATLADDKEIWCYCVKSGKSHFLNASVKPVDADTVLDTDGGD 120
           KL+ +I IPSTN+V+ACDVA  +D++EIWCY +++GK   LN + K   A+  +++D   
Sbjct: 61  KLVLSIPIPSTNIVTACDVAR-SDEQEIWCYALQAGKVCTLNVASKVSHAENGVNSD--- 116

Query: 121 KTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYF 180
             +  K+K+D + VG+ +    K IVVVL++GLIQ+YDFQL+ L SLD+SY +V V  +F
Sbjct: 117 --DVLKVKVDDQAVGVHVNGKDKTIVVVLKNGLIQFYDFQLKLLHSLDVSYSDVSVTKFF 174

Query: 181 SENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQSG 240
           +E   +F+F+L     +KVCFKLFEL   +  +  PIKELS+ ILE+F+L  SK+CYQSG
Sbjct: 175 TEGANDFLFILCSLPEDKVCFKLFELSLPNYNQ-VPIKELSSIILEDFSLATSKICYQSG 233

Query: 241 KLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQVYLLDL 300
           +LY+L G  +  YALPQC LVQ   LPM+    +  +S+ P+S+NRIL+T +N++YLL+L
Sbjct: 234 RLYRLIGHEVLVYALPQCQLVQAVTLPMV--QGADVISMKPISSNRILVTADNKIYLLNL 291

Query: 301 VHSSVLSERTLTHAKTFQLLRSAPLN--VSSSLKGSEFATRTLAIGVTTKNGNNPTSALE 358
            H+S+L +R LTH K+FQLL+SA ++  VSSSL       +T  IGV TK+G NPTS+LE
Sbjct: 292 THNSILFQRELTHLKSFQLLKSAVIDSRVSSSLPNQ----KTFVIGVGTKHGKNPTSSLE 347

Query: 359 VINVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSDEVVAFAYEDIFK 418
           ++NVDVGTGTLKDSLGK F   N+  +  L+PLFSD++++A D  +  E   F +  I++
Sbjct: 348 IVNVDVGTGTLKDSLGKGFTVSNEPISQVLKPLFSDEDNEAEDEDNKFE--HFDFNQIYQ 405

Query: 419 ELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQEYPRAXX 478
            L KN +SIS FD  F + LNI+ EHYT+ +RFICD++FLS VV LIL +F +EYP+A  
Sbjct: 406 HLEKNKQSISSFDRIFLRELNIKREHYTELDRFICDRQFLSNVVHLILQNFQEEYPKALT 465

Query: 479 XXXXXXXXXXDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISL 538
                     DCT  LL R R HPRLFKQAIVTCPNLPL +LLSELFSI NGEL LDISL
Sbjct: 466 FLLTHPLFPVDCTPKLLSRLREHPRLFKQAIVTCPNLPLQELLSELFSIENGELSLDISL 525

Query: 539 RILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQLLSLVIDAIGL 598
           RILQD+TTDMIK EV+KLNK+DV NF+ F+IS  DE  I  +S+++LFQLLSLV+D+IGL
Sbjct: 526 RILQDYTTDMIKQEVRKLNKIDVQNFIEFVISSNDENAI--RSSHQLFQLLSLVLDSIGL 583

Query: 599 FALDGALLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYT 658
           FALDG LL RL+DYI E+V +AERN++L +LLD +  +RG   S AGS  +  + +PKYT
Sbjct: 584 FALDGVLLDRLADYIQERVAIAERNSKLCHLLDDKQNSRGFAKSGAGSVGSTREAVPKYT 643

Query: 659 VEYLEL 664
           VEYL+L
Sbjct: 644 VEYLDL 649

>Kpol_480.16 s480 (33288..35255) [1968 bp, 655 aa] {ON}
           (33288..35255) [1968 nt, 656 aa]
          Length = 655

 Score =  632 bits (1629), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/669 (50%), Positives = 448/669 (66%), Gaps = 19/669 (2%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60
           MPS  QPFRL+VLP+I +LSN E Q   L+++ D S  SNKITIGIS S ISQYI+NPTP
Sbjct: 1   MPSFSQPFRLAVLPKILSLSNVETQISSLQIADDFSLESNKITIGISGSTISQYIINPTP 60

Query: 61  KLLSNISIPSTNVVSACDVATLADDK-----EIWCYCVKSGKSHFLNASVKPVDADTVLD 115
            L+ N+ IPSTN V+AC++     D      E W Y +   K+H LN S+K  D D    
Sbjct: 61  SLVFNVPIPSTNNVTACNIGHFVSDTDGSKLECWAYGLSYNKNHTLNISIKTSDDDKYA- 119

Query: 116 TDGGDKTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVK 175
           T GG+  E +  K D K+  IKI    K IVVVL++GLIQ+YDF L+ L S+++ Y ++ 
Sbjct: 120 TSGGEVVETYSQKCDDKIEHIKINEKEKVIVVVLKNGLIQFYDFTLKLLKSVNVMYSDIS 179

Query: 176 VVNYFSENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKL 235
            V +F E+G+ F  +LS  E  K+ FKL+EL  +D    T I ELS+TILE+ +L +S++
Sbjct: 180 FVEHFEEDGKQFAIILSNIEGKKISFKLYELFTND---KTSINELSSTILEDADLGESQI 236

Query: 236 CYQSGKLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQV 295
           CYQ GK+Y+L    +  Y LPQC L QT  LP I   +S  +S +P++ NRILLTVNN++
Sbjct: 237 CYQFGKIYRLFEDRLYIYNLPQCQLQQTIELPFIQKKDSDVLSFSPIANNRILLTVNNKI 296

Query: 296 YLLDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTS 355
           YLLDLVH+S+L+ER L+H K +QLL+S    +    KG    ++T+AIGV+ KNG +P S
Sbjct: 297 YLLDLVHNSILAERDLSHVKVYQLLKS----IVVPSKGENKNSKTIAIGVSIKNGPSPIS 352

Query: 356 ALEVINVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSDEVVAFAYED 415
           +LEVINVDVG+GTLKDSLGKSFQ  N  K   LQ LF +DE+         E  +F Y++
Sbjct: 353 SLEVINVDVGSGTLKDSLGKSFQVANVKKNIPLQSLFPEDETIYAKG----EQKSFDYKN 408

Query: 416 IFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQEYPR 475
           I +EL  N   I+KFD  F K+LNI +E+YT+++RFI DQ+FLS V+ LI  +F ++YPR
Sbjct: 409 ILQELQNNKNDINKFDDIFFKKLNIMKEYYTEQDRFIYDQKFLSDVLDLIFSAFKKDYPR 468

Query: 476 AXXXXXXXXXXXXDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLD 535
           A              TR LL +FRN PRLFKQA+VTCPNLPL +LL+ELF+I NGELCLD
Sbjct: 469 ALTFLLTHPLFPISHTRNLLTKFRNQPRLFKQAVVTCPNLPLKELLAELFTITNGELCLD 528

Query: 536 ISLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQLLSLVIDA 595
           ISLRILQD+T D IK E+K L+KVD+ NF+ F+I    E+  +++   +LFQLLSLV+DA
Sbjct: 529 ISLRILQDYTRDSIKQELKTLSKVDIQNFIEFVIDTDSED--KSQFNPQLFQLLSLVLDA 586

Query: 596 IGLFALDGALLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLP 655
            GLFAL+   L++LS YID QV +AERN RLW+LLD  +  R         +  + ++L 
Sbjct: 587 SGLFALEEETLEKLSAYIDNQVNVAERNNRLWHLLDENSDKRSTLNQANDQNVLQTKSLS 646

Query: 656 KYTVEYLEL 664
            Y+VEYLEL
Sbjct: 647 AYSVEYLEL 655

>NCAS0E00830 Chr5 (151952..153967) [2016 bp, 671 aa] {ON} Anc_3.489
           YGR128C
          Length = 671

 Score =  616 bits (1588), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/682 (50%), Positives = 472/682 (69%), Gaps = 29/682 (4%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVS-SDISPNSNKITIGISESAISQYILNPT 59
           MPS+ QPFRL++LP+I +LSN+ +QSDY++V+ S  SP +NKITIGIS S++SQYI+NPT
Sbjct: 1   MPSLSQPFRLTILPKIASLSNFALQSDYIQVNDSTFSPTTNKITIGISGSSVSQYIVNPT 60

Query: 60  PKLLSNISIPSTNVVSACDV-ATLADDKEIWCYCVKSGKSHFLNASVK---PVDADTVLD 115
           PKL+ N  IPSTN+V+AC+V       +E WC+   + K+  LN   K     + +   D
Sbjct: 61  PKLIFNFPIPSTNIVTACNVFEQKGSSEETWCFATMANKTSTLNLINKNQYQTNEEESGD 120

Query: 116 TDGGDK--TEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQN 173
           +   D   T +FKIK D  VV IKI+ + K I+VVL++G IQ YDF+L+ L+S++++Y N
Sbjct: 121 SAPSDSSVTSEFKIKADDHVVDIKIL-NKKKIIVVLKNGKIQTYDFELKLLNSINMAYNN 179

Query: 174 VKVVNYFSENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQS 233
           V+ V +F E+G++FMFVL   EN+KVC KLF++  +    +    EL++TILENF L+ +
Sbjct: 180 VRFVEHFHEDGKDFMFVLCDLENDKVCLKLFQINENIETINDSAIELTSTILENFPLENA 239

Query: 234 KLCYQSGKLYQLEGSTIKTYALPQCHLVQTTHLPMILD--PNSQKVSLAPVSTNRILLTV 291
           K CYQ GK Y+L    I  Y+LPQ     +  LPMI D     + VS  P+S NRILLTV
Sbjct: 240 KFCYQFGKFYKLTDDKILVYSLPQFQFQYSITLPMITDLKEGERVVSFKPISPNRILLTV 299

Query: 292 NNQVYLLDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGN 351
           NN++YLLDL+H+S+LSER LTH KTFQLL++A ++ + +        RTLAIGV+TK G+
Sbjct: 300 NNKIYLLDLIHNSILSERELTHLKTFQLLKTAVVDTNIN------QNRTLAIGVSTKFGS 353

Query: 352 NPTSALEVINVDVGTGTLKDSLGKSFQ-SINDSKTHNLQPLFSDDESDAGDNADSDEVVA 410
           NPTS+LE++NVDVGT T+KDSLGKSFQ S  ++   +L+ LF DDE+D  D     +V  
Sbjct: 354 NPTSSLELLNVDVGTSTIKDSLGKSFQTSSTENNVQSLKSLF-DDENDYSDKKK--QVKN 410

