Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D10032g3.490ON20920910331e-144
TDEL0D055803.490ON1932013159e-36
Kpol_480.153.490ON2072012839e-31
KLTH0F14784g3.490ON1951962783e-30
NCAS0E008203.490ON2021992742e-29
SAKL0F02816g3.490ON1921972722e-29
Kwal_55.212263.490ON1962022653e-28
Skud_7.4403.490ON2132142524e-26
NDAI0G009503.490ON2132132491e-25
Suva_7.4173.490ON2122132393e-24
AFR308W3.490ON1922012358e-24
YGR129W (SYF2)3.490ON2152152333e-23
Ecym_12393.490ON1932012148e-21
Smik_6.2253.490ON2132102151e-20
TPHA0D042403.490ON2092181792e-15
TBLA0C044703.490ON2222141765e-15
CAGL0I10538g3.490ON2002021739e-15
KLLA0E04643g3.490ON2212051703e-14
KNAG0B008203.490ON2072061301e-08
KAFR0C019503.490ON1571131016e-05
AGR196W8.568ON48077730.57
CAGL0M10087g2.493ON36833720.83
Kpol_1013.447.527ON72570691.9
NDAI0B049501.294ON1405112656.1
Ecym_14394.135ON741101648.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D10032g
         (209 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {O...   402   e-144
TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3....   125   9e-36
Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON} ...   113   9e-31
KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakl...   111   3e-30
NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON...   110   2e-29
SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {O...   109   2e-29
Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W...   106   3e-28
Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W (...   101   4e-26
NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON...   100   1e-25
Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W (...    97   3e-24
AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic ho...    95   8e-24
YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member ...    94   3e-23
Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON} ...    87   8e-21
Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W (...    87   1e-20
TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.49...    74   2e-15
TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3....    72   5e-15
CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa] ...    71   9e-15
KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {O...    70   3e-14
KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON...    55   1e-08
KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.49...    44   6e-05
AGR196W Chr7 (1122726..1124168) [1443 bp, 480 aa] {ON} Syntenic ...    33   0.57 
CAGL0M10087g Chr13 (1005238..1006344) [1107 bp, 368 aa] {ON} som...    32   0.83 
Kpol_1013.44 s1013 complement(99135..101312) [2178 bp, 725 aa] {...    31   1.9  
NDAI0B04950 Chr2 complement(1207146..1211363) [4218 bp, 1405 aa]...    30   6.1  
Ecym_1439 Chr1 complement(910930..913155) [2226 bp, 741 aa] {ON}...    29   8.0  

>ZYRO0D10032g Chr4 complement(847175..847804) [630 bp, 209 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 209

 Score =  402 bits (1033), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 197/209 (94%), Positives = 197/209 (94%)

Query: 1   MAIKGSQGSQMDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPE 60
           MAIKGSQGSQMDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPE
Sbjct: 1   MAIKGSQGSQMDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPE 60

Query: 61  PSLPTQDDKHGNQLMNYTIQQYEEWNSRQRDQTNKRDSGNLQDMAKYTYDKELNKLHKDT 120
           PSLPTQDDKHGNQLMNYTIQQYEEWNSRQRDQTNKRDSGNLQDMAKYTYDKELNKLHKDT
Sbjct: 61  PSLPTQDDKHGNQLMNYTIQQYEEWNSRQRDQTNKRDSGNLQDMAKYTYDKELNKLHKDT 120

Query: 121 MLQNRYTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXXXXXXXXXSNV 180
           MLQNRYTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTAT            SNV
Sbjct: 121 MLQNRYTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATERYEARRREMERSNV 180

Query: 181 QNASSGGGYINEKNKQFNEKLDRQMPQSP 209
           QNASSGGGYINEKNKQFNEKLDRQMPQSP
Sbjct: 181 QNASSGGGYINEKNKQFNEKLDRQMPQSP 209

>TDEL0D05580 Chr4 (1007529..1008110) [582 bp, 193 aa] {ON} Anc_3.490
           YGR129W
          Length = 193

 Score =  125 bits (315), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 71/201 (35%), Positives = 123/201 (61%), Gaps = 13/201 (6%)

Query: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPEP--SLPT-QD 67
           MDL+     F  LKK+S +++++ RK+   E+K+ +   KP++Y +E      + P    
Sbjct: 1   MDLESIENRFKDLKKRSVDVAIQIRKIAEREAKDESLVGKPKIYSMEDTNEMGTRPVDSS 60

Query: 68  DKHGNQLMNYTIQQYEEWNSRQRDQTNKRDSGNLQDMAKYTYDKELNKLHKDTMLQNRYT 127
           ++   +LMNY++++YEEW+ +Q+ +  KR   N+Q++AKY+Y+K+L++        ++  
Sbjct: 61  ERRRLKLMNYSMREYEEWDKKQKGKEVKRGGANVQELAKYSYEKDLSR--------SKQN 112

