Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D10010g3.491ON38238217720.0
Skud_16.4433.491ON42042310051e-134
YPR148C3.491ON4354379991e-133
Smik_16.4013.491ON4274319731e-129
TDEL0D055903.491ON3443829611e-128
Suva_16.4773.491ON4234229611e-127
Kwal_55.212273.491ON3763889291e-123
KLTH0F14806g3.491ON3583858931e-118
SAKL0F02794g3.491ON3974028891e-117
Kpol_1017.73.491ON3783918091e-105
TBLA0D029803.491ON4434157693e-98
KLLA0E04621g3.491ON3894127592e-97
TPHA0D032703.491ON3884097505e-96
AFR309C3.491ON3643957033e-89
Ecym_12383.491ON3934017029e-89
NDAI0B058503.491ON4734736662e-82
CAGL0L08492g3.491ON3853676532e-81
NCAS0F035403.491ON4442616042e-73
KAFR0G036803.491ON4154485855e-71
KNAG0A079303.491ON4524615599e-67
ZYRO0D16522g7.221ON3581982117e-18
Kwal_47.181487.221ON3232572099e-18
NDAI0A026607.221ON3642402091e-17
KLTH0A03894g7.221ON3232592036e-17
SAKL0F08162g7.221ON3302452036e-17
KLLA0E04511g7.221ON3022502001e-16
Kpol_478.227.221ON3501961992e-16
TDEL0H022407.221ON3382401966e-16
ADL115W7.221ON3332381903e-15
Ecym_43777.221ON3332331833e-14
Kpol_1070.197.221ON3112381823e-14
KAFR0I019507.221ON3302471798e-14
CAGL0L00891g7.221ON3412421735e-13
TBLA0D042007.221ON3312431701e-12
NCAS0A133807.221ON3292381673e-12
KNAG0D017607.221ON3422001664e-12
TPHA0B027507.221ON3631961656e-12
Suva_9.1597.221ON3252341551e-10
TBLA0B015807.221ON3862031542e-10
TPHA0C012307.221ON3052461513e-10
Smik_9.1507.221ON3262341504e-10
Skud_9.1287.221ON3292341504e-10
YIL041W (GVP36)7.221ON3262341461e-09
TDEL0H026107.186ON1170128950.005
TPHA0C029002.201ON142265790.40
ZYRO0G16170g5.279ON158147750.45
Skud_16.1036.170ON29555770.47
Skud_1.427.80ON1126217780.52
TBLA0H008008.408ON481134770.58
TPHA0F002604.21ON52643770.60
Suva_4.617.301ON28137750.81
KAFR0A064204.165ON960133760.88
Smik_15.1138.808ON40666750.96
Kpol_2001.321.175ON40171731.7
TDEL0C012008.91ON19974711.9
ZYRO0D17688g6.381ON31761722.0
KLLA0D05731g8.8ON21239712.1
CAGL0K01551g3.159ON96996722.7
TPHA0A026801.163ON102391722.7
KAFR0B032858.736ON1499134722.8
TDEL0F038608.259ON1399132713.6
CAGL0E05500g7.51ON1643174713.7
KLTH0E04686g7.190ON16978683.9
Skud_6.1237.190ON14542674.4
TPHA0G013808.732ON65948704.4
TBLA0H006108.431ON70896704.4
Kwal_27.111186.175ON727147704.4
TPHA0C031602.248ON75568704.5
TBLA0F031203.384ON78147704.5
TDEL0B004108.872ON849108704.5
KNAG0J001908.872ON899136704.6
NDAI0E031608.484ON94678704.6
Suva_15.2695.363ON106556704.7
TPHA0A024803.389ON36080694.9
TBLA0B048708.85ON469180695.4
SAKL0F02552g3.498ON47865695.4
KAFR0A039008.685ON62988695.7
Suva_13.558.872ON89780696.0
Skud_13.508.872ON89880696.0
KLLA0D11880g8.487ON31870686.2
CAGL0J06490g8.816ON15494666.3
CAGL0J09460g7.281ON344149686.4
TBLA0B092202.392ON35349686.5
NCAS0B009908.808ON39295686.7
Smik_14.1912.130ON434125686.9
AFR414W1.508ON27228677.7
KNAG0H021002.273ON81875687.9
TPHA0D014408.704ON86158687.9
KLTH0F06424g1.242ON29691678.0
ZYRO0D12804g5.538ON1049139688.1
Kwal_23.47762.234ON19780668.2
NDAI0D031304.340ON149564688.3
TPHA0A049605.113ON207768688.5
ZYRO0F04422g8.91ON20682668.5
ZYRO0D09592g7.150ON51266679.6
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ZYRO0D10010g
         (1149 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   687   0.0  
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   391   e-134
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   389   e-133
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   379   e-129
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   374   e-128
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   374   e-127
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   362   e-123
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   348   e-118
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   347   e-117
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   316   e-105
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   300   3e-98
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   296   2e-97
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   293   5e-96
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   275   3e-89
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   275   9e-89
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   261   2e-82
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   256   2e-81
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   237   2e-73
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   229   5e-71
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   219   9e-67
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    86   7e-18
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    85   9e-18
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     85   1e-17
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    83   6e-17
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    83   6e-17
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    82   1e-16
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    81   2e-16
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    80   6e-16
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    78   3e-15