Query: 411 FAYEDIFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFD 470
           F YE I+KEL  +   ++KFD  F K  +I++E+YT+++RFI + EFL +++ LI ++F 
Sbjct: 411 FNYEKIYKELVDSKNDVTKFDDIFFKSFDIKKEYYTEKDRFIYNHEFLVQIIDLIFETFK 470

Query: 471 QEYPRAXXXXXXXXXXXXDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNG 530
           +EYP+             + T+GLL R  NHPRLFKQAIVTCPNLPL++LL+ELF+I+NG
Sbjct: 471 EEYPKTFTYLLTDPLFPLERTKGLLARLNNHPRLFKQAIVTCPNLPLNELLAELFTISNG 530

Query: 531 ELCLDISLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQLLS 590
           EL LDISLRILQD+T D IK E+KKL K++V NF+ F+I  ++ ++    +   LFQLLS
Sbjct: 531 ELSLDISLRILQDYTRDSIKKELKKLPKIEVENFIEFIID-EESDIKDTTNAPHLFQLLS 589

Query: 591 LVIDAIGLFALDGALLQRLSDYIDEQVYLAERNARLWNLLDTRN----KNRGATGSLAGS 646
           LV+D+IGLFALD A+L+RLS YIDEQV +A+ N  LW+LLD  N    KN     S +  
Sbjct: 590 LVVDSIGLFALDNAVLERLSKYIDEQVAIAQSNTELWHLLDYSNVLAYKNDKFVTSTSKD 649

Query: 647 S----RAKEQTLPKYTVEYLEL 664
           S    + +E+ LPKY+VEYL+L
Sbjct: 650 SNTSLKLQEEVLPKYSVEYLDL 671

>SAKL0F02838g Chr6 (240272..242236) [1965 bp, 654 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 654

 Score =  601 bits (1549), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/672 (47%), Positives = 453/672 (67%), Gaps = 28/672 (4%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60
           M SI QPFRL+ LP+I +L+N+  Q+DYL+V++ ++P++NKI IG+S S+ISQYI+NPTP
Sbjct: 1   MASISQPFRLTALPKIASLNNFSTQTDYLQVANTLTPSANKINIGVSGSSISQYIINPTP 60

Query: 61  KLLSNISIPSTNVVSACDVATL------ADDKEIWCYCVKSGKSHFLNASVKPVDADTVL 114
           KL+ N+SIPST++V+ACDV+ +       + +E+WCY + + KS  LN  +KP+ AD   
Sbjct: 61  KLVHNLSIPSTSIVTACDVSEIQQNEGDTETQEVWCYALVANKSFTLNTIIKPLTADAP- 119

Query: 115 DTDGGDKTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNV 174
             +     E++K+ +  KV  +KI P  K I+ VL++GL+Q +DFQL+ L S DISY N+
Sbjct: 120 SVNSTQTFENYKVSIKHKVASVKIFPSRKTIIAVLQNGLVQTFDFQLKLLHSADISYGNI 179

Query: 175 KVVNYFS-ENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQS 233
            +V YF+ E  Q+FM VL+   ++KVC+KLFE+++HD   + P+KEL++ ILE F+L  S
Sbjct: 180 SLVKYFTNEVLQDFMIVLTDLNDDKVCYKLFEIIHHDS--NVPLKELNSVILEGFSLQNS 237

Query: 234 KLCYQSGKLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNN 293
           K  YQ GK+Y L    I  Y+LP   L  T +LP +   N   VS  P+STNR LLTV+N
Sbjct: 238 KTFYQFGKIYTLSNGKISIYSLPHFQLSNTINLPFVTHENV--VSFKPISTNRALLTVDN 295

Query: 294 QVYLLDLVHSSVLSERTLTHAKTFQLLRSA--PLNVSSSLKGSEFATRTLAIGVTTKNGN 351
           ++YLLDL+H+++LS+R LTH KTFQLL +A  P N + +        +T+AIGV+TK+ N
Sbjct: 296 RIYLLDLLHNAILSQRELTHVKTFQLLTTAIIPGNTAEN-------NKTIAIGVSTKSDN 348

Query: 352 NPTSALEVINVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSDEVVAF 411
           N TSAL+++N++VG+GTLKDS+ K F +  D+    L  LF + + +  ++  S     F
Sbjct: 349 NATSALDIVNINVGSGTLKDSMSKGFLT-QDATEEVLNSLFDEQDDELDEDGTSQ----F 403

Query: 412 AYEDIFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQ 471
            Y  I  EL K      KFD+ F K LNI++E+YT+ +RF   Q FL KV+ LI ++F++
Sbjct: 404 DYNQILSELEKAKSKTEKFDNVFFKSLNIKKEYYTEYDRFFNSQGFLDKVLSLIFENFNK 463

Query: 472 EYPRAXXXXXXXXXXXXDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGE 531
           EYPRA                 LL +F+ HPRLF+QAIVTCPNLPLD LL ELF++ N E
Sbjct: 464 EYPRALTYLLTHPLFPAKHATCLLSKFKEHPRLFRQAIVTCPNLPLDALLHELFTVINDE 523

Query: 532 LCLDISLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQLLSL 591
           LCLD+SLRILQDFT D IK  +KK++KVD++NF+ F+I+  D+E  +NKS  +LFQLL+L
Sbjct: 524 LCLDLSLRILQDFTKDSIKQSIKKMSKVDINNFIGFVINEDDDEE-RNKSKPQLFQLLNL 582

Query: 592 VIDAIGLFALDGALLQRLSDYIDEQVYLAERNARLWNLL-DTRNKNRGATGSLAGSSRAK 650
           V+D+IGLFALDG  L+ L  +I+ QV + E+N  L NLL DT  K+     S + SS   
Sbjct: 583 VLDSIGLFALDGESLENLHQFIENQVDIVEQNIELLNLLDDTSAKSTSIISSYSASSSTT 642

Query: 651 EQTLPKYTVEYL 662
           EQ LP Y+VEYL
Sbjct: 643 EQALPSYSVEYL 654

>TPHA0D04230 Chr4 complement(913504..915462) [1959 bp, 652 aa] {ON}
           Anc_3.489 YGR128C
          Length = 652

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/669 (48%), Positives = 438/669 (65%), Gaps = 22/669 (3%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60
           MPS+ QPFRL++LP+I  LS+Y VQS  L+V+ D + +SNKITIG+S  A+SQY++NPTP
Sbjct: 1   MPSLSQPFRLAILPKIAVLSDYNVQSKLLQVADDFTLDSNKITIGVSGCAVSQYVINPTP 60

Query: 61  KLLSNISIPSTNVVSACDVATLADDK-----EIWCYCVKSGKSHFLNASVKPVDADTVLD 115
            +   + IPSTN V+AC+VA   D       EIW Y +   K + L+ ++K VD D    
Sbjct: 61  NVSQTVPIPSTNNVTACNVAQYKDADTEELFEIWVYNLAVNKKNTLHVAIKTVDPDK-FS 119

Query: 116 TDGGDKTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVK 175
           T   D  E + +K D+ VVGIKI  + K IVV L +G IQ +DF+L+ L+S++ SY N+ 
Sbjct: 120 TTQSDALETYTVKCDASVVGIKINKEDKTIVVTLGNGFIQIFDFKLKLLNSVNTSYDNIY 179

Query: 176 VVNYFSENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKL 235
              +F EN ++F  +LS  E NK+ +KL+EL    G+  T IKELS+TILE+     SK+
Sbjct: 180 FSEHFVENKKSFAIILSTIEGNKLSYKLYELF---GQDKTSIKELSSTILEDIQCKDSKI 236

Query: 236 CYQSGKLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQV 295
            YQ GKLY+L  + +  Y+LPQC LV T  LP I    SQ +S  PVS NRILLTV+N++
Sbjct: 237 SYQFGKLYRLYKNQMFVYSLPQCQLVDTITLPQIDLKKSQAISFKPVSNNRILLTVDNKI 296

Query: 296 YLLDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTS 355
           ++LDLVH + L+ER L H K FQLL+S  +  + +        +T+AIGV+ KNG +P +
Sbjct: 297 FILDLVHRATLAERVLGHVKMFQLLKSVVIETNDASNNH----KTIAIGVSVKNGPSPIT 352

Query: 356 ALEVINVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSDEVVAFAYED 415
           ALE+IN +VGTGTLKDSLG SF      K++ LQPLF+DD       A+  +   F YE 
Sbjct: 353 ALEIINANVGTGTLKDSLGNSFDVSKSFKSNILQPLFTDD-------ANLVKRHDFKYEA 405

Query: 416 IFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQEYPR 475
           I K+LS     I KFD  F   L IQ+ +YTD ERFI D  FLS V+ LI  +F +EYP 
Sbjct: 406 ILKKLSSTENDIKKFDDIFFGDLYIQQNYYTDNERFIFDVTFLSDVIDLIFKNFQKEYPS 465

Query: 476 AXXXXXXXXXXXXDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLD 535
           A              T+ LL + R HPRLFKQA+VTCPNLP+D+LL+ELFSI NGEL +D
Sbjct: 466 ALTFLLTHPLFPIHQTKNLLLKLREHPRLFKQAVVTCPNLPIDELLTELFSITNGELSVD 525

Query: 536 ISLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQLLSLVIDA 595
           ISLRILQD+T D IK E+K LNK+D+ NF++F+I P +EE  + K   +LF LLSLV+DA
Sbjct: 526 ISLRILQDYTKDSIKLELKNLNKIDIQNFIDFVIDPNNEE--EKKHNEQLFVLLSLVLDA 583

Query: 596 IGLFALDGALLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLP 655
            GLF+++G LL +LS+YID+QV + E++ +LW+L+D     R      +G++  + + L 
Sbjct: 584 SGLFSIEGPLLTQLSEYIDKQVEMIEKSNKLWHLIDGTLGKRNNHYQTSGATVPEIKALT 643

Query: 656 KYTVEYLEL 664
            Y+VEYLEL
Sbjct: 644 AYSVEYLEL 652

>Suva_7.416 Chr7 complement(718089..720230) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  593 bits (1530), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/719 (47%), Positives = 473/719 (65%), Gaps = 61/719 (8%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVS-SDISPNSNKITIGISESAISQYILNPT 59
           MPS+ QPFRL+ LP+I +LSN+ +Q+DY++V+    +  +N IT+GIS S+ISQYI+NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGPFNEFTNNITLGISGSSISQYIINPT 60

Query: 60  PKLLSNISIPSTNVVSAC-----------DVATLADDK--------------EIWCYCVK 94
           PKL  +  IPSTN+++AC           D     +DK              EIW + + 
Sbjct: 61  PKLTFDYPIPSTNIITACNAVQGQVEIENDTKNSDNDKTDHEVTNFQSKRDVEIWSFGLM 120