Query: 128 NGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXXXXXXXXXSNVQNASSGG 187
           NG  + K++ + KT +L +KDD++LV KLA D+ KT              ++ +  ++ G
Sbjct: 113 NGNRVVKISTDAKTNRLQVKDDEKLVNKLANDLKKTTRERFLARKKDMEKADAR--ATPG 170

Query: 188 GYINEKNKQFNEKLDRQMPQS 208
           GYINEKNKQFN KLDRQM ++
Sbjct: 171 GYINEKNKQFNLKLDRQMKET 191

>Kpol_480.15 s480 complement(32143..32766) [624 bp, 207 aa] {ON}
           complement(32143..32766) [624 nt, 208 aa]
          Length = 207

 Score =  113 bits (283), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 73/201 (36%), Positives = 122/201 (60%), Gaps = 12/201 (5%)

Query: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLE--APEPSLPTQDD 68
           M++ + +++F  LK+K+ +I +ENRKL++A ++EL    KP+ Y +E  A + ++ T   
Sbjct: 3   MEIKEALEEFKRLKRKAVDILIENRKLLDANTRELKKNSKPKTYSMEELAEDDTVNTGTV 62

Query: 69  KHGNQLMNYTIQQYEEWNSRQ-RDQTN----KRDSGNLQDMAKYTYDKELNKLHKDTMLQ 123
              ++L+NY+I++YEEW  +Q R + N    K    +   +AK+TYDK++ KL K     
Sbjct: 63  DEADRLLNYSIREYEEWEKKQGRHKENVHVTKSSVNSTAQIAKFTYDKQIKKLQKQKSTN 122

Query: 124 NRYTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXXXXXXXXXSNVQNA 183
           +   N G I K+ ++PKTGK+ + D  QL+K+LA+D+++T              ++ QN 
Sbjct: 123 D---NRGKISKIRKDPKTGKIVVNDSKQLIKQLAEDLNQTTKERYDRTNQKRQKNSDQN- 178

Query: 184 SSGGGYINEKNKQFNEKLDRQ 204
                YINEKNK+FN+KL+RQ
Sbjct: 179 -ENYSYINEKNKEFNDKLERQ 198

>KLTH0F14784g Chr6 (1211778..1212365) [588 bp, 195 aa] {ON} weakly
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 195

 Score =  111 bits (278), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 70/196 (35%), Positives = 111/196 (56%), Gaps = 10/196 (5%)

Query: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPE-PSLPTQDDK 69
           MDL+++      LK+K   +SV+N++ +  E K+ +A  KP VY ++  E PS  T ++ 
Sbjct: 1   MDLNKYADRLKNLKRKGVSLSVKNKQQILQEEKQTSARAKPAVYSMKTEEAPSSETTEES 60

Query: 70  HGNQLMNYTIQQYEEWNSRQRDQTNK-RDSGNLQDMAKYTYDKELNKLHKDTMLQNRYTN 128
              +L+ Y+++ +E+W  ++R ++ K  D    QD+AK+TYDKE+ +L K+      YTN
Sbjct: 61  KEAKLLQYSMKDFEQWQDKERRKSQKSSDVAKYQDLAKFTYDKEVQQLRKN------YTN 114

Query: 129 GGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXXXXXXXXXSNVQNASSGGG 188
                K     K GK+ +KDD  LV  LA  ++KTA               V  + + GG
Sbjct: 115 KVEKPKKVSINKKGKIVVKDDPHLVGSLADSLNKTANERYARIEKKIHRQMV--SDTPGG 172

Query: 189 YINEKNKQFNEKLDRQ 204
           +INEKNKQFN+K++RQ
Sbjct: 173 FINEKNKQFNDKIERQ 188

>NCAS0E00820 Chr5 complement(151102..151710) [609 bp, 202 aa] {ON}
           Anc_3.490 YGR129W
          Length = 202

 Score =  110 bits (274), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 77/199 (38%), Positives = 123/199 (61%), Gaps = 11/199 (5%)

Query: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPEPS-LPTQ--- 66
           +DL+ + +    LK+K+ + ++ENR LV+ ESK++ +  KPRVY ++  + + L TQ   
Sbjct: 2   IDLEGYSRKLKELKRKAQDATIENRLLVDRESKDIESSGKPRVYNMQDDQDNQLETQEED 61

Query: 67  -DDKHGNQLMNYTIQQYEEWNSRQRDQTNKRDSGNLQDMAKYTYDKELNKLHKDTMLQNR 125
            DDK   +LMNYT++QYEEW  +Q+D+  K DS +++ +A ++YDK ++ L++     ++
Sbjct: 62  ADDKVA-KLMNYTLRQYEEWEKKQKDKKIKDDSSDMKQLAMFSYDKGVSNLNR--FRTDK 118