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    75   3e-14
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    75   3e-14
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    74   8e-14
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    71   5e-13
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    70   1e-12
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    69   3e-12
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    69   4e-12
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    68   6e-12
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    64   1e-10
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    64   2e-10
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    63   3e-10
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    62   4e-10
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    62   4e-10
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    61   1e-09
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....    41   0.005
TPHA0C02900 Chr3 (630971..635239) [4269 bp, 1422 aa] {ON} Anc_2....    35   0.40 
ZYRO0G16170g Chr7 (1327801..1328277) [477 bp, 158 aa] {ON} simil...    33   0.45 
Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {O...    34   0.47 
Skud_1.42 Chr1 (90362..93742) [3381 bp, 1126 aa] {ON} YAL019W (R...    35   0.52 
TBLA0H00800 Chr8 (179344..180789) [1446 bp, 481 aa] {ON} Anc_8.4...    34   0.58 
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    34   0.60 
Suva_4.61 Chr4 (114078..114923) [846 bp, 281 aa] {ON} YDL186W (R...    33   0.81 
KAFR0A06420 Chr1 (1300149..1303031) [2883 bp, 960 aa] {ON} Anc_4...    34   0.88 
Smik_15.113 Chr15 (194228..195448) [1221 bp, 406 aa] {ON} YOL054...    33   0.96 
Kpol_2001.32 s2001 complement(93914..95119) [1206 bp, 401 aa] {O...    33   1.7  
TDEL0C01200 Chr3 (205482..206081) [600 bp, 199 aa] {ON} Anc_8.91...    32   1.9  
ZYRO0D17688g Chr4 complement(1464457..1465410) [954 bp, 317 aa] ...    32   2.0  
KLLA0D05731g Chr4 complement(493687..494325) [639 bp, 212 aa] {O...    32   2.1  
CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highl...    32   2.7  
TPHA0A02680 Chr1 complement(575046..578117) [3072 bp, 1023 aa] {...    32   2.7  
KAFR0B03285 Chr2 (683307..687806) [4500 bp, 1499 aa] {ON}              32   2.8  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....    32   3.6  
CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highl...    32   3.7  
KLTH0E04686g Chr5 (420873..421382) [510 bp, 169 aa] {ON} weakly ...    31   3.9  
Skud_6.123 Chr6 complement(219525..219962) [438 bp, 145 aa] {ON}...    30   4.4  
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    32   4.4  
TBLA0H00610 Chr8 complement(127408..129534) [2127 bp, 708 aa] {O...    32   4.4  
Kwal_27.11118 s27 (644020..646203) [2184 bp, 727 aa] {ON} YPL180...    32   4.4  
TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {O...    32   4.5  
TBLA0F03120 Chr6 complement(758028..760373) [2346 bp, 781 aa] {O...    32   4.5  
TDEL0B00410 Chr2 complement(74062..76611) [2550 bp, 849 aa] {ON}...    32   4.5  
KNAG0J00190 Chr10 complement(21137..23836) [2700 bp, 899 aa] {ON...    32   4.6  
NDAI0E03160 Chr5 complement(673686..676526) [2841 bp, 946 aa] {O...    32   4.6  
Suva_15.269 Chr15 complement(454630..456861,456862..457827) [319...    32   4.7  
TPHA0A02480 Chr1 (530188..531270) [1083 bp, 360 aa] {ON} Anc_3.3...    31   4.9  
TBLA0B04870 Chr2 (1146824..1148233) [1410 bp, 469 aa] {ON} Anc_8...    31   5.4  
SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} simila...    31   5.4  
KAFR0A03900 Chr1 (793680..795569) [1890 bp, 629 aa] {ON} Anc_8.6...    31   5.7  
Suva_13.55 Chr13 (84186..86879) [2694 bp, 897 aa] {ON} YML093W (...    31   6.0  
Skud_13.50 Chr13 (82470..85166) [2697 bp, 898 aa] {ON} YML093W (...    31   6.0  
KLLA0D11880g Chr4 (1013755..1014711) [957 bp, 318 aa] {ON} some ...    31   6.2  
CAGL0J06490g Chr10 (621951..622415) [465 bp, 154 aa] {ON} some s...    30   6.3  
CAGL0J09460g Chr10 complement(928455..929489) [1035 bp, 344 aa] ...    31   6.4  
TBLA0B09220 Chr2 complement(2181788..2182849) [1062 bp, 353 aa] ...    31   6.5  
NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {O...    31   6.7  
Smik_14.191 Chr14 (349918..351222) [1305 bp, 434 aa] {ON} YNL136...    31   6.9  
AFR414W Chr6 (1176836..1177654) [819 bp, 272 aa] {ON} Syntenic h...    30   7.7  
KNAG0H02100 Chr8 (377648..380104) [2457 bp, 818 aa] {ON} Anc_2.2...    31   7.9  
TPHA0D01440 Chr4 complement(296591..299176) [2586 bp, 861 aa] {O...    31   7.9  
KLTH0F06424g Chr6 (556413..557303) [891 bp, 296 aa] {ON} some si...    30   8.0  
ZYRO0D12804g Chr4 complement(1079076..1082225) [3150 bp, 1049 aa...    31   8.1  
Kwal_23.4776 s23 complement(859927..860520) [594 bp, 197 aa] {ON...    30   8.2  
NDAI0D03130 Chr4 (742587..747074) [4488 bp, 1495 aa] {ON} Anc_4....    31   8.3  
TPHA0A04960 Chr1 (1115122..1121355) [6234 bp, 2077 aa] {ON} Anc_...    31   8.5  
ZYRO0F04422g Chr6 (373261..373881) [621 bp, 206 aa] {ON} similar...    30   8.5  
ZYRO0D09592g Chr4 (815689..817227) [1539 bp, 512 aa] {ON} simila...    30   9.6  