Query: 95  SGKSHF-LNASVKPVD-----ADTVLDTDGGDK-----TED----FKIKMDSKVVGIKII 139
             K ++ LN   K V+     ++  L  +G DK     T+D    +KIK   KV+ IKI 
Sbjct: 121 VNKGNYTLNVITKAVEDNDDTSNDHLTENGTDKKAYAGTDDILSQYKIKTKDKVMNIKID 180

Query: 140 PDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYFSENGQNFMFVLSGFENNKV 199
                ++ VL++GL+++YDF+L+ L S DISY N+K   +F+ENG  F+FVL   E++KV
Sbjct: 181 AKNSLVIAVLQNGLVEFYDFKLKLLHSYDISYGNLKYAKWFTENGTEFVFVLCPLEDDKV 240

Query: 200 CFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQSGKLYQLEGSTIKTYALPQCH 259
           C+KLFEL   +GK  +PIKELS+TI+E F+ + SK CYQ GKLY+L    I  Y+LP C 
Sbjct: 241 CYKLFELSDFEGKESSPIKELSSTIIEGFSFESSKFCYQFGKLYKLNQGKIHVYSLPHCQ 300

Query: 260 LVQTTHLPMILDPNSQK--VSLAPVSTNRILLTVNNQVYLLDLVHSSVLSERTLTHAKTF 317
           L Q   +P+I  P S+   +S  PVS NRILLTVNN +YLLDL+H S+L++R LTH +TF
Sbjct: 301 LQQIIDVPLINKPTSENDLISFQPVSVNRILLTVNNTIYLLDLLHCSILNQRELTHVRTF 360

Query: 318 QLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALEVINVDVGTGTLKDSLGKSF 377
           QLLRSA ++   S       ++T+AIG++TKNG NPTS+LE+IN+DVGT TLKDSLGKSF
Sbjct: 361 QLLRSAVIDSEKSQN-----SKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKSF 415

Query: 378 Q-SINDSKTHNLQPLFSDDESDAGDNADSDE------VVAFAYEDIFKELSK-NNKSISK 429
           Q   ND+ +  L+PLF DDE+ A +    ++      V  F Y++I K++S   N  ++ 
Sbjct: 416 QIGKNDTSSVVLKPLF-DDENVADNMVKRNDIDGNISVPTFQYDEIIKKISALKNNDVAS 474

Query: 430 FDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFD-QEYPRAXXXXXXXXXXXX 488
           FD  F K L ++EEHYT+++RFI D EFL++V+ LI + F+  +YP+A            
Sbjct: 475 FDDIFFKDLKVKEEHYTEKDRFISDSEFLNRVLDLIFEKFNGNDYPKALTFLLTHPLFPL 534

Query: 489 DCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTTDM 548
           + T  LL R R+ PRLFKQAIVTCPNLPL++LL ELFSI N EL LDIS RILQDFT D 
Sbjct: 535 NRTHNLLSRLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDS 594

Query: 549 IKDEVKKLNKVDVHNFVNFLISPKDEELIQN---KSTYELFQLLSLVIDAIGLFALDGAL 605
           IK E+K L+K+D+ NF++F+ +  ++  ++N     + +LFQLLSLV+D+IGLF+L+GAL
Sbjct: 595 IKQEMKNLSKLDIQNFIDFITNTDEDSTLENLNHSQSSQLFQLLSLVLDSIGLFSLEGAL 654

Query: 606 LQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYTVEYLEL 664
           L  L+ YID+QV +AERN  LWNL++T+    G T   + S  +++Q LP YT+EYLE+
Sbjct: 655 LDNLASYIDKQVEIAERNTELWNLVETKGSQHGFTNMNSDSRTSQKQALPTYTMEYLEI 713

>TBLA0C04460 Chr3 complement(1080461..1082557) [2097 bp, 698 aa]
           {ON} Anc_3.489 YGR128C
          Length = 698

 Score =  592 bits (1525), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/711 (46%), Positives = 465/711 (65%), Gaps = 60/711 (8%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSD-ISPNSNKITIGISESAISQYILNPT 59
           MPS+ QPFRL+VLP+I +LSNY +Q+DYL+V+ D  + ++NK+T+GIS S ISQYI+NPT
Sbjct: 1   MPSLSQPFRLAVLPKIASLSNYSLQTDYLQVAPDTFTYDTNKVTLGISGSGISQYIINPT 60

Query: 60  PKLLSNISIPSTNVVSACDVA-----------TLADDK---------------------- 86
           PKLL NI+IPSTN V+A +++           T+  DK                      
Sbjct: 61  PKLLFNIAIPSTNNVTASNISHYIEEVENANSTVTTDKSDLVDKDNMESTEEVSVAENTD 120

Query: 87  ------EIWCYCVKSGKSHFLNASVKPVDADTVLDTDGGDKTEDFKIKMDSKVVGIKIIP 140
                 E+W Y + + KS+ LN SVK    D    T  G+      IK+DSKVV IKI  
Sbjct: 121 VTKRSVELWAYGLVANKSNTLNISVKTTGLDE-FSTTPGEIIRKKTIKVDSKVVNIKIFK 179

Query: 141 DYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYFSENGQNFMFVLSGFENNK-- 198
           ++K IVVVL++GL++ +DF L   SSLDI+Y +V+ V +F+E+ QNF+ +LS  +  K  
Sbjct: 180 EFKTIVVVLKNGLVKLFDFDLNLKSSLDIAYNDVQFVQHFTESKQNFLLILSNIDEEKSS 239

Query: 199 VCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQSGKLYQLEGSTIKTYALPQC 258
           VCFKL++L          + ELS +IL++F+L +SKL YQ GKLY+L GS +  Y+LPQC
Sbjct: 240 VCFKLYQLRLDSDSNQ--VSELSFSILQDFDLSKSKLSYQFGKLYRLTGSELFVYSLPQC 297

Query: 259 HLVQTTHLPMILDPNSQKVS-LAPVSTNRILLTVNNQVYLLDLVHSSVLSERTLTHAKTF 317
            L+Q   L  I  PN+  VS + PV+ NR++L +NN VYL+D +H S+L+ER  TH KTF
Sbjct: 298 QLLQNISLAEIF-PNTIDVSSIKPVANNRLVLAINNVVYLIDTLHRSILAEREFTHVKTF 356

Query: 318 QLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALEVINVDVGTGTLKDSLGKSF 377
           QLL+SA      ++  S    RT+AIGV+TK+G    SALE+IN++VG+GTLKDSLGK  
Sbjct: 357 QLLQSA------TIGDSNITQRTIAIGVSTKSGPTSASALELINIEVGSGTLKDSLGKGV 410

Query: 378 -QSINDSKTHNLQPLF--SDDESDAGDNA-DSDEVVAFAYEDIFKELSKNNKSISKFDST 433
            + +++    +L+PLF  +D++S  G    D   V +F +  I  +L K++ +IS FD T
Sbjct: 411 SKKLSEGSHSDLKPLFDENDEKSLIGTPVHDISNVKSFNFNKILADL-KSSDTISDFDKT 469

Query: 434 FAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQEYPRAXXXXXXXXXXXXDCTRG 493
           F + L I+E HYT+ +RFI DQ+F++  + LI   FD E+P+A              T G
Sbjct: 470 FFESLEIKENHYTENDRFISDQDFIANTIDLIFKKFDTEFPKAFTFLLTHPLFPIKLTVG 529

Query: 494 LLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTTDMIKDEV 553
           LL++ ++HPRLFKQAIVTCPNLPL +LL +LF++ NGEL LDISLR+LQD++ + +K E+
Sbjct: 530 LLDKLKDHPRLFKQAIVTCPNLPLSELLFQLFTVKNGELTLDISLRVLQDYSRNDVKQEI 589

Query: 554 KKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQLLSLVIDAIGLFALDGALLQRLSDYI 613
           KKL+ VD+ NF+ F+I+P  EE+  N  T +LFQLLSLV+D+IGLFAL G LL+RLS+YI
Sbjct: 590 KKLDNVDIENFIEFIITPTTEEIQTN--TPQLFQLLSLVLDSIGLFALKGPLLERLSNYI 647

Query: 614 DEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYTVEYLEL 664
           +EQV +AER++ LW+LLDT    R    +   S    ++TL  Y+V+YL++
Sbjct: 648 NEQVTIAERSSELWHLLDTSTTPRPFKNAYLKSVIGNKETLSVYSVDYLDI 698

>KLTH0F14762g Chr6 complement(1209571..1211523) [1953 bp, 650 aa]
           {ON} similar to uniprot|P53276 Saccharomyces cerevisiae
           YGR128C UTP8 Nucleolar protein required for export of
           tRNAs from the nucleus also copurifies with the small
           subunit (SSU) processome containing the U3 snoRNA that
           is involved in processing of pre-18S rRNA
          Length = 650

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/671 (46%), Positives = 450/671 (67%), Gaps = 28/671 (4%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60
           MPSI QPFRL+ LP+I +L+NY  Q +YL+V+  ++P +N I +G+S SA+SQYI+NPTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGNYLQVADTLTPTTNNINVGVSGSAVSQYIINPTP 60

Query: 61  KLLSNISIPSTNVVSACDVATLA-----DDKEIWCYCVKSGKSHFLNASVKPVDADTVLD 115
           KL+ N  I STNVVSAC VA +      D +E+ CY ++S + + L A++KPV + T  D
Sbjct: 61  KLVYNQPISSTNVVSACAVAEITTTSEKDSQEVICYGIQSNRVYSLCATIKPVSS-TASD 119

Query: 116 TDGGDKTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVK 175
           +  G+     K+ +  ++V +K+ PD K+IV VL SGLIQ++DF+L+   SLD SY+NV 
Sbjct: 120 SSFGETYAAHKVSVSDQIVNLKVFPDTKSIVAVLRSGLIQFFDFELKLQHSLDSSYKNVS 179

Query: 176 VVNYF-SENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSK 234
            V +F SE+GQ + F+LS  + +KV FKLFE+   D    TP  ELS+ ILEN  L  S+
Sbjct: 180 YVQHFTSESGQRYTFLLSDIDGHKVSFKLFEIGQSDSA--TPATELSSVILENMCLKDSQ 237

Query: 235 LCYQSGKLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQ 294
           + YQ G++Y+L G+ +  Y LP     +T  LP  L P S  +S  P+STNR LLT +N+
Sbjct: 238 IFYQFGQVYRLHGNAVSIYNLPHFQHSRTIELPF-LAPES-IISFKPISTNRALLTSDNK 295

Query: 295 VYLLDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPT 354
           ++LLDL+H+++LS+R + H K FQLL +A +  +S+L       +T+A+GV+ K+G+NP+
Sbjct: 296 IFLLDLLHNAILSQREMGHVKIFQLLETAVIPGNSTLNN-----KTIALGVSIKHGSNPS 350