Query: 126 YTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXXXXXXXXXSNVQNASS 185
            T    +Q +  N KTGK+ I+D+ +LV  LAK++ KTA              +    SS
Sbjct: 119 TTTEREVQ-IQVNSKTGKVNIQDEKKLVNDLAKNLTKTANKRYMVTKKKLDARS--KDSS 175

Query: 186 GGGYINEKNKQFNEKLDRQ 204
             GYINE+NK FNEKLDR+
Sbjct: 176 AEGYINERNKHFNEKLDRE 194

>SAKL0F02816g Chr6 complement(239471..240049) [579 bp, 192 aa] {ON}
           weakly similar to uniprot|P53277 Saccharomyces
           cerevisiae YGR129W SYF2 SYnthetic lethal with cdcForty
           (putative) involved in pre-mRNA splicing
          Length = 192

 Score =  109 bits (272), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 68/197 (34%), Positives = 109/197 (55%), Gaps = 9/197 (4%)

Query: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPEPSLPTQDDKH 70
           MDL   +     LK+K  ++SV+NRK    E K+     KP+VY +   E     +++  
Sbjct: 1   MDLTDLLGKLKYLKRKGVDVSVKNRKEAEKEEKQAKQSGKPKVYSMNEDETFKDQKEEDT 60

Query: 71  GNQLMNYTIQQYEEWNSRQRDQTNKRDSGNLQDMAKYTYDKELNKLHKDTMLQNRYTNGG 130
             +L+NY+I+ YE+W  ++  +    D  + QD+AKYTYDKE+ ++ KD  L     N G
Sbjct: 61  RGKLLNYSIKDYEKWQLKRTAKLKNSDGSSQQDLAKYTYDKEIREMEKDGSL-----NRG 115

Query: 131 SIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXXXXXXXXXSNVQNASSGGGYI 190
            + K   N K G++ I DD + +++LA +++K+              +   ++S+ GG+I
Sbjct: 116 KVTKARLNGK-GRIQINDDKKSLEQLADNLNKST---KRRYIERKKQAEKLDSSTTGGFI 171

Query: 191 NEKNKQFNEKLDRQMPQ 207
           N+KNKQFNEKL RQ  Q
Sbjct: 172 NDKNKQFNEKLSRQFKQ 188

>Kwal_55.21226 s55 (738730..739320) [591 bp, 196 aa] {ON} YGR129W
           (SYF2) - (putative) involved in pre-mRNA splicing
           [contig 130] FULL
          Length = 196

 Score =  106 bits (265), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 71/202 (35%), Positives = 113/202 (55%), Gaps = 22/202 (10%)

Query: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQL--EAPEPSLPTQDD 68
           MDL ++      LK+K  ++SV+N+  V  E K ++A RKP VY +  E  E  +  +D 
Sbjct: 1   MDLSKYADRLKNLKRKRIDLSVKNKNEVIREEKMVSASRKPAVYSMNAEGAEEEIA-KDV 59

Query: 69  KHGNQLMNYTIQQYEEWNSRQRDQTNKRDSG-NLQDMAKYTYDKELNKLHKDTMLQNRYT 127
              N+L+ Y++ +YE+W  + +  +++ + G + QD+AK TYDKE+ +L K         
Sbjct: 60  TEANKLLKYSMLEYEQWQDKVKKNSHRLEGGASFQDLAKSTYDKEVQQLSK--------I 111

Query: 128 NGGSIQKMNRNPK-----TGKLTIKDDDQLVKKLAKDMDKTATXXXXXXXXXXXXSNVQN 182
           +G    ++N+N K      GK+ ++DD QLV  L + ++KTA                 N
Sbjct: 112 DGN---RVNKNTKYRVNNKGKIVVEDDQQLVTGLVETLNKTADERYARIQKKIGRQ--MN 166

Query: 183 ASSGGGYINEKNKQFNEKLDRQ 204
            ++ GGYINEKNKQFN+KL+RQ
Sbjct: 167 NTTSGGYINEKNKQFNDKLERQ 188

>Skud_7.440 Chr7 (729641..730282) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score =  101 bits (252), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 74/214 (34%), Positives = 112/214 (52%), Gaps = 26/214 (12%)

Query: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLE-APEPSLPTQDDK 69
           M+LD+  +    LK+K   +S++NRKL + E +E    RKP+VY +E   + + P +D +
Sbjct: 1   MELDKLDQKLKVLKRKGVNVSIKNRKLADREIQEAGLNRKPKVYSMEDVNDGAEPVEDAE 60

Query: 70  HG--NQLMNYTIQQYEEWNSRQRDQTNKRD--SGNLQD-MAKYTYDKELNKLHKDTMLQN 124
               ++  +YT+Q+Y  W  +Q  + N +   SGN  D +AK +Y+K L  L    + QN
Sbjct: 61  TSDKDKAFHYTVQEYNAWKQKQNQRKNGQGQRSGNSYDQVAKLSYEKTLRNL----VTQN 116