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar to
            uniprot|Q06523 Saccharomyces cerevisiae YPR148C Protein
            of unknown function green fluorescent protein
            (GFP)-fusion protein localizes to the cytoplasm in a
            punctate pattern
          Length = 382

 Score =  687 bits (1772), Expect = 0.0
 Identities = 350/382 (91%), Positives = 350/382 (91%)
 Frame = +1

Query: 1    MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 180
            MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV
Sbjct: 1    MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 60

Query: 181  DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW 360
            DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW
Sbjct: 61   DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW 120

Query: 361  FGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDED 540
            FGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDED
Sbjct: 121  FGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDED 180

Query: 541  DVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRL 720
            DVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRL
Sbjct: 181  DVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRL 240

Query: 721  KFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKNQQXXXXXXXXXXXXXXXXXXXXXQHT 900
            KFDTMRYEMRL           TANADEGPSNKNQQ                     QHT
Sbjct: 241  KFDTMRYEMRLKEKEEKEENENTANADEGPSNKNQQEPTNEPAKEEEKPTPAEPAEAQHT 300

Query: 901  TKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQL 1080
            TKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQL
Sbjct: 301  TKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQL 360

Query: 1081 VYYRQCVQEMEASLKGLNDLEN 1146
            VYYRQCVQEMEASLKGLNDLEN
Sbjct: 361  VYYRQCVQEMEASLKGLNDLEN 382

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
            YPR148C (REAL)
          Length = 420

 Score =  391 bits (1005), Expect = e-134
 Identities = 213/423 (50%), Positives = 278/423 (65%), Gaps = 41/423 (9%)
 Frame = +1

Query: 1    MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVA--NVNLNDPQTRLSIKTRTRYLKETLG 174
            MS YFS FS   + DSIA AAH+TQD L+NA+A  NVNLNDP+TRLSIK+RTR+++E+LG
Sbjct: 1    MSGYFSGFSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLG 60

Query: 175  AVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKE 354
             V +ISKLPPQY  LE+KSD+LEK C+R+LLV++TFEVEGYDYPPNL ES SDWWS +K+
Sbjct: 61   TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120

Query: 355  GWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEK------ 516
            GWFGS K +   + K+    +  D  +PRSFAQAI+KA+ +C   +Q+ ++ EK      
Sbjct: 121  GWFGSRKSENANKKKV---SNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKK 177

Query: 517  ----------------KQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDK 648
                            ++ +EDED  NL+++F++ S CY+NIDEGK EMD ++ +EFN K
Sbjct: 178  SESNETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKK 237

Query: 649  LEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXT----------ANA 798
            LE+L+N+DFKK+H LR KVE+SRLKFDTMRYE++            T          ANA
Sbjct: 238  LEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSANA 297

Query: 799  ----DEGPSNKNQQXXXXXXXXXXXXXXXXXXXXXQHTTKTE---NSNKEPMVEKPEDNK 957
                DE P+ +++                          K +   N   EP +E  E+NK
Sbjct: 298  PISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTIEDLEENK 357