Query: 355 SALEVINVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSDEVVAFAYE 414
           S+L++IN+DVGTGTL+DS+GK F S  ++K+ +LQPL S          +  E   F Y+
Sbjct: 351 SSLDIINIDVGTGTLRDSMGKGFMS-RENKSQHLQPLIS--------TLNDTEAAEFNYD 401

Query: 415 DIFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQEYP 474
            I KELSK   +I  FDS F KRL I+  +YTD +RF+ D+EFL  V  LI  SF  EYP
Sbjct: 402 RILKELSKAADNIENFDSVFFKRLGIKNNYYTDSDRFVNDREFLEDVSTLIFKSFKSEYP 461

Query: 475 RAXXXXXXXXXXXXDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCL 534
           +A              T  LL++ ++HPRLFKQAIVTCPNL LD+L+ ELF++ N ELCL
Sbjct: 462 KALTYLLTNPLFPVSHTHNLLQKLKDHPRLFKQAIVTCPNLLLDELVQELFTVINDELCL 521

Query: 535 DISLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPK-DEELIQNKSTYELFQLLSLVI 593
           D+SLRILQDF  D IK+ +K+ +K+DV+NF+NF+IS   +E+ I+NK    LFQLLSLV+
Sbjct: 522 DLSLRILQDFNKDSIKEAIKQKSKIDVNNFINFVISENFEEDRIKNKP--RLFQLLSLVL 579

Query: 594 DAIGLFALDGALLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQT 653
           D++GLFAL+  +L++L+ YID+Q+ + + N  L+NL++ +N   G    L  +S + E  
Sbjct: 580 DSVGLFALENEMLEKLTKYIDQQLSVVKENVELYNLVEEKNFKNGFGQPLGDTSTSGEPV 639

Query: 654 LPKYTVEYLEL 664
           +  Y++E LEL
Sbjct: 640 ITAYSIEQLEL 650

>Smik_6.224 Chr6 complement(365799..367916) [2118 bp, 705 aa] {ON}
           YGR128C (REAL)
          Length = 705

 Score =  585 bits (1507), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/710 (46%), Positives = 467/710 (65%), Gaps = 51/710 (7%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVS-SDISPNSNKITIGISESAISQYILNPT 59
           MPS+ QPFRL+ LP+I +LSN+ +Q++Y++V+    + ++N IT+GIS S++SQYI+NPT
Sbjct: 1   MPSLSQPFRLAALPKIASLSNFSLQANYVQVADGTFNESTNNITLGISGSSVSQYIINPT 60

Query: 60  PKLLSNISIPSTNVVSACDVATLA---DDK---------------EIWCYCVKSGKSHFL 101
           PKL+ +  IPSTN+++AC+        +DK               EIW + +   K ++ 
Sbjct: 61  PKLIFDYPIPSTNIITACNAGEAQVNIEDKDNNEKVINSQTKRNIEIWSFGLMVNKGNYT 120

Query: 102 NASVKPVDADTVLDTDGG---DKTED------------FKIKMDSKVVGIKIIPDYKAIV 146
              +  V  +T+ +TD     +K E+            +KIK  +KV+ IKI      I+
Sbjct: 121 LNVITKVLENTINNTDENLVENKIENNVYTGSEGLLSQYKIKAKAKVMSIKIDTKNNLII 180

Query: 147 VVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYFSENGQNFMFVLSGFENNKVCFKLFEL 206
            +L++GLI++YDF+L+ L S DISY N+K   +F+ENG  F+FVL   +++KVC+KL EL
Sbjct: 181 AILQNGLIEFYDFKLKLLHSFDISYDNLKYAKWFTENGIEFIFVLCPLQDDKVCYKLLEL 240

Query: 207 LYHDGKRHTPIKELSTTILENFNLDQSKLCYQSGKLYQLEGSTIKTYALPQCHLVQTTHL 266
             ++ + ++PIKELS+TI+E F+ D SKLCYQ GKLY+L    I  Y+LP C L Q   L
Sbjct: 241 TDYENRENSPIKELSSTIIEGFSFDDSKLCYQFGKLYKLNKGKIYVYSLPHCQLQQVIEL 300

Query: 267 PMILDPNSQK--VSLAPVSTNRILLTVNNQVYLLDLVHSSVLSERTLTHAKTFQLLRSAP 324
           P+I + + +   +S  PVS NR+LLTVNN VYLLDL+H S L +R L+H KTFQLL +A 
Sbjct: 301 PLINNSDFEHDLISFQPVSVNRVLLTVNNIVYLLDLLHCSTLGQRELSHVKTFQLLNTAV 360

Query: 325 LNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALEVINVDVGTGTLKDSLGKSFQSINDSK 384
           +N   S      +++T+AIG++TKNG NPTS+LE+IN+DVGT TLKDSLGKSFQ+     
Sbjct: 361 INSEKS-----HSSKTIAIGISTKNGANPTSSLEIINIDVGTNTLKDSLGKSFQAEKKDS 415

Query: 385 THNLQPLFSDDESDAG----DNADSD-EVVAFAYEDIFKELSK-NNKSISKFDSTFAKRL 438
           +  L+PLF D+E        +N D D  +  F Y++I  +LS   +  I+ FD  F K L
Sbjct: 416 SVILKPLFDDEEVTENMVKRNNIDGDISIPTFQYDEIIVKLSALKSNDITSFDDIFFKDL 475

Query: 439 NIQEEHYTDRERFICDQEFLSKVVRLILDSFD-QEYPRAXXXXXXXXXXXXDCTRGLLER 497
            I+EEHYT+++RFI D  FL+KV+ LI + F+  +YP+             D TR LL  
Sbjct: 476 KIKEEHYTEKDRFISDLVFLNKVLDLIFEKFNGNDYPKTLTFLLTHPLFPLDRTRNLLSL 535

Query: 498 FRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTTDMIKDEVKKLN 557
            R+ PRLFKQAIVTCPNLPL++LL ELFSI N EL LDIS RILQDFT D IK E+K+L+
Sbjct: 536 LRDQPRLFKQAIVTCPNLPLNELLEELFSIRNKELLLDISFRILQDFTRDSIKQEMKRLS 595

Query: 558 KVDVHNFVNFLISPKDE---ELIQNKSTYELFQLLSLVIDAIGLFALDGALLQRLSDYID 614
           K+D+ NF+ F+ S +++   E   +  + +LFQLLSLV+D+IGLF+L+GALL+ L+ YID
Sbjct: 596 KLDIQNFIEFMTSTENDNSLEGFNHSQSTQLFQLLSLVLDSIGLFSLEGALLESLTSYID 655

Query: 615 EQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYTVEYLEL 664
           +QV +AERN  LWNL+D ++   G T     S+ +++Q LP YT+EYL++
Sbjct: 656 KQVKIAERNTELWNLIDIKSSQHGFTNLAFESASSQKQALPTYTMEYLDI 705

>Skud_7.439 Chr7 complement(727211..729352) [2142 bp, 713 aa] {ON}
           YGR128C (REAL)
          Length = 713

 Score =  568 bits (1463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/721 (46%), Positives = 465/721 (64%), Gaps = 65/721 (9%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVS-SDISPNSNKITIGISESAISQYILNPT 59
           MPS+ QPFRL+ LP+I +LSN+ +Q+DY++V+    + ++N IT+GIS S+ISQYI+NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 60  PKLLSNISIPSTNVVSACDVATLA-----------DDK---------------EIWCYCV 93
           PKL  +  IPSTNV++AC  A +            DD                EIW +  
Sbjct: 61  PKLTFDYPIPSTNVITACSAAEVQVNVEEDLKISNDDSNDEEKAANSQTKRNIEIWSFGS 120

Query: 94  KSGKSHF-LNASVKPVDADT----------VLDTDGGDKTEDF----KIKMDSKVVGIKI 138
              K ++ LN + K ++++            +D+      +DF    KIK  +KV+ IKI
Sbjct: 121 MVNKGNYTLNVTTKMLESNKNTSNEHLVEDSIDSRRHAGADDFLSQHKIKTKAKVMNIKI 180

Query: 139 IPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYFSENGQNFMFVLSGFENNK 198
                 I+ VL++GLI++YD +L+ L S DISY N+K   +F+ENG +F+FVL   E++K
Sbjct: 181 DAKNSLIIAVLQNGLIEFYDLKLKLLYSFDISYDNLKYAKWFTENGTDFVFVLCPLEDDK 240

Query: 199 VCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQSGKLYQLEGSTIKTYALPQC 258
           VC+K+ EL   + K ++PIKELS+TI+E F+ + SKLCYQ GKLY+L    I  Y+LP C
Sbjct: 241 VCYKMLELSDFESKDNSPIKELSSTIIEGFSFESSKLCYQFGKLYKLNQGKIYVYSLPHC 300

Query: 259 HLVQTTHLPMILDPNSQK--VSLAPVSTNRILLTVNNQVYLLDLVHSSVLSERTLTHAKT 316
            L Q   LP+I   NS+   +S  PVS NRILLTVNN +YLLDL+H S+L+ R LTH KT
Sbjct: 301 QLQQIIELPLINKSNSEDDLISFQPVSVNRILLTVNNIIYLLDLLHCSILNHRELTHVKT 360

Query: 317 FQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALEVINVDVGTGTLKDSLGKS 376
           FQLL+SA ++   S       ++T+AIG++TKNG NPTS+LE+IN+DVGT TLKDSLGKS
Sbjct: 361 FQLLKSALIDSEKS-----HNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKS 415

Query: 377 FQSINDSKTHNLQPLFSDDESDAGDNA----DSD---EVVAFAYEDIFKELS--KNNKSI 427
           FQ   +  +  L+PLF  D+ D  +N     D D    V  F Y+++ ++LS  KNN  I
Sbjct: 416 FQVGKNDASVILKPLF--DDEDVTNNMVKRNDIDGNINVPIFHYDEVIEKLSVLKNN-DI 472

Query: 428 SKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSF-DQEYPRAXXXXXXXXXX 486
           + FD  F   L ++EEHYT+++RFI D  FL+KV+ LI   F   +YP+A          
Sbjct: 473 ASFDEIFFNDLKVKEEHYTEKDRFISDPGFLNKVLDLIFLKFGGNDYPKALTFLLTHPLF 532

Query: 487 XXDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTT 546
             + T GLL   R+ PRLFKQAIVTCPNLPL++LL ELFSI N EL LDIS R+LQDFT 
Sbjct: 533 PLNRTHGLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRVLQDFTR 592

Query: 547 DMIKDEVKKLNKVDVHNFVNFLISPKDE---ELIQNKSTYELFQLLSLVIDAIGLFALDG 603
           D IK E+KKL+K+D+ NF+  + + +++   E   +  + +LFQLLSLV+D+IGLF+L+G
Sbjct: 593 DSIKQEMKKLSKLDIQNFIECITNTEEDGPLEGFNHNHSSQLFQLLSLVLDSIGLFSLEG 652