Query: 125 RYTN--------------GGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXX 170
              N               G+I K+ RN KTGK+ I DDD+LV KLA  ++  +      
Sbjct: 117 SNKNENSVNKNDSNSSPKNGAIHKIQRNIKTGKIEIVDDDKLVNKLAFTLE--SESKKRY 174

Query: 171 XXXXXXXSNVQNASSGGGYINEKNKQFNEKLDRQ 204
                   N +  SS   +IN+KNKQFNEKL R+
Sbjct: 175 EARRKQMENAKTPSSVESFINDKNKQFNEKLSRE 208

>NDAI0G00950 Chr7 complement(198741..199382) [642 bp, 213 aa] {ON}
           Anc_3.490 YGR129W
          Length = 213

 Score =  100 bits (249), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 72/213 (33%), Positives = 120/213 (56%), Gaps = 23/213 (10%)

Query: 10  QMDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPEPS------- 62
           Q +LD + ++  ALK+   +I  ENRK  + E KE +   KP+VY ++A E         
Sbjct: 3   QEELDVYEENLKALKRSVLDIITENRKRADQEVKEKSQSSKPKVYDIKAVEDDDNHHTDY 62

Query: 63  -----LPTQDDKHGNQLMNYTIQQYEEWNSRQRDQTNKR-DSGNLQDMAKYTYDKELNKL 116
                   +++K   +LMNYTI++YEEW+ +Q+D+  KR D  +L ++A +TY+KEL+KL
Sbjct: 63  DGLGDFSNEEEKRKFKLMNYTIREYEEWDKQQKDKQRKRVDGSDLTELATFTYEKELSKL 122

Query: 117 HKDTMLQNRYTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXXXXXXXX 176
             ++ L+N   +     ++  N + GKL +KD+++L+  L  ++++TA            
Sbjct: 123 --NSKLEN--ISHEQKHQIGVNTRNGKLNVKDEERLLNNLVNNLNETAKKRYMVRKKKLQ 178

Query: 177 XSNVQNASS--GGGYINEKNKQFNEKLDRQMPQ 207
                 ASS   G Y  +KNKQFNEKL+R++ +
Sbjct: 179 SK----ASSDIAGNYFKDKNKQFNEKLERELKE 207

>Suva_7.417 Chr7 (720529..721167) [639 bp, 212 aa] {ON} YGR129W
           (REAL)
          Length = 212

 Score = 96.7 bits (239), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 74/213 (34%), Positives = 114/213 (53%), Gaps = 25/213 (11%)

Query: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLE-APEPSLPTQ--- 66
           MDL++       LK++  + S++ RKL + E +E ++ RKPRVY +E A +  L  +   
Sbjct: 1   MDLEELGNKLKELKRRRVDASLKTRKLADREIQEASSNRKPRVYSMEDASDDELVRETKS 60

Query: 67  DDKHGNQLMNYTIQQYEEWN--SRQRDQTNKRDSGNLQD-MAKYTYDKELNKL------- 116
           DDK  ++  +YT+Q+Y  W    +QR     + +GN  D +AK +YDK L  L       
Sbjct: 61  DDK--DRAFHYTVQEYNAWEQKQKQRKSGKTQGTGNSYDQLAKLSYDKTLRNLTTQNYGK 118

Query: 117 HKDTMLQNRYTNGGS-----IQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXXX 171
           H+ ++  N   + GS     I+K+ +N  TGK+ I DDD+LV KLA  ++  +       
Sbjct: 119 HESSV--NEKDSKGSLGKSRIEKIQKNSITGKIRIVDDDELVNKLASTLE--SDSKKRHD 174

Query: 172 XXXXXXSNVQNASSGGGYINEKNKQFNEKLDRQ 204
                  NV+  S    +IN+KNKQFNEKL R+
Sbjct: 175 ARKRQMENVKTPSGVESFINDKNKQFNEKLGRE 207

>AFR308W Chr6 (999495..1000073) [579 bp, 192 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR129W (SYF2)
          Length = 192

 Score = 95.1 bits (235), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 65/201 (32%), Positives = 100/201 (49%), Gaps = 20/201 (9%)

Query: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPEPSLPTQDDKH 70
           M ++   +    LKKK  + S+ NRK   +E +   A  KPRVY +          DD  
Sbjct: 1   MGIEDINRRLRQLKKKRVDASIRNRKEAASEERARLAEGKPRVYSMAEEPADEAEADDTQ 60

Query: 71  GNQL--MNYTIQQYEEWNSRQRDQTNKRDSGNLQDMAKYTYDKELNKLHKDTMLQNRYTN 128
             QL  +NY I  YE+W+ +Q+      D  +L ++A  TY  EL++LH+  +++ R TN
Sbjct: 61  SEQLKLLNYRIADYEKWDEKQKRHKQPSDGADLGELANSTYRSELHQLHRRGVVKGRATN 120