Query: 958  LLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLND 1137
            LLE+LEDEFVSNT+ AVE M  I + S+IL L+KLFQN QLVY+RQCVQE+EA+LK LN 
Sbjct: 358  LLEKLEDEFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNS 417

Query: 1138 LEN 1146
            LEN
Sbjct: 418  LEN 420

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
            Protein of unknown function that may interact with
            ribosomes, based on co-purification experiments; green
            fluorescent protein (GFP)-fusion protein localizes to the
            cytoplasm in a punctate pattern
          Length = 435

 Score =  389 bits (999), Expect = e-133
 Identities = 215/437 (49%), Positives = 275/437 (62%), Gaps = 56/437 (12%)
 Frame = +1

Query: 1    MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVAN--VNLNDPQTRLSIKTRTRYLKETLG 174
            MS YFS FS   + DSIA AAH+TQD L+NA+AN  VNLNDPQTRLSIK+RTR+++E+LG
Sbjct: 1    MSGYFSGFSLNKITDSIATAAHKTQDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 175  AVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKE 354
             V +ISKLPPQY  LE+KSD+LEK CKR+LLV++TFEVEGYDYPPNL ES SDWWS +K+
Sbjct: 61   TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 355  GWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQI--- 525
            GWFGS K +   + K     +  D  +PRSFAQAI+KA+ +C   +QN + +EK ++   
Sbjct: 121  GWFGSKKSESSTKKK---GSNHDDAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKKK 177

Query: 526  ----------------------------DEDEDDVNLVEMFNTLSICYRNIDEGKDEMDK 621
                                        ++DED  NL+++F++ S CY+NIDEGK EMD 
Sbjct: 178  KESIKTAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDS 237

Query: 622  SIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRL---------------- 753
             + +EFN KLE L+N+DFKK+H LR KVE SRLKFDTMRYE++                 
Sbjct: 238  MMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVKAKEAELEAKKAEATGEA 297

Query: 754  ---XXXXXXXXXXXTANADEGPSNKNQ----QXXXXXXXXXXXXXXXXXXXXXQHTTKTE 912
                          T + DE PS +++    +                     +   K+ 
Sbjct: 298  HSKDVSAKDISANTTTSFDETPSTEDEKPKSEGAEEESKKEANEPTVDDVADRKEDLKSN 357

Query: 913  NSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYR 1092
              N EP +E+ EDNKLLE+LEDEFVSNT+ AVETM  I + SEIL L+KLFQN QLVY+R
Sbjct: 358  KVNDEPPIEESEDNKLLEKLEDEFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFR 417

Query: 1093 QCVQEMEASLKGLNDLE 1143
            QCVQE+EA+LK LN LE
Sbjct: 418  QCVQEVEANLKVLNGLE 434

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
            YPR148C (REAL)
          Length = 427

 Score =  379 bits (973), Expect = e-129
 Identities = 211/431 (48%), Positives = 272/431 (63%), Gaps = 49/431 (11%)
 Frame = +1

Query: 1    MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVAN--VNLNDPQTRLSIKTRTRYLKETLG 174
            MS YFSSFS   + DSIA AAH+T D L+NA+AN  VNLNDPQTRLSIK+RTR+++E+LG
Sbjct: 1    MSGYFSSFSLNKITDSIATAAHKTHDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 175  AVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKE 354
             + +ISKLPPQY  LE+KSD+LEK CKR+LLV++TFEVEGYDYPPNL ES SDWWS +K+
Sbjct: 61   TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 355  GWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQI--- 525
            GWFGS K +   + K     +  D  +PRSFAQAI+KA+ +C   +QN +  EK ++   
Sbjct: 121  GWFGSKKSEITNKKK---GSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKKK 177

Query: 526  -------------------------DEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIA 630
                                     +EDED  NL+++F++ S CY+NIDEGK EMD  + 
Sbjct: 178  RESTKNAQTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDSMMV 237

Query: 631  REFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRL--------------XXXXX 768
            +EFN KLE+L+N+DFK++H LR KVE SRLKFDTMRYE++                    
Sbjct: 238  KEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHTK 297

Query: 769  XXXXXXTANADEGPS-----NKNQQXXXXXXXXXXXXXXXXXXXXXQHTTKTENSNKEPM 933
                    + +E PS      K+                       +   K +  +  P+
Sbjct: 298  DVSANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVMKEDPKDDKKDDTPL 357

Query: 934  VEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEME 1113
             E+ E+NKLLE+LEDEFVSNT+ AVETM  I + SEIL L+KLFQN QLVY+RQCVQE+E
Sbjct: 358  -EESEENKLLEKLEDEFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVE 416

Query: 1114 ASLKGLNDLEN 1146
            A+LK LN LEN
Sbjct: 417  ANLKVLNGLEN 427

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] {ON}
            Anc_3.491 YPR148C
          Length = 344