Query: 604 ALLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYTVEYLE 663
           ALL+ L+ YID+QV +AERN  LWNL+D +    G     +GS+ +++Q LP Y +EYL+
Sbjct: 653 ALLENLTLYIDKQVKIAERNTELWNLIDIKGSQHGFATLSSGSTTSQKQALPAYAMEYLD 712

Query: 664 L 664
           +
Sbjct: 713 I 713

>YGR128C Chr7 complement(747950..750091) [2142 bp, 713 aa] {ON}
           UTP8Nucleolar protein required for export of tRNAs from
           the nucleus; also copurifies with the small subunit
           (SSU) processome containing the U3 snoRNA that is
           involved in processing of pre-18S rRNA
          Length = 713

 Score =  562 bits (1449), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/720 (45%), Positives = 449/720 (62%), Gaps = 63/720 (8%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVS-SDISPNSNKITIGISESAISQYILNPT 59
           MPS+ QPFRL+ LP+I +LSN+ +Q+DY++V+    + ++N IT+GIS S+ISQYI+NPT
Sbjct: 1   MPSLSQPFRLATLPKIASLSNFSLQADYVQVADGTFNESTNNITLGISGSSISQYIINPT 60

Query: 60  PKLLSNISIPSTNVVSACD-----------VATLADDK---------------EIWCYCV 93
           PKL  +  IPSTN+++AC+           +    DD+               EIW + +
Sbjct: 61  PKLTFDYPIPSTNIITACNAEKGQANIDGNIEASTDDEANNEKTINTQKKRNVEIWAFGL 120

Query: 94  KSGKSHF-LNASVKPVDADTVLDTD-------------GGDK-TEDFKIKMDSKVVGIKI 138
              K ++ LN   K ++  T    D             G D+    +KIK  +KV+ IKI
Sbjct: 121 MVNKGNYTLNVITKALEDTTDTSNDHLSESDIDNKAYTGSDEFLSQYKIKAKAKVMSIKI 180

Query: 139 IPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYFSENGQNFMFVLSGFENNK 198
                 ++ +L++GLI+ +DF+L  L S DISY N+K   +F+ENG  ++FVL   +++K
Sbjct: 181 DTKNSLVIAILQNGLIEIFDFKLTLLHSFDISYDNLKYAKWFTENGTEYVFVLCPLQDDK 240

Query: 199 VCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQSGKLYQLEGSTIKTYALPQC 258
           VC+KL EL        +PIKELS+TI+E F+ + SKLCYQ GKLY+L    I  Y+LP C
Sbjct: 241 VCYKLLELTDCGSGESSPIKELSSTIIEGFSFENSKLCYQFGKLYKLNQGKIYIYSLPHC 300

Query: 259 HLVQTTHLPMI--LDPNSQKVSLAPVSTNRILLTVNNQVYLLDLVHSSVLSERTLTHAKT 316
            L Q    PM+  L P    +S  PVS NR+LLTVNN +YLLDL+H S LS+R LTH KT
Sbjct: 301 QLQQVIEFPMVDKLSPGDDLISFQPVSVNRVLLTVNNVIYLLDLLHCSTLSQRELTHVKT 360

Query: 317 FQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALEVINVDVGTGTLKDSLGKS 376
           FQLL+SA +N   S       ++T+AIG++TKNG NPTS+LE+IN+DVGT TLKDSLGKS
Sbjct: 361 FQLLKSAVINSEKS-----HNSKTIAIGISTKNGPNPTSSLEIINIDVGTNTLKDSLGKS 415

Query: 377 FQSINDSKTHNLQPLFSDDESDAGD--------NADSDEVVAFAYEDIFKELSKNNKSIS 428
           FQ  N+  +  L+PLF  D+ D  D        + DS   V    E I K  +  +  I+
Sbjct: 416 FQVGNNDSSVILKPLF--DDKDINDKRVKCNDVSGDSSVPVLHCNEVIEKLSALQDNDIT 473

Query: 429 KFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFD-QEYPRAXXXXXXXXXXX 487
            FD  F K L I+EEHYT+++R+I D  FL+KV+ LI   F   +YP+            
Sbjct: 474 SFDDIFFKELKIKEEHYTEKDRYISDPGFLNKVLDLIFGKFSGNDYPKTLTFLLTHPLFP 533

Query: 488 XDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTTD 547
              TR LL   R+ PRLFKQAIVTCPNLPL++LL ELFSI N EL LDIS RILQDFT D
Sbjct: 534 LSRTRNLLSLLRDQPRLFKQAIVTCPNLPLNELLEELFSIRNRELLLDISFRILQDFTRD 593

Query: 548 MIKDEVKKLNKVDVHNFVNFLISPKDE---ELIQNKSTYELFQLLSLVIDAIGLFALDGA 604
            IK E+KKL+K+DV NF+ F+ S  ++   E      + +LFQLLSLV+D+IGLF+L+GA
Sbjct: 594 SIKQEMKKLSKLDVQNFIEFITSGGEDSSPECFNPSQSTQLFQLLSLVLDSIGLFSLEGA 653

Query: 605 LLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYTVEYLEL 664
           LL+ L+ YID+QV +AERN  LWNL+DT+    G   S   +  ++++ LP YT+EYL++
Sbjct: 654 LLENLTLYIDKQVEIAERNTELWNLIDTKGFQHGFASSTFDNGTSQKRALPTYTMEYLDI 713

>AFR307C Chr6 complement(997169..999121) [1953 bp, 650 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR128C
           (UTP8)
          Length = 650

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/671 (45%), Positives = 439/671 (65%), Gaps = 30/671 (4%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60
           M  I QPFRL+ LP+I +L+NY  Q+ YL+V+  + P SN +T+G+S S+ISQY++NPTP
Sbjct: 1   MAYIAQPFRLANLPKISSLNNYAQQTSYLQVADVLEPTSNTVTVGVSGSSISQYVINPTP 60

Query: 61  KLLSNISIPSTNVVSACDVATLADDKEIWCYCVKS-GKSHFLNASVKPVDADTVLDTDGG 119
           KL+ NI IPSTNVV+ CDV  ++D  E+W Y + + GK H L+A ++   A       G 
Sbjct: 61  KLVYNIPIPSTNVVTGCDVLAMSDGAELWSYALTANGKVHTLHAVLR--KAGAAPQETGL 118

Query: 120 DKTED--FKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVV 177
           D +ED  FK  +  +VV ++I+   K I+VVL+ GLIQ YD+QLQ L SLDISY NV +V
Sbjct: 119 DASEDEHFKQTLKGRVVRVRILSACKRIMVVLDCGLIQTYDYQLQLLHSLDISYTNVGLV 178

Query: 178 NYFSEN-GQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLC 236
            YF+++ G+++MFVL   +N K C+KLF+L  +    + PI EL++ ILE+F L +SK+ 
Sbjct: 179 EYFTDSAGKDYMFVLCDIQNKKTCYKLFQL--NHSAENLPITELNSVILEDFALAESKMV 236

Query: 237 YQSGKLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQVY 296
           YQ GKLY+L  S +  Y+LP   L     LP +      +VSL  +STNR+LLT  N+++
Sbjct: 237 YQFGKLYRLVDSKMYVYSLPHFQLSHCVPLPFV--RKDDQVSLQAISTNRLLLTCCNKIF 294

Query: 297 LLDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSA 356
           LLDL+H+++L ER L++ K FQLLR+A   +  +  G   + RT AIGV+TK G+NP+SA
Sbjct: 295 LLDLLHNAILYERELSNIKFFQLLRAAV--IPGTTPGE--SNRTFAIGVSTKQGSNPSSA 350

Query: 357 LEVINVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSDEVVAFAYEDI 416
           L+V+ + VGTGTLKDSLGK F S    +T  L+PLF  D+ D   N D        +  I
Sbjct: 351 LDVVTIAVGTGTLKDSLGKGFLSGEHRRTEALKPLFGTDD-DESPNID--------FAAI 401

Query: 417 FKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQEYPRA 476
             EL+ +  +   FDS F KRL  ++E+YT+ +RFI + EFL+ ++  I  +F  E+P+A
Sbjct: 402 LAELT-SRTTPKAFDSIFYKRLGPKKEYYTEHDRFINNSEFLAGILDHIFATFADEFPKA 460

Query: 477 XXXXXXXXXXXXDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDI 536
                         T+GLL + + HPRLFKQA+VTCPNLPLD+LL ELF++ N EL LD+
Sbjct: 461 LIYLLTHPLFPSSHTKGLLPKLKAHPRLFKQAVVTCPNLPLDELLHELFTVLNDELSLDL 520

Query: 537 SLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQLLSLVIDAI 596
           SLR+LQ+FT + IK  +++L++VD+HNF+NF+I    +   + K+  +LFQLLSLVIDA+
Sbjct: 521 SLRVLQEFTKEDIKQGIRELSRVDLHNFLNFVIKDSTDVEERQKAKPQLFQLLSLVIDAV 580

Query: 597 GLFALDGALLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSRAKEQ---- 652
           GL AL+G +L RLS +ID QV +A++   L  LL+  +  +G    L   +R  E     
Sbjct: 581 GLLALEGDILHRLSAFIDSQVAVADQLVELLYLLENSSTKKGK--HLNSVTRLDESPVAA 638

Query: 653 TLPKYTVEYLE 663
           T+P Y+VEYL+
Sbjct: 639 TIPLYSVEYLD 649

>NDAI0G00960 Chr7 (199784..201886) [2103 bp, 700 aa] {ON} Anc_3.489
           YGR128C
          Length = 700

 Score =  524 bits (1349), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 321/718 (44%), Positives = 462/718 (64%), Gaps = 72/718 (10%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVS-SDISPNSNKITIGISESAISQYILNPT 59
           MPS+ QPFRL+VLP+I +LSNY +Q DY++V+ S  +P +NK+ IG+S SAISQYI+NPT
Sbjct: 1   MPSLSQPFRLTVLPKIASLSNYSLQGDYIQVTKSTFNPTTNKVVIGVSGSAISQYIINPT 60

Query: 60  PKLLSNISIPSTNVVSACDV---ATLADDKEIWCYCVKSGKSHFLN--------ASVKPV 108
           PKL+ N  IPSTN+V+ACDV        + E+WC+ + + K++ L         +S    
Sbjct: 61  PKLIFNYPIPSTNIVTACDVLENDNDNTNNEVWCFGLVANKTYTLTLITKDKQKSSATME 120

Query: 109 DADTVLDTDGGDKTEDFKIKMDSKVVGIKIIPDYK---AIVVVLESGLIQYYDFQLQKLS 165
           D + V+D       ++F +K+DSK+V IKII       +I++VLE+GLIQ+++  L+ L+
Sbjct: 121 DDEDVVDVIDTTIKDEFNVKLDSKIVDIKIIKKKADDISIMIVLENGLIQFFNSSLKLLN 180