Query: 129 GGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXXXXXXXXXSNVQNASSGG- 187
           G       R   +GK+ + D+ +LV+KLA  + +TA                + A  GG 
Sbjct: 121 G-------RISASGKVVLDDEPELVEKLAAAVQQTAKRRHEERQK-------KAAKDGGR 166

Query: 188 ---GYINEKNKQFNEKLDRQM 205
              G +N+KN+ FNEKLDR+ 
Sbjct: 167 ATAGSLNDKNRHFNEKLDREF 187

>YGR129W Chr7 (750400..751047) [648 bp, 215 aa] {ON}  SYF2Member of
           the NineTeen Complex (NTC) that contains Prp19p and
           stabilizes U6 snRNA in catalytic forms of the
           spliceosome containing U2, U5, and U6 snRNAs; isy1 syf2
           cells have defective spindles activiating cell cycle
           arrest
          Length = 215

 Score = 94.4 bits (233), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 68/215 (31%), Positives = 110/215 (51%), Gaps = 26/215 (12%)

Query: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLE---APEPSLPTQD 67
           MD  +  +    LK+K  ++S+++RKL + E +E++A RKPRVY +E     + S+   +
Sbjct: 1   MDFYKLDEKLKELKRKRVDVSIKSRKLADREIQEVSANRKPRVYSMEDVNDADESVGDTE 60

Query: 68  DKHGNQLMNYTIQQYEEWNSRQ-RDQTNKRDSGNLQ--DMAKYTYDKELNKLHKDTMLQN 124
                +  +YT+Q+Y+ W  R  + +T +   G +    +AK +Y+K L  L   T   +
Sbjct: 61  SPEKEKAFHYTVQEYDAWERRHPQGKTGQSQRGGISYDQLAKLSYEKTLRNLATQTQNSS 120

Query: 125 RYTNG------------GSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXXXX 172
           +  +             G I K+ ++ KTGK+TI DDD+LV KLA      +        
Sbjct: 121 KQDSSADEEDNKNVPKKGRIGKVQKDTKTGKITIADDDKLVNKLA-----VSLQSESKKR 175

Query: 173 XXXXXSNVQNASSGGG---YINEKNKQFNEKLDRQ 204
                  +QNA +  G   +IN+KNKQFNEKL R+
Sbjct: 176 YEARKRQMQNAKTLYGVESFINDKNKQFNEKLSRE 210

>Ecym_1239 Chr1 complement(491113..491694) [582 bp, 193 aa] {ON}
           similar to Ashbya gossypii AFR308W
          Length = 193

 Score = 87.0 bits (214), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 64/201 (31%), Positives = 105/201 (52%), Gaps = 15/201 (7%)

Query: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGR-KPRVYQLE---APEPSLPTQ 66
           MD+D        LK K  +IS++NRK + +E + L  GR KP VY +    A    + + 
Sbjct: 1   MDIDDISSRLRRLKSKRVDISIKNRKEIVSE-EVLQVGRSKPEVYSINDEGAAVNEVQST 59

Query: 67  DDKHGNQLMNYTIQQYEEWNSRQRDQTNKRDSGNLQDMAKYTYDKELNKLHKDTMLQNRY 126
            +    +L+NY++  YE+W+ +++ Q N  D     D+A  TY  E+ +L K  + + + 
Sbjct: 60  SNTERRKLLNYSLIDYEKWDEKEK-QAN-FDGTYSGDIAYSTYKNEIKQLRKGGLTKGKI 117

Query: 127 TNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXXXXXXXXXSNVQNASSG 186
           T G       R  ++GK+ I+D+ +LV KLA+ ++KT+              +  N S  
Sbjct: 118 TKG-------RISESGKVAIEDEKELVNKLAQTLEKTS-RERFLREKKRLDGHKANTSEL 169

Query: 187 GGYINEKNKQFNEKLDRQMPQ 207
           G ++NEKN+ FNEKL RQ  +
Sbjct: 170 GNFVNEKNRHFNEKLSRQFKE 190

>Smik_6.225 Chr6 (368227..368868) [642 bp, 213 aa] {ON} YGR129W
           (REAL)
          Length = 213

 Score = 87.4 bits (215), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 105/210 (50%), Gaps = 18/210 (8%)

Query: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLE---APEPSLPTQD 67
           M+LDQ  +    LKKK   +S++NRKL + E +E    RKPRVY +E     + S+   +
Sbjct: 1   MNLDQLEQRLKELKKKRVNVSIKNRKLADREIQEANVNRKPRVYNMEDINDVDESVGYTE 60