 Score =  374 bits (961), Expect = e-128
 Identities = 200/382 (52%), Positives = 259/382 (67%)
 Frame = +1

Query: 1    MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 180
            MS Y S+FS   + D++ANAAH+TQD L++A+ANV+  DPQ +LS+K RTRYL+ETLG +
Sbjct: 1    MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS--DPQAKLSLKARTRYLQETLGTI 58

Query: 181  DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW 360
            D+ SKLPPQY  LE+KSDALEK CKR+LLVT+TFEVEGYDYPPNL ES SDWWS +K+GW
Sbjct: 59   DDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGW 118

Query: 361  FGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDED 540
            FG+ K ++       +DGS  D  +PRSF+QAI+KA+++C   + N Q+   +  +EDED
Sbjct: 119  FGTKKPEKTKND--SSDGS--DAFLPRSFSQAISKAANDCNSVFTNLQEHGDED-EEDED 173

Query: 541  DVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRL 720
              N+ +MF++ S CY+NIDEGK EMD  I +EFN KLE+++N DFKK+H  R KVE SRL
Sbjct: 174  VSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEESRL 233

Query: 721  KFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKNQQXXXXXXXXXXXXXXXXXXXXXQHT 900
            KFDT+RYE++L           T NA +                                
Sbjct: 234  KFDTVRYEIKL---------KETENAKKSTET-------------------------DEA 259

Query: 901  TKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQL 1080
            +K E   +E   +  E++KLLE+LEDEFVSNT+ AVE M  + E +EIL L KLFQN QL
Sbjct: 260  SKDETKTEEEPPKTSEEDKLLEELEDEFVSNTTAAVEIMGEVTESAEILGLAKLFQNFQL 319

Query: 1081 VYYRQCVQEMEASLKGLNDLEN 1146
            VY+RQCVQE+EASLK L  LE+
Sbjct: 320  VYFRQCVQEVEASLKILGALES 341

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
            YPR148C (REAL)
          Length = 423

 Score =  374 bits (961), Expect = e-127
 Identities = 204/422 (48%), Positives = 267/422 (63%), Gaps = 49/422 (11%)
 Frame = +1

Query: 28   FKNLGDSIANAAHRTQDKLSNAVAN--VNLNDPQTRLSIKTRTRYLKETLGAVDEISKLP 201
            +  + DSIA AAH+TQD L++A+AN  VNLNDPQTRLSIK+RTR+++E+LG V +ISKLP
Sbjct: 5    WNKITDSIATAAHKTQDTLNSALANANVNLNDPQTRLSIKSRTRFVQESLGTVSDISKLP 64

Query: 202  PQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFGSTKQD 381
            PQY  LE+KSD+LEK CKR+LLV++TFEVEGYDYPPNL ES SDWWS +K+GWFGS K +
Sbjct: 65   PQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKDGWFGSKKTE 124

Query: 382  EDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQI------------ 525
               + K   D +  D  +PRSFAQAI+KA+ +C   ++N +++EK+ +            
Sbjct: 125  HASKKK---DSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNEKEDLKQKKEAKKTTQE 181

Query: 526  --------------DEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLL 663
                          ++DED  NL+++F++ S CY+NIDEGK EMD  + +EFN KLE+L+
Sbjct: 182  TAEQEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKEFNKKLEKLI 241

Query: 664  NRDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXTA-NADEGPSNKNQQXXXX 840
            N DFKK+H LR KVE SRLKFDTMRYE +            T+  AD   ++ N      
Sbjct: 242  NEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQKDETSKEADNNDNSANSTSLEE 301

Query: 841  XXXXXXXXXXXXXXXXXQ--------------------HTTKTENSNKEPMVEKPEDNKL 960
                             +                       K + +N +P VE  E+NKL
Sbjct: 302  ALTAEKKAEKEDDAKVPEEEPKKVETDVTTANDDIDTNENPKQQPTNNQPPVEDSEENKL 361

Query: 961  LEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDL 1140
            LE+LEDEFVSNT+ AVETM  I + SEIL L+KLFQN QLVY+RQC QE+EA+LK LN +
Sbjct: 362  LEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVEANLKVLNGM 421

Query: 1141 EN 1146
            EN
Sbjct: 422  EN 423

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
            YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  362 bits (929), Expect = e-123
 Identities = 195/388 (50%), Positives = 249/388 (64%), Gaps = 7/388 (1%)
 Frame = +1

Query: 1    MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 180
            MS YF  FSF  L D++ NAAH+TQD LS A+AN+ L+DPQ  LS+K R  YL+ETLG +
Sbjct: 1    MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTI 60