Query: 166 SLDISYQNVKVVNYFSENGQNFMFVLSGF-ENNKVCFKLFELLYHDGKRHTPIKELSTTI 224
           ++ I+Y+NVK V +F E+ ++FMF +    +NNKVC KLF++       +    EL++ I
Sbjct: 181 TVKINYKNVKFVEHFKEDNKDFMFTICDLGDNNKVCIKLFQI------NNDSAIELNSII 234

Query: 225 LENFNLDQSKLCYQSGKLYQLEGSTIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVST 284
           +ENFN   +K CYQ GK Y+L  + +  Y+LPQ  L  TT +PMI   + Q VS+ P+ST
Sbjct: 235 MENFNGQNAKFCYQFGKFYKLTNNNLMVYSLPQFQLEHTTTIPMI-KTDDQIVSMKPIST 293

Query: 285 NRILLTVNNQVYLLDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIG 344
           NRILLT+NN++YLLDL+H+S+LSER LTH K+ QLLRSA +      KG E   +T+ IG
Sbjct: 294 NRILLTINNKIYLLDLIHNSILSERELTHLKSLQLLRSAVIG-----KG-ENNNKTITIG 347

Query: 345 VTTKNGNNPTSALEVINVDVGTGTLKDSLGKSFQSIN-----DSKTHNLQPLFSDDESDA 399
           V+TK G NPTS+LE+INVDVG+ TLKDSLGK FQ++N        T  L+PLF  D +  
Sbjct: 348 VSTKFGVNPTSSLEIINVDVGSNTLKDSLGKCFQNLNLQNQIQISTQALKPLF--DPNTD 405

Query: 400 GDNADS--DEVVA---FAYEDIFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICD 454
           GD  D    ++V    F Y++I  +LS+N   I KFD  F +  NI++EHYT+ +RFI +
Sbjct: 406 GDKDDDLFKKLVTKEQFNYDEILTKLSENTNDIGKFDEIFFQSFNIKKEHYTENDRFIYN 465

Query: 455 QEFLSKVVRLILDSFD--------QEYPRAXXXXXXXXXXXXDCTRGLLERFRNHPRLFK 506
            EF  K++ LI + F          EYP+             + T+ LL RF NHPRLFK
Sbjct: 466 HEFFLKLIDLIFEKFGSTATTAQTNEYPKTLTFLLTHPLFPMERTQSLLSRFANHPRLFK 525

Query: 507 QAIVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTTDMIKDEVKKLNKVDVHNFVN 566
           QAIVTCPNLPL +LL+EL +I N EL LDISLRILQD++ D IK E++ L ++++ NF++
Sbjct: 526 QAIVTCPNLPLPELLNELLTIKNNELSLDISLRILQDYSKDSIKQELRNLPRLEIENFID 585

Query: 567 FLISPKDEELIQNKSTYELFQLLSLVIDAIGLFALDGALLQRLSDYIDEQVYLAERNARL 626
           F++   ++E+  ++++ +LFQLL+LV+D+IGLFAL   +L+ LS YID QV + E+N  L
Sbjct: 586 FIL---NDEIKDDQNSPQLFQLLALVLDSIGLFALSDNILENLSAYIDRQVSIVEKNTEL 642

Query: 627 WNLLD------TRNKNRGATGSLAGSSR--------------AKEQTLPKYTVEYLEL 664
           W L+D      + NK   +  S + S+                +++ LP Y+V+YLEL
Sbjct: 643 WYLIDSNNNIFSHNKKDNSFSSASASTNSKSNNISSNNKKSFTQKEALPMYSVDYLEL 700

>KLLA0E04665g Chr5 (414183..416126) [1944 bp, 647 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128C UTP8
           Nucleolar protein required for export of tRNAs from the
           nucleus also copurifies with the small subunit (SSU)
           processome containing the U3 snoRNA that is involved in
           processing of pre-18S rRNA
          Length = 647

 Score =  518 bits (1334), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 284/669 (42%), Positives = 433/669 (64%), Gaps = 29/669 (4%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60
           M SI QPFRLS LP+I +L+NY  Q+DYL+V  ++SP++NK+ IGIS S+ISQY++NPTP
Sbjct: 1   MASISQPFRLSALPKIPSLNNYANQTDYLQVVDNLSPSANKVNIGISGSSISQYLINPTP 60

Query: 61  KLLSNISIPSTNVVSACDVATLADDKEIWCYCVKSGKSHFLNASVKPVDADTVLDTDGGD 120
           KL+ N+ IPSTN+V+ACDV   A + E+WCY +++ K   L+ + KP+  D V  +   +
Sbjct: 61  KLVFNLPIPSTNIVTACDVVEDAANTEVWCYGLEARKVSHLHLATKPMIQDAV-SSSNAE 119

Query: 121 KTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYF 180
            T  FK K+ S+VV IKI    + ++V+L +GLIQ +D++L+  +++DISY +++ V +F
Sbjct: 120 ITSQFKYKLKSEVVSIKIYSKAEKVLVILRNGLIQTFDYELKLSNTIDISYDDIRFVQFF 179

Query: 181 SE-NGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQS 239
            +  G +F FVL    + K+C+KLF++            EL++ ILEN+ L+ +KLC++ 
Sbjct: 180 QDGQGNDFFFVLCQLSDEKICYKLFQV----RSESVSCIELNSIILENYTLENAKLCFEF 235

Query: 240 GKLYQLEGST-IKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQVYLL 298
           GKLY L+ S  +  Y LP   L  +  LP I       VS+ PVS+NR+LLT +N +YL+
Sbjct: 236 GKLYVLKNSNELSIYQLPHLQLQTSIQLPFI--SKDAVVSIKPVSSNRVLLTADNTIYLV 293

Query: 299 DLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALE 358
           DL+++++L ++ L + K  QLL +A +      + SE   +T+A+ VTTKNG NPTS L+
Sbjct: 294 DLLYNAILFQKDLQNIKAIQLLSTAVVQ-----ENSEDNRKTIALDVTTKNGANPTSYLD 348

Query: 359 VINVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSDEVVAFAYEDIFK 418
           VIN+DVGTGTLKD++GK F      +   LQ LF +   D     D  E+ +  YE I K
Sbjct: 349 VINIDVGTGTLKDAMGKGFMV---KQKQKLQKLFEESNED-----DDVELPSPDYERIIK 400

Query: 419 ELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQEYPRAXX 478
           +L    K I  FDS F K L++ +E+YTD +RF+ D + L++++  +  +F  EYP+A  
Sbjct: 401 QLHIC-KKIENFDSIFFKMLSLDKEYYTDNDRFLNDSDLLTQIIDCLFLNFKDEYPKALT 459

Query: 479 XXXXXXXXXXDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSINNGELCLDISL 538
                        +GLL + +N+PRLFKQAIVTCPN+PLDDLL+ELF+I N ELC DI+L
Sbjct: 460 YLLTHPLFPPVHAKGLLTKLKNNPRLFKQAIVTCPNVPLDDLLTELFNITNAELCFDITL 519

Query: 539 RILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPK--DEELIQNKSTYELFQLLSLVIDAI 596
           R+LQD+  + IK  ++K+ K+D+ NF++ +++    D +L  NK   ++FQL+SL+ID+I
Sbjct: 520 RVLQDYKKESIKAGIRKIEKMDITNFLDMILNSNKADSDLKLNKP--QIFQLMSLIIDSI 577

Query: 597 GLFALDGALLQRLSDYIDEQVYLAERNARLWNLLD--TRNKNRGATGSLAGSSRAKEQTL 654
           GLFALD   L++LS ++D QV +  +N  L +L +  T++ +     S + ++ +  Q +
Sbjct: 578 GLFALDDEYLEKLSSFVDAQVSVVSQNIELLHLAEHYTKHSSVVNNKSNSSTNSSSTQPI 637

Query: 655 PKYTVEYLE 663
             YTV+YLE
Sbjct: 638 SAYTVDYLE 646

>CAGL0I10560g Chr9 (1043862..1045898) [2037 bp, 678 aa] {ON} similar
           to uniprot|P53276 Saccharomyces cerevisiae YGR128c
          Length = 678

 Score =  509 bits (1310), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 283/702 (40%), Positives = 441/702 (62%), Gaps = 62/702 (8%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60
           MPS+ QPFRL+VLP+I +L N+  +  Y++V+   +P+SN + +GIS S+IS+Y++ PTP
Sbjct: 1   MPSLSQPFRLAVLPKIASLHNFSQKKTYIKVADSFTPDSNSVLLGISGSSISKYVITPTP 60

Query: 61  KLLSNISIPSTNVVSACDVATLADDK------------------------------EIWC 90
           +L+ N+ IPST++VSAC++ T ++                                EIWC
Sbjct: 61  RLIFNVPIPSTHLVSACNMGTYSETSTVSSDPQATADETTDTAPTSTNTVEETKHYEIWC 120

Query: 91  YCVKSG-KSHFLNASVKPVDADTVLDTDGGDKTEDFKIKMDSKVVGIKIIPDYKAIVVVL 149
           Y + +  K+H LN  ++ VD +   +T   +    F  K   +++ I++   +K IV++ 
Sbjct: 121 YALSANNKTHTLNCLIREVDNN---NTSITENNPQFNAKFKEQIINIEVDTKHKVIVILF 177

Query: 150 ESGLIQYYDFQLQKLSSLDISYQNVKVVNYFSENGQNFMFVLSGFENNKVCFKLFELLYH 209
           E+GL+Q+YD QL+ L+S++  Y+++K+V  F ENG  +M ++S  ++ KV  +L+E+   
Sbjct: 178 ETGLVQFYDLQLKLLNSINTPYRDIKIVKTFEENGLEYMLLISDLKDQKVALQLYEVSTE 237

Query: 210 DGKRHTPIKELSTTILENFNLDQSKLCYQSGKLYQLEGSTIKTYALPQCHLVQTTHLPMI 269
           + K    +KEL+++I+ENFNL  S LCYQ G++Y+L    I+ Y++P   L     +P +
Sbjct: 238 EKK----VKELTSSIIENFNLQDSLLCYQFGRIYRLFKDEIEVYSIPSLQLNSKVKIPFL 293

Query: 270 --LDPNSQKVSLAPVSTNRILLTVNNQVYLLDLVHSSVLSERTLTHAKTFQLLRSAPLNV 327
             ++  +  +SL P++TNR+LLTV N++YLLDL+H S+LSER ++H KTFQ+L++A    
Sbjct: 294 SEIEDKNCLISLKPIATNRVLLTVKNKIYLLDLLHKSILSEREVSHMKTFQILKTA---- 349