Query: 68  DKHGNQLMNYTIQQYEEWNSRQRDQT---NKRDSGNLQDMAKYTYDKELNKL-------H 117
               ++  +YT Q+Y  W  R   +    +KR   +   +AK +Y+K L  L       +
Sbjct: 61  SSDKDRAFHYTAQEYIAWEQRHHQRKIGQSKRSGISYDQLAKLSYEKTLRNLATQDLSEY 120

Query: 118 KDTMLQNRYTNGGSIQKMNR---NPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXXXXXX 174
            + + +  + N   I +++R   + KTGK+ I DD +LV KLA  ++  +          
Sbjct: 121 DNFVNEKDHKNISKISRIDRIQKDTKTGKIRIADDHKLVNKLAVSLESESKKRYEARKRQ 180

Query: 175 XXXSNVQNASSGGGYINEKNKQFNEKLDRQ 204
              + +   S    +IN+KNKQFNEKL R+
Sbjct: 181 MESAVI--PSGVESFINDKNKQFNEKLSRE 208

>TPHA0D04240 Chr4 (916281..916910) [630 bp, 209 aa] {ON} Anc_3.490
           YGR129W
          Length = 209

 Score = 73.6 bits (179), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 99/218 (45%), Gaps = 36/218 (16%)

Query: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQL-------EAPEPSL 63
           MD+   I +F  LKK++ +  +E+RK + A+ KE  +  KP+VY +             L
Sbjct: 1   MDMVSLIDEFKVLKKQALDSLIEDRKFLEADEKERKSVLKPKVYSINMDDDGDGDAGDDL 60

Query: 64  PTQDDKHGNQLMNYTIQQYEEWNSRQRDQTNKRDSGNLQD----------MAKYTYDKEL 113
            T + +    L+ YTI+ YEEW     +++ KR   N+ +           AK+TYDKE+
Sbjct: 61  LTNNSERA--LLTYTIRDYEEW-----EESLKRKHKNVTNTSTSSSSQQQTAKFTYDKEI 113

Query: 114 NKLHKDTMLQNRYTNGGSIQK---MNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXX 170
           +++ K    Q ++     I +   M      GKL IKDD  LV     D++K +      
Sbjct: 114 HRMKKR---QGKFATDEEITRGSAMKEVLDDGKLLIKDDKHLVNGFISDINKVSNDRYIK 170

Query: 171 XXXXXXXSN------VQNASSGGGYINEKNKQFNEKLD 202
                  +N      V +      Y N KNK FN+KL+
Sbjct: 171 RMKLNAVNNDATGSKVSHDKGKTSYNNAKNKDFNDKLE 208

>TBLA0C04470 Chr3 (1082932..1083600) [669 bp, 222 aa] {ON} Anc_3.490
           YGR129W
          Length = 222

 Score = 72.4 bits (176), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 113/214 (52%), Gaps = 26/214 (12%)

Query: 12  DLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQL--EAPEPSLPTQDDK 69
           D+++    +  LK+K+    + N+  + +   + A   KP+VY +  E  +  LP  D+ 
Sbjct: 3   DINELETSWKTLKEKAENTRINNQHFLTSLRDKSATNNKPKVYSMTDEFDKDELPINDEN 62

Query: 70  ----HG-----NQLMNYTIQQYEEWNSRQRD-----QTNKRDS--GNLQDMAKYTYDKEL 113
               H      ++LMNYT+++Y++W  +Q +     QTN +D    +L  +AK TYDK++
Sbjct: 63  ARKNHSEEERISKLMNYTLREYKDWELKQNEYTTESQTNSKDDQIESLDSLAKRTYDKDI 122

Query: 114 NKLHK---DTMLQNRYTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXX 170
            KL+K    T   N+    G I K +RN ++ K+ IKDD  LV++L  ++ KT +     
Sbjct: 123 RKLNKALRATNSGNKSNKPGKIIKNHRN-ESNKIVIKDDKFLVEELVNNL-KTKSDRLYK 180

Query: 171 XXXXXXXSNVQNASSGGGYINEKNKQFNEKLDRQ 204
                  +    +++  G++N KN++FNEKL R+
Sbjct: 181 HLGERRKN---YSTTLSGHVNTKNQEFNEKLTRE 211

>CAGL0I10538g Chr9 complement(1042601..1043203) [603 bp, 200 aa]
           {ON} similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129w
          Length = 200

 Score = 71.2 bits (173), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 98/202 (48%), Gaps = 19/202 (9%)

Query: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPEP------SLP 64
           M+L+ + +    LKK   +I + NR L+  E++E   G KPRVY +   E       S  
Sbjct: 1   MNLEDYNEKLKLLKKSVQDIKIRNRNLLKQEAEEKEKGLKPRVYSMHDDEDDSDEKRSSD 60

Query: 65  TQDDKHGNQLMNYTIQQYEEWNSRQRDQTNKRDSGN----LQDMAKYTYDKELNKLHKDT 120
            Q D   N L  YT+Q + +W  RQ+ +   +        LQ +AK TYDKEL  L +  
Sbjct: 61  EQSDMRTN-LFQYTVQDFIDWEKRQQRKKKSKLESKSGMRLQHLAKNTYDKELQNLPRP- 118