Query: 181  DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW 360
            ++ISKLPPQY LLE+K D+LEKAC+RML+VT+TFEVEGYDYPPNL ES SDWWS +KEG 
Sbjct: 61   EDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGL 120

Query: 361  FG---STKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAY----QNSQKSEKK 519
            FG   S+K+D+  ES      ++K  LMPRSFAQAIAKA+ + G+         Q++   
Sbjct: 121  FGLMSSSKKDKGAESA----AAAKSALMPRSFAQAIAKAAKDSGDVLAALKDQEQQASAD 176

Query: 520  QIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRN 699
            + DEDED   L++MF+  S C   ID+GK EMD  +A+EFN KL  L+   FK   VLR 
Sbjct: 177  EEDEDEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRR 236

Query: 700  KVENSRLKFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKNQQXXXXXXXXXXXXXXXXX 879
            KVE+SRLKFDTMRYE++L                   + +N++                 
Sbjct: 237  KVEDSRLKFDTMRYEVKL------------TEQQSKQAMENEKAQFKESDLSSKEEGADA 284

Query: 880  XXXXQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMK 1059
                    K+    KE         +LLE+LEDEFVSNT+EAVETM  I + +E+L L+K
Sbjct: 285  NETSNEVGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVK 344

Query: 1060 LFQNLQLVYYRQCVQEMEASLKGLNDLE 1143
            LF N QLVY+RQCVQ++EASL  LN+LE
Sbjct: 345  LFHNFQLVYHRQCVQDLEASLSTLNELE 372

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa] {ON}
            similar to uniprot|P40531 Saccharomyces cerevisiae
            YIL041W GVP36 Golgi-vesicle protein of unknown function
            green fluorescent protein (GFP)-fusion protein localizes
            to the cytoplasm
          Length = 358

 Score =  348 bits (893), Expect = e-118
 Identities = 183/385 (47%), Positives = 241/385 (62%), Gaps = 4/385 (1%)
 Frame = +1

Query: 1    MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 180
            MS YF  FS   L +SI N AH+TQD LS A+AN+ L+DPQ +LS+K R  YL+ETLG +
Sbjct: 1    MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI 60

Query: 181  DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW 360
            ++ISKLPPQY  LE+K D+LEK C+RML+VT+T+EVEGYDYPPNL ES SDWWS +KEG 
Sbjct: 61   EDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGL 120

Query: 361  FGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAY----QNSQKSEKKQID 528
            FG     +  E K++    SK+ LMPRSFAQAI+KA+ + GE         QK+  ++ +
Sbjct: 121  FGFVSSSKK-EKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAEEDE 179

Query: 529  EDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVE 708
            EDED  +L++MF   S C  N+D+ K EMD  + +EFN KL   +   FK    LR KVE
Sbjct: 180  EDEDITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVE 239

Query: 709  NSRLKFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKNQQXXXXXXXXXXXXXXXXXXXX 888
            +SRLKFDTMRYE+++               ++G + +  Q                    
Sbjct: 240  DSRLKFDTMRYELKMA-------------EEQGKTEEAAQ-----------------QTE 269

Query: 889  XQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQ 1068
             Q   + E    +      E  KLLE+LEDEFVSNT+EAVETM  I + +EI+ L+KLF 
Sbjct: 270  SQKPQEDEAEASKDSDSSDEAQKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFH 329

Query: 1069 NLQLVYYRQCVQEMEASLKGLNDLE 1143
            N QL+YY+QCVQ +E S+  LN+LE
Sbjct: 330  NFQLIYYKQCVQNLETSINSLNELE 354

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar to
            uniprot|Q06523 Saccharomyces cerevisiae YPR148C Protein
            of unknown function green fluorescent protein
            (GFP)-fusion protein localizes to the cytoplasm in a
            punctate pattern
          Length = 397

 Score =  347 bits (889), Expect = e-117
 Identities = 195/402 (48%), Positives = 255/402 (63%), Gaps = 20/402 (4%)
 Frame = +1

Query: 1    MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 180
            MS YFSSFS   L +SI++AAH+TQDKLS A+AN+ L+DPQ +LS+K R  YL+ETLGA+
Sbjct: 1    MSGYFSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAI 60

Query: 181  DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW 360
            D+ISKLPPQY  LE+K D+LEK C+RML+VT+TFEVEGYDYPPNL ES SDWW  ++ G 
Sbjct: 61   DDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGL 120

Query: 361  --FGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGE---AYQNSQKSEKKQI 525
              F   K+ E   +K + +    +  +PRSFAQA++KA+ + G+     ++ QK   +  
Sbjct: 121  LSFMDGKKGEGSRAKAE-EKDENEGFLPRSFAQALSKAAKDSGDVLRTLKDEQKEPPQDE 179