Query: 328 SSSLKGSEFATRTLAIGVTTKNGNNPTSALEVINVDVGTGTLKDSLGKSFQSINDSKTHN 387
             +  GSE +  TLA+G++TKNG NPTSALE+IN+DVG+ +LKDSLGKSF   N+     
Sbjct: 350 -MNRDGSE-SKLTLALGISTKNGQNPTSALEIINIDVGSNSLKDSLGKSFLRRNNQIQGQ 407

Query: 388 LQPLFSDDESDAGDNADSDEVVAFAYEDIFKELSKNNKSISKFDSTFAKRLNIQEEHYTD 447
           L+ LF + +          E+ +  + +I  +L KN  S  KFD TF   LNI+EE +T+
Sbjct: 408 LKNLFPEPKY---------ELPSINFPEILGKL-KNANSAEKFDETFFNLLNIKEEMFTE 457

Query: 448 RERFICDQEFLSKVVRLILDSFD--QEYPRAXXXXXXXXXXXXDCTRGLLERFRNHPRLF 505
             RF+ DQ FL+ V+ LI    D  +  PR+            +   GLL + +++ RLF
Sbjct: 458 NSRFLNDQRFLASVLDLIFTKIDYNKSCPRSLMFLLTHPLFPKEKAIGLLTKVKSNSRLF 517

Query: 506 KQAIVTCPNLPLDDLLSELFSINNGELCLDISLRILQDFTTDMIKDEVKKLNKVDVHNFV 565
           KQAIVTCPNLPL +LL ELF+I N EL +DIS+RILQD+T D IK+E+KKL++V V NF+
Sbjct: 518 KQAIVTCPNLPLQELLQELFTIKNSELVVDISMRILQDYTKDAIKEEIKKLDQVSVENFM 577

Query: 566 NFLISPKDEELIQNKSTY---ELFQLLSLVIDAIGLFALDGALLQRLSDYIDEQVYLAER 622
           NF+I   + E   +  T    ++F+LLSL++D+IGLF L+ ++L +LS  I+++V +AER
Sbjct: 578 NFIIKMNNREAAVSDFTMFTPQIFKLLSLILDSIGLFGLEESILIQLSSIIEKEVKIAER 637

Query: 623 NARLWNLLDTRNKNRGATGSLAGSSRAKEQTLPKYTVEYLEL 664
           N  LWN++D +  +   + S A S  A+    P Y VEY+++
Sbjct: 638 NVELWNIMDAKMLSVKKSSSTAASKLAENSQTP-YIVEYIDI 678

>Kwal_55.21222 s55 complement(736354..737475) [1122 bp, 373 aa] {ON}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 131] PARTIAL
          Length = 373

 Score =  343 bits (881), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 191/389 (49%), Positives = 261/389 (67%), Gaps = 17/389 (4%)

Query: 277 VSLAPVSTNRILLTVNNQVYLLDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEF 336
           +S  P+S NR LLT +N+VYLLDL+H+++LS+R  TH KTFQLL +A +  +SS   S  
Sbjct: 1   MSFGPISINRALLTCDNKVYLLDLLHNAILSQREFTHVKTFQLLGTAVIPGNSSSNNS-- 58

Query: 337 ATRTLAIGVTTKNGNNPTSALEVINVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDE 396
              T+AIGV TK GN  TS+L+V+N+DVGTGTLKDS+GK F S   SKT    P     +
Sbjct: 59  ---TIAIGVATKPGNTSTSSLDVVNIDVGTGTLKDSMGKGFLS---SKTKVQCP-----Q 107

Query: 397 SDAGDNADSDEVVAFAYEDIFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQE 456
           S  G   D+ EV    Y  I K+L+K   +  KFDS F K+LNI+ ++YTD +RF+ DQE
Sbjct: 108 SLLGTPNDT-EVQEHNYTQILKDLAKTKSNSDKFDSVFFKKLNIKNDYYTDSDRFLNDQE 166

Query: 457 FLSKVVRLILDSFDQEYPRAXXXXXXXXXXXXDCTRGLLERFRNHPRLFKQAIVTCPNLP 516
           FL   ++LI ++F  EYP+A             CT  LL++ ++HPRLFKQAIVTCPNLP
Sbjct: 167 FLGNSLKLIFENFQSEYPKALTYLLTHPLFPITCTHDLLQKLKDHPRLFKQAIVTCPNLP 226

Query: 517 LDDLLSELFSINNGELCLDISLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPK-DEE 575
           L DLL ELF++ N ELCLD+SLRILQDF+ D IK+ +K+ +KVDV+ F+NF+++   DE+
Sbjct: 227 LSDLLQELFTVINDELCLDLSLRILQDFSKDSIKNAIKQRSKVDVNCFINFVMNENVDED 286

Query: 576 LIQNKSTYELFQLLSLVIDAIGLFALDGALLQRLSDYIDEQVYLAERNARLWNLLDTRNK 635
            ++NK    LFQLL+LV+D++GLFAL+   L +LS+YID Q+ + ++N +L+NL+D RN 
Sbjct: 287 RVKNKP--RLFQLLNLVLDSVGLFALEDEALDKLSNYIDRQLSVVKQNVQLYNLVDERNF 344

Query: 636 NRGATGSLAGSSRAKEQTLPKYTVEYLEL 664
                   A S    E  +  Y+VE LEL
Sbjct: 345 KNILGQHHADSLSVGEGAITAYSVEQLEL 373

>KAFR0C01940 Chr3 complement(387789..389618) [1830 bp, 609 aa] {ON}
           Anc_3.489 YGR128C
          Length = 609

 Score =  313 bits (803), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 227/684 (33%), Positives = 368/684 (53%), Gaps = 95/684 (13%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60
           MPSI QPF ++ +P+  + S   V S  L      + NSN + + IS+ A+S++++NPTP
Sbjct: 1   MPSISQPFAITTVPKQSSTSPIIVSSHSL------TANSNSLDVAISKYAVSKFVINPTP 54

Query: 61  KLLSNISIPSTNVVSACDVATLADDKEIWCYCVKSGKSHFLNASVKPVDADTVLDTDGGD 120
           KL+++I IPS  VV+A      A                        V+    L  +G  
Sbjct: 55  KLINSIPIPSNEVVTAFHDTVFA---------------------TATVNQKYTLHLNGK- 92

Query: 121 KTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNYF 180
                K+ + SK+  +K+  D    + +LE+G I+ YD  L K S+    ++++  V + 
Sbjct: 93  -----KVPIQSKI--MKLFSDESQTITILENGTIEKYDSNLIK-STYKTPHKDLVNVEFI 144

Query: 181 SENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQSG 240
                 +  ++S    N +         +D      ++ ++       ++  S      G
Sbjct: 145 E---SKYALLIS---QNSISL-------YDINTMIELRNVANVQ----DIVDSDFKSLDG 187

Query: 241 KLYQLEG--STIKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQVYLL 298
           KLYQ     S    + +    +V    +P I D     VS   V  N +++ VN+ +Y L
Sbjct: 188 KLYQFNQKLSKFDIWEISSMTIVNIITIPFINDVEKDVVSFTVVDDNCVVMAVNSTIYAL 247

Query: 299 DLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSALE 358
           +L  SSV+S   L + K F+L+ +               +    +G++    NN     E
Sbjct: 248 NLHLSSVISMSELLNLKWFKLIDNL--------------SNQFVLGLS---FNNENYKFE 290

Query: 359 VINVDVGTG-TLKDSLGKSFQSI-----NDSKTHNLQPLFSDDESDAGDNADSDEVV--A 410
           +IN+D+ +   LKDSLGK F++      ++ +T  L+ LFS DE+D   + DSD  V   
Sbjct: 291 LINLDLNSNFGLKDSLGKGFRNFLVDKQSEKETLVLKSLFSADEADEDLHNDSDSDVEHT 350

Query: 411 FAYEDIFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDS-- 468
           F Y+ I  +L+K  K+ SKFD  F ++ NI++EHYT+ +RF+ +Q+FL+KV+ LIL +  
Sbjct: 351 FNYDKIIVDLNKAVKNPSKFDKIFFEKFNIKKEHYTEADRFLVNQDFLAKVIELILQNYK 410

Query: 469 FDQE---YPRAXXXXXXXXXXXXDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELF 525
           FD +   YP+               T+ LL +FR  PRL+KQAIVTCPNLPL +LL++LF
Sbjct: 411 FDTDGNNYPKTLTYLLTHPLFPVSLTKNLLPKFRESPRLYKQAIVTCPNLPLGELLADLF 470

Query: 526 SINNGELCLDISLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYEL 585
           +I N EL LDISLR+LQD+T D IK+++K L KVD+ NF+ F+   +D+++     + +L
Sbjct: 471 TIENNELSLDISLRVLQDYTKDSIKEQIKLLPKVDIRNFIEFVTQDEDQQV-----SSQL 525

Query: 586 FQLLSLVIDAIGLFALDGALLQRLSDYIDEQVYLAERNARLWNLLD----TRNKNRGATG 641
           FQLLSL+ID+IGLFALD  +L R+S++I+E+  +A++N+ L +LLD     ++  R ++ 
Sbjct: 526 FQLLSLIIDSIGLFALDMDILGRISNFINEKTLVAKQNSELLHLLDYNPSKQSSARQSSK 585

Query: 642 SLAGSSRA-KEQTLPKYTVEYLEL 664
            +  ++++   +TLP YTVE+L+L
Sbjct: 586 LINNNNKSLHRKTLPTYTVEHLDL 609

>KNAG0B00830 Chr2 (151939..153762) [1824 bp, 607 aa] {ON} Anc_3.489
           YGR128C
          Length = 607

 Score =  311 bits (797), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 229/681 (33%), Positives = 347/681 (50%), Gaps = 96/681 (14%)

Query: 3   SIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTPKL 62
           SI QPF ++ +PR  +      Q+  L     ++ N+N + + +S+ +ISQYI+NPTPKL
Sbjct: 4   SISQPFTIANVPRQAS------QTKVLISQHSLTSNANTLDVAVSKYSISQYIINPTPKL 57

Query: 63  LSNISIPSTNVVSACDVATLADDKEIWCYCVKSGKSHFLNASVKPVDADTVLDTDGGDKT 122
           +++ +IPS   V+A D    A       +C+   +SH                       
Sbjct: 58  VNSKAIPSNLTVTAFDNGVYATQSNNKSFCLYLDESH----------------------- 94

Query: 123 EDFKIKMDSKVVGI---KIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQNVKVVNY 179
              +I + S VV     KI  +      +L+ G +Q Y    Q  +   +  +++K V +
Sbjct: 95  ---QIPLKSAVVNCLSEKIHDESVVTTAILQDGTVQKYKGGEQVFAK-HLPLKDIKQVEF 150