Query: 121 MLQNRYTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXXXXXXXXXSNV 180
                +       +   N  +GK+ IKD+ +LV++L++++ +TA             +N 
Sbjct: 119 ----EFKMKAKETQFRINKDSGKVNIKDNKELVQRLSQNLKETA---KQRYDSNRKIAND 171

Query: 181 QNASSGGGYINEKNKQFNEKLD 202
           +  +S  G IN KN QFN+ LD
Sbjct: 172 KEHTSLSGSINAKNLQFNKSLD 193

>KLLA0E04643g Chr5 complement(413277..413942) [666 bp, 221 aa] {ON}
           similar to uniprot|P53277 Saccharomyces cerevisiae
           YGR129W SYF2 SYnthetic lethal with cdcForty (putative)
           involved in pre-mRNA splicing
          Length = 221

 Score = 70.1 bits (170), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 101/205 (49%), Gaps = 33/205 (16%)

Query: 12  DLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLE----------APEP 61
           DL +  K   +L+K+  E+S+ N+K + AE K+     + RVY +             EP
Sbjct: 38  DLMEIEKKLKSLRKQKVEVSIRNKKAIIAEEKK---NSERRVYSMADDGEDKARSNKSEP 94

Query: 62  SLPTQDDKHGNQLMNYTIQQYEEWNSR-QRDQTNKRDSGNLQDMAKYTYDKELNKLHKDT 120
             P        +L NY+I++YE+W ++ Q  + NK   G+ Q +AK +Y KE++ L KD 
Sbjct: 95  EDPI-------KLANYSIREYEKWEAKTQNSRHNKSVMGDFQTIAKNSYKKEVDALPKDI 147

Query: 121 MLQNRYTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXXXXXXXXXSNV 180
              +    GG  +        GK+ ++D+ +LV+K+  D+++ +              N 
Sbjct: 148 ---SHPLKGGITE-------DGKVQVEDNPELVEKMVNDLNERSKKRYMVRKQKLDKQNK 197

Query: 181 QNASSGGGYINEKNKQFNEKLDRQM 205
            N     G+IN+KNK+FN KL+ + 
Sbjct: 198 INLDD--GFINDKNKRFNAKLNSEF 220

>KNAG0B00820 Chr2 complement(151197..151820) [624 bp, 207 aa] {ON}
           Anc_3.490 YGR129W
          Length = 207

 Score = 54.7 bits (130), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 59/206 (28%), Positives = 87/206 (42%), Gaps = 41/206 (19%)

Query: 11  MDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLEAPEPSLPTQD--- 67
           M L +    F  L ++S  + V  RK       + A   KP+VY L+A EPS+   D   
Sbjct: 35  MGLTELRDKFKTLSQESQRLRVRIRK-------QQAEVEKPKVYSLQAAEPSVDGIDGAE 87

Query: 68  --DKHGNQLMNYTIQQYEEWNSRQR---DQTNKRDSGNLQDMAKYTYDKELNKLHKDTML 122
             D    +L+N  ++Q E   +R+    D    R  G+   +AK TY KEL       +L
Sbjct: 88  VVDNVTVKLLNTPLRQLEAREARRGENGDDAVARVEGD--RVAKDTYKKEL------ALL 139

Query: 123 QNRYTNGGSIQKMNRNPKTGKLTIKDDDQLVKKLAKDMDKTATXXXXXXXXXXXXSNVQN 182
             + T G               T +D+   V++L   ++  +                + 
Sbjct: 140 GRKSTRG---------------TYRDN---VERLVTHLNDVSKKRYLVRKNKMKRQGARG 181

Query: 183 ASSGGGYINEKNKQFNEKLDRQMPQS 208
            SS  GYINEKNKQFN+KL R  P +
Sbjct: 182 GSSLDGYINEKNKQFNKKLQRNGPST 207

>KAFR0C01950 Chr3 (390143..390616) [474 bp, 157 aa] {ON} Anc_3.490
           YGR129W
          Length = 157

 Score = 43.5 bits (101), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 55/113 (48%), Gaps = 20/113 (17%)

Query: 10  QMDLDQFIKDFNALKKKSWEISVENRKLVNAESKELAAGRKPRVYQLE----APEPSLPT 65
           +MD+    ++F  L+KK  EI +ENRKL++  S       KP+ Y +       E S   
Sbjct: 2   EMDMANLREEFRDLRKKCREIKIENRKLISIAS-------KPKTYSIREEEIGAEVSDED 54

Query: 66  QDDKHGNQLMNYTIQQYEEWNSRQRDQTNKRDSGNLQDMAKYTYDKELNKLHK 118
           +DD    +L+   ++++E         T    + N +D+ + TY+KE+  L K
Sbjct: 55  EDDSEIIKLLTKPLREFE---------TEAHVAENKEDIDRLTYNKEVMSLGK 98