Query: 526  DEDED-DVN-LVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRN 699
            DEDED D+N L+ MF   S C + ID+ K EMD  +A+EFN KL++L+N DFKK+H LR 
Sbjct: 180  DEDEDEDINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLRK 239

Query: 700  KVENSRLKFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKNQQXXXXXXXXXXXXXXXXX 879
            KVE SRLKFDT+RYE+ L            A A E  + K                    
Sbjct: 240  KVEESRLKFDTLRYELNL-----KEKEQQKAKAKEEENEKVDVVEQNAPEEKAKTEGQET 294

Query: 880  XXXXQHTTKTENSNKEPMVEK-PE------------DNKLLEQLEDEFVSNTSEAVETMT 1020
                +H  K +    E    K PE            ++KLLE+LEDEFVS+T+EAVE M 
Sbjct: 295  SEGKEHDLKADEKLSEDTASKIPESVENEEVDNEDPEHKLLEKLEDEFVSSTTEAVEIMG 354

Query: 1021 SIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLEN 1146
             I + SEIL L+KLF   QL+Y+RQCVQE+EAS K L+ L+N
Sbjct: 355  EITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDN 396

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137 bp,
            378 aa] {ON} (27496..28272,28322..28330,28419..28769)
            [1137 nt, 379 aa]
          Length = 378

 Score =  316 bits (809), Expect = e-105
 Identities = 178/391 (45%), Positives = 241/391 (61%), Gaps = 14/391 (3%)
 Frame = +1

Query: 13   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVN------LNDPQTRLSIKTRTRYLKETLG 174
            FS FS   L DSI+N A +TQ+ L+NA++NVN      LNDP T+LSIK++ R+++E LG
Sbjct: 2    FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61

Query: 175  AV-DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSK 351
             + D+ SKLPP Y  LE K+DA+EKA KR+L VT+T+E EGYDYPPNL ES SDWW+   
Sbjct: 62   TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWTNDD 121

Query: 352  EGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQN-------SQKS 510
                  T  DE+ E+ IQ++ S     +PRSFAQAI+ AS +      +       + K 
Sbjct: 122  N----VTNTDENDEN-IQSNKS----FLPRSFAQAISNASFDAASNVNSVTNTIKLNHKD 172

Query: 511  EKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHV 690
            ++++ ++DE+  +L ++F +L  CYRNID GK EMDK I  EFN+KL+ L+N +FK +H 
Sbjct: 173  DEEEEEDDEEWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQ 232

Query: 691  LRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKNQQXXXXXXXXXXXXXX 870
            LR  VENSRLKFDTMRYE+++           T    E     +                
Sbjct: 233  LRKSVENSRLKFDTMRYELKI------KEWKRTXXXMEAEDKSDVSKKGTSKKETPKKEA 286

Query: 871  XXXXXXXQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILR 1050
                   +   K E+   E   E   DNKLLE+LEDEFVSNT  AVE M  + + S+I+ 
Sbjct: 287  SKKETPKKEINKKEDITNEGNTENDNDNKLLEKLEDEFVSNTQNAVEKMEELTDNSKIIN 346

Query: 1051 LMKLFQNLQLVYYRQCVQEMEASLKGLNDLE 1143
            L+KL+QN QLVYY+QC+QE+E++LK LN LE
Sbjct: 347  LVKLYQNFQLVYYKQCIQEIESNLKILNGLE 377

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
            YPR148C
          Length = 443

 Score =  300 bits (769), Expect = 3e-98
 Identities = 174/415 (41%), Positives = 241/415 (58%), Gaps = 35/415 (8%)
 Frame = +1

Query: 1    MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNL--NDPQTRLSIKTRTRYLKETLG 174
            MS YFS+FS   L DS+ +AA +TQD LSNA+ NVN+  NDPQTRL++ ++  YL+E++G
Sbjct: 26   MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85

Query: 175  AVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKE 354
             ++EISKLP QY  LERK+DALEK  KR+L+VT TFE+EGYDYPPNL ES S+WW     
Sbjct: 86   QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPL 145

Query: 355  GWFGSTKQDED--------GESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQN---- 498
             +        D         ++K ++D  S+   +PRSF  AI+KAS +      N    
Sbjct: 146  AFLRDNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSDSSAILTNLNNN 205

Query: 499  ------SQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQL 660
                    K+E ++ ++DED   L+++F++ S+C +NID+ K + D+ I ++FN KL  L
Sbjct: 206  EKLEFAKTKTEDEEYEDDEDIQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKLTSL 265

Query: 661  LNRDFKKIHVLRNKVENSRLKFDTMRYE--------MRLXXXXXXXXXXXTANADEGPSN 816
            L+ +FK +  LR KV+++RLKFDTMRYE        +R                DEG   
Sbjct: 266  LDVEFKNVKALRLKVQDARLKFDTMRYEIAKAAEAKVRAEENDKPVEMEKGEGEDEGEGE 325