Query: 180 FSENGQNFMFVLSGFENNKVCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQS 239
              +GQ  + V +          L+EL     +  T ++  +T   E F   +  L    
Sbjct: 151 I--DGQYALIVAAQ------STALYEL-----ENLTELRVSTTLHFEQFKQIRQHL---- 193

Query: 240 GKLYQLEGST--IKTYALPQCHLVQTTHLPMILDPNSQKVSLAPVSTNRILLTVNNQVYL 297
           GK+YQ + +T   K + L   + +   ++P +       ++   V  +R+ L + N++YL
Sbjct: 194 GKIYQFDLATNDFKIFELTTLNEIGVVNIPFLSASKGAPLTFTVVGDSRVCLALANEIYL 253

Query: 298 LDLVHSSVLSERTLTHAKTFQLLRSAPLNVSSSLKGSEFATRTLAIGVTTKNGNNPTSAL 357
           LDL   SVLS       K  +L       ++ +  GS       AI ++    +N  S L
Sbjct: 254 LDLHLGSVLSHNKFAQLKQVEL-------IAGARDGS------FAIALSHGPQDNAVS-L 299

Query: 358 EVINVDVGTGTLKDSLGKSFQSINDSKTH-----NLQPLFSDDESDAGDNADSDEVVAFA 412
           ++IN+++G+ ++KDSLGK F +    +        L+P+      DAGD        +F 
Sbjct: 300 DIINLELGSRSIKDSLGKGFATFMKERRSAESQVTLRPIL-----DAGDKTKR----SFD 350

Query: 413 YEDIFKELSKNNKSISKFDSTFAKRLNIQEEHYTDRERFICDQEFLSKVVRLILDSFDQE 472
           Y  I K+L+   K  +KFD  F K L I +E YT+ +RFI DQ FLS+ V +IL ++  E
Sbjct: 351 YASILKKLTAAAKDPAKFDQIFFKELYIVQECYTEGDRFIIDQNFLSETVGVILKNYSFE 410

Query: 473 ----YPRAXXXXXXXXXXXXDCTRGLLERFRNHPRLFKQAIVTCPNLPLDDLLSELFSIN 528
               YP A            D TR LL + +  PRL+KQ IVTCPNLPLD+LL+E F I 
Sbjct: 411 PSSKYPAAFTYLLTHPLFPADKTRHLLSKVKQIPRLYKQVIVTCPNLPLDELLTESFVIE 470

Query: 529 NGELCLDISLRILQDFTTDMIKDEVKKLNKVDVHNFVNFLISPKDEELIQNKSTYELFQL 588
           N EL LD+SL+ILQD+T D IK E+K L +V+V NF+ F+I   +     + +T +LFQL
Sbjct: 471 NNELSLDLSLKILQDYTKDSIKKEMKALPRVNVTNFIKFVIGNYNNSDESSVATPQLFQL 530

Query: 589 LSLVIDAIGLFALDGALLQRLSDYIDEQVYLAERNARLWNLLDTRNKNRGATGSLAGSSR 648
           LSLVID+IGLFALDG LL  L+ YID  V +AE N  LWNLL+ R        S+AGS+R
Sbjct: 531 LSLVIDSIGLFALDGELLTELAGYIDNMVKIAEMNTELWNLLEFRTNK----ASVAGSNR 586

Query: 649 AK-----EQTLPKYTVEYLEL 664
           +K     ++  P Y V++LE+
Sbjct: 587 SKYVKTQKKVFPPYLVDHLEI 607

>Kwal_55.21225 s55 complement(737726..738370) [645 bp, 215 aa] {OFF}
           YGR128C (UTP8) - Protein required for cell viability
           [contig 130] PARTIAL
          Length = 215

 Score =  189 bits (479), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 95/214 (44%), Positives = 143/214 (66%), Gaps = 10/214 (4%)

Query: 1   MPSIFQPFRLSVLPRIGALSNYEVQSDYLRVSSDISPNSNKITIGISESAISQYILNPTP 60
           MPSI QPFRL+ LP+I +L+NY  Q  YL+V+  ++P +N++ +GIS SAISQY++NPTP
Sbjct: 1   MPSISQPFRLTALPKIASLNNYATQGSYLQVADTLTPATNRVNVGISGSAISQYVINPTP 60

Query: 61  KLLSNISIPSTNVVSACDVATL--------ADDKEIWCYCVKSGKSHFLNASVKPVDADT 112
           KL+ N+ I STNVV+ACDVA +        A+  E+ CY +++ K+  + A  KP+ +  
Sbjct: 61  KLVYNLPISSTNVVTACDVAEVAGTNNEGTAEAHEVLCYALQANKTFSICAVKKPIPS-A 119

Query: 113 VLDTDGGDKTEDFKIKMDSKVVGIKIIPDYKAIVVVLESGLIQYYDFQLQKLSSLDISYQ 172
             D+  G+     K+ + ++ V +K+ P  K+IV VL SGLIQ++D+ L+   S+D SY 
Sbjct: 120 ATDSSFGETYATHKVALANQAVNVKVFPATKSIVAVLSSGLIQFFDYDLKLQHSIDSSYG 179

Query: 173 NVKVVNYF-SENGQNFMFVLSGFENNKVCFKLFE 205
           NV+ V +F SE+ Q+FMF+LS  +  KV FKL +
Sbjct: 180 NVQFVQHFVSESKQDFMFLLSDLDGRKVSFKLLK 213

>KAFR0F02380 Chr6 complement(462858..463796) [939 bp, 312 aa] {ON}
           Anc_3.225 YBR024W
          Length = 312

 Score = 35.4 bits (80), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 27/102 (26%), Positives = 49/102 (48%), Gaps = 14/102 (13%)

Query: 535 DISLRILQDFTTDMIK-----DEVKKLNKVDVHNFVNFL-----ISPKDEELIQNKSTYE 584
           D+  R L+DF   +I      D++K + K    NF  F      +SP+++ ++ + + + 
Sbjct: 206 DVLKRYLKDFHPSIIGLTGTYDQIKDMCK----NFKVFFSTPRNVSPQEDYIVDHSAFFY 261

Query: 585 LFQLLSLVIDAIGLFALDGALLQRLSDYIDEQVYLAERNARL 626
           L       ++A+G    D   L+R+  +ID  V  AER  R+
Sbjct: 262 LLDPEGQFVEALGTIYEDKDGLERIEKHIDAYVPKAERERRM 303

>KNAG0A07460 Chr1 (1170179..1173301) [3123 bp, 1040 aa] {ON}
           Anc_3.408 YPR097W
          Length = 1040

 Score = 32.7 bits (73), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 62/140 (44%), Gaps = 18/140 (12%)

Query: 308 ERTLTHAKTFQLLRSAPLNVSSSLKGSEFAT----RTLAIGVTTKN-----GNNPTSALE 358
           E+ +  AKT+   +    N+  S  G +F         +I V T+N     G  P++  E
Sbjct: 323 EQAVYTAKTYNDFKKFAHNLKESAPGHKFPKLPHKTKKSISVVTRNETLPDGRVPSNPTE 382

Query: 359 VI--NVDVGTGTLKDSLGKSFQSINDSKTHNLQPLFSDDESDAGDNADSD-------EVV 409
            I  + +  T +L  S  +S +S+N S+  N   +FS+D+ D  +    D       +  
Sbjct: 383 QIVHSFETETQSLLASANQSAESLNKSRAQNAVDVFSNDDEDEDETTFEDFEDAMDTKTN 442

Query: 410 AFAYEDIFKELSKNNKSISK 429
             A+E +   L +  +S+SK
Sbjct: 443 KLAHEKMRTSLRQYLRSLSK 462

>Kpol_1054.42 s1054 complement(100453..101379) [927 bp, 308 aa] {ON}
           complement(100453..101379) [927 nt, 309 aa]
          Length = 308

 Score = 32.0 bits (71), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 30/104 (28%), Positives = 45/104 (43%), Gaps = 8/104 (7%)

Query: 141 DYKAIVVVLESGLIQYYDFQ--LQKLSSLDISYQNVKVVNYFSENGQNFMFVLSGFENNK 198
           D K +V  L+   + Y+     LQ L   D+ +    V + F + G  + F  +G     
Sbjct: 158 DVKCVVAGLDHN-VNYHRLAITLQYLQQPDVEFVGTNVDSTFPQKG--YTFPGAGSMVES 214

Query: 199 VCFKLFELLYHDGKRHTPIKELSTTILENFNLDQSKLCYQSGKL 242
           V F       + GK   P K +  TI+  FNLD+SK C    +L
Sbjct: 215 VAFSSGRRPAYCGK---PNKNMLNTIVSAFNLDRSKCCMVGDRL 255

>SAKL0E01694g Chr5 complement(131246..131863) [618 bp, 205 aa] {ON}
           similar to uniprot|Q08058 Saccharomyces cerevisiae
           YOL008W Hypothetical ORF
          Length = 205

 Score = 31.2 bits (69), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 39/78 (50%), Gaps = 2/78 (2%)

Query: 62  LLSNISIPSTNVVSACDVATLADDKEIWCYCVKSGKSHFLNASVKPVDADTVLDTDGGDK 121
           L   I+ P+ NV     V+ ++  KE   YCV+S  +     + KPV+A  ++      +
Sbjct: 48  LCKTINAPTVNVYEV--VSEVSQYKEFMPYCVESFVNKRNQDTGKPVEAGLMISFKHYVE 105

Query: 122 TEDFKIKMDSKVVGIKII 139
               K++ DSK+ GIK +
Sbjct: 106 KFVCKVECDSKLEGIKTV 123

>TBLA0C03630 Chr3 (860550..867713) [7164 bp, 2387 aa] {ON} Anc_5.206
            YJL005W
          Length = 2387

 Score = 31.6 bits (70), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 41/80 (51%), Gaps = 14/80 (17%)

Query: 534  LDISLRILQDFTTDMIKDEVKKLNKVDVH--NFVNFLISPKDEELIQNKSTYELFQLLSL 591
            L ++   L+   T+  K  +K L  +D+H  N  NF++  +D EL     TY     L++
Sbjct: 1457 LSVARNKLEGLPTEFSK--LKNLKSLDLHSNNIRNFILGTEDIEL-----TY-----LNI 1504

Query: 592  VIDAIGLFALDGALLQRLSD 611
              +A G FALDG   Q +++
Sbjct: 1505 SSNAFGEFALDGTFFQTITN 1524

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,788,104
Number of extensions: 3424068
Number of successful extensions: 13681
Number of sequences better than 10.0: 72
Number of HSP's gapped: 14125
Number of HSP's successfully gapped: 73
Length of query: 664
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 548
Effective length of database: 40,180,143
Effective search space: 22018718364
Effective search space used: 22018718364
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)