>AGR196W Chr7 (1122726..1124168) [1443 bp, 480 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL091W (GLR1)
          Length = 480

 Score = 32.7 bits (73), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 22/77 (28%), Positives = 38/77 (49%), Gaps = 17/77 (22%)

Query: 89  QRDQTNKRDSGNLQDMAKYTYDKELNKLHKDTMLQNRYTNGGSIQKMNRNPKTGKLT--- 145
           ++D    +   ++Q++    Y+KE   +HK            SIQ++ ++P TGKLT   
Sbjct: 226 RKDHVLTKFDPSIQEIVTEHYEKEGVNIHKKE----------SIQRVEKDPNTGKLTVHL 275

Query: 146 ----IKDDDQLVKKLAK 158
               I+D DQLV  + +
Sbjct: 276 SGKIIEDVDQLVWAIGR 292

>CAGL0M10087g Chr13 (1005238..1006344) [1107 bp, 368 aa] {ON} some
           similarities with uniprot|P38749 Saccharomyces
           cerevisiae YHL009c transcription factor
          Length = 368

 Score = 32.3 bits (72), Expect = 0.83,   Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (69%)

Query: 9   SQMDLDQFIKDFNALKKKSWEISVENRKLVNAE 41
           S++D DQ +K+   L+K + EI+ ENRKL+  E
Sbjct: 199 SEIDRDQLLKELEKLRKWNMEINAENRKLLQKE 231

>Kpol_1013.44 s1013 complement(99135..101312) [2178 bp, 725 aa] {ON}
           complement(99135..101312) [2178 nt, 726 aa]
          Length = 725

 Score = 31.2 bits (69), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 33/70 (47%), Gaps = 10/70 (14%)

Query: 62  SLPTQDDKHGNQLMNYTIQ-------QYEEWNSRQRDQTNKRDSGNLQDMAKYTYDKELN 114
           SLP QDDK   Q+    +        +Y     R  DQ +K D+      + YTY++  N
Sbjct: 41  SLPPQDDKESLQVARKILDGSYVESDEYRAVIDRSVDQLSKNDTSY---ESAYTYEQSRN 97

Query: 115 KLHKDTMLQN 124
             H+D+ L+N
Sbjct: 98  SKHRDSRLRN 107

>NDAI0B04950 Chr2 complement(1207146..1211363) [4218 bp, 1405 aa]
           {ON} Anc_1.294 YJL076W
          Length = 1405

 Score = 29.6 bits (65), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 48/112 (42%), Gaps = 17/112 (15%)

Query: 27  SWEISVENRKLVNAESKELAAGRKPRVYQLEAPEPSLPTQDDKH-----------GNQLM 75
           + EI + ++K VN ESKE A  +KP    +     S+ TQ  K            GN++ 
Sbjct: 632 AAEIKMNSKKRVNEESKENAIVKKPLTKSVSG-SSSINTQPKKSKVEMEPIPVAKGNKMK 690

Query: 76  NYTIQQYEEWNSRQRDQTNKRDSGNLQDMAKYTYDKE-----LNKLHKDTML 122
                  EE    + D T K+   N   + K+ + K+     +++ HKD  L
Sbjct: 691 TLEFSTDEESTDDENDTTPKKKIENTTAVGKFKFKKQEEELPISRSHKDIKL 742

>Ecym_1439 Chr1 complement(910930..913155) [2226 bp, 741 aa] {ON}
           similar to Ashbya gossypii AFR495C
          Length = 741

 Score = 29.3 bits (64), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 30/101 (29%), Positives = 43/101 (42%), Gaps = 29/101 (28%)

Query: 56  LEAPEPSLPTQDDKHGNQLMNYTIQQYEEWNSRQRDQTNKRDSGNLQDMAK------YTY 109
           +EAP PSLPT  D        Y+ Q      +  R+ + KRD   + +  +       T 
Sbjct: 259 VEAPTPSLPTSTD--------YSFQ----GTTTARNVSVKRDESMVSEHIEDGTDIGTTK 306

Query: 110 DKELNKLHKDTMLQNRYTNGGS----IQKMNRNPKTGKLTI 146
            + LN+       Q+RY   GS      K+N   K GKLT+
Sbjct: 307 SETLNR-------QSRYIGDGSTITVFLKLNNKVKKGKLTL 340

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.125    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 23,395,366
Number of extensions: 988851
Number of successful extensions: 3541
Number of sequences better than 10.0: 98
Number of HSP's gapped: 3475
Number of HSP's successfully gapped: 98
Length of query: 209
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 104
Effective length of database: 41,441,469
Effective search space: 4309912776
Effective search space used: 4309912776
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.6 bits)
S2: 63 (28.9 bits)