Query: 817  KNQQXXXXXXXXXXXXXXXXXXXXXQHTTKTENSNKE---PMVEK----PEDNKLLEQLE 975
               +                           E+  K+   P  EK     ED KLLE LE
Sbjct: 326  GKGKGKGKGETASTSTETASTSTTKDAAATIESQKKDSPNPEFEKNDSQNEDEKLLEHLE 385

Query: 976  DEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDL 1140
            DEFVS+TS AVETM  I E S+IL L+KLFQN QL++Y+QC++E+E ++K L DL
Sbjct: 386  DEFVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMKLLTDL 440

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
            similarites with uniprot|Q06523 Saccharomyces cerevisiae
            YPR148C Protein of unknown function green fluorescent
            protein (GFP)-fusion protein localizes to the cytoplasm
            in a punctate pattern
          Length = 389

 Score =  296 bits (759), Expect = 2e-97
 Identities = 168/412 (40%), Positives = 249/412 (60%), Gaps = 34/412 (8%)
 Frame = +1

Query: 13   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEIS 192
            FS  S  N+ DSI+NAA RTQ++ S+A+  ++L+DP+TRLSI  R   L+ETLG V +IS
Sbjct: 2    FSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDIS 61

Query: 193  KLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFGST 372
            +LP QY  LE+KSDALEK CKR+LLVT+TFEVEGYDYPPNL ESF+DWWSG+K+  F  +
Sbjct: 62   QLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSFS 121

Query: 373  KQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECG---------EAYQNSQKSEK--- 516
            K+  +   +++   ++++ L+PRSFAQA++KA+ +           E   N ++S++   
Sbjct: 122  KKKAEVSPEVKE--TAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGAD 179

Query: 517  ------------------KQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFN 642
                              +  DEDED  NL++ F + + C  +ID+ K EMD  + +EFN
Sbjct: 180  QKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFN 239

Query: 643  DKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKN 822
             KL +L+  DFKK H LR KV+++RL FDT+R+E++L            A+++E      
Sbjct: 240  AKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKL----KLQEKEVVASSEEAEKKVA 295

Query: 823  QQXXXXXXXXXXXXXXXXXXXXXQHTTKTENSNKEPM----VEKPEDNKLLEQLEDEFVS 990
             +                        T  + +N+EP+     E+  D+KL E+LED+FVS
Sbjct: 296  TETP---------------------ETPEKKTNEEPVDMAKTEEDPDSKLFERLEDQFVS 334

Query: 991  NTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLEN 1146
             TSE VE +  + + SEI+ L+KLF N QL++Y+QCV+ +E  L+ LN L++
Sbjct: 335  ATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLDS 386

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
            Anc_3.491 YPR148C
          Length = 388

 Score =  293 bits (750), Expect = 5e-96
 Identities = 178/409 (43%), Positives = 231/409 (56%), Gaps = 32/409 (7%)
 Frame = +1

Query: 13   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVN------LNDPQTRLSIKTRTRYLKETLG 174
            FS+FS   L DSI+N A +TQ+  +NA+ ++N      LNDP T+LSI+ R+RY++E LG
Sbjct: 2    FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61

Query: 175  AVD-EISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSK 351
             +D EISKLP QYV LE K+D++EK  KR+LLVT TF  EGYDYPPNL ES SDWW+   
Sbjct: 62   TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWA--- 118

Query: 352  EGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHEC----------------- 480
                    +DE  E+K           +PRSFAQA+AKA  +                  
Sbjct: 119  --------EDETTENK---------NFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSP 161

Query: 481  ---GEAYQNSQKSEKKQID-----EDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIARE 636
               G   +N +   +++++     EDED V L + F  LS  + NID GK+EMD  I  E
Sbjct: 162  KNTGTKDENPEAGAEEEVEADDDEEDEDLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNE 221

Query: 637  FNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXTANADEGPSN 816
            FN KLE LL  +FK++  LR  VENSRLKFDTMRY+++L             + D+    
Sbjct: 222  FNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLKEAKAEQEEAKEVSTDKEIEK 281

Query: 817  KNQQXXXXXXXXXXXXXXXXXXXXXQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNT 996
            K  +                     +   K      E      ED KLLEQLEDEFVSNT
Sbjct: 282  KESETKEPETKGTEEKEPETKDTEEKDPVKENEGENED-----EDYKLLEQLEDEFVSNT 336

Query: 997  SEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLE 1143
            S AVE M  + + ++IL L+KLFQN QLVYYRQCVQE+E +LK ++DLE
Sbjct: 337  SSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLE 385

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  275 bits (703), Expect = 3e-89
 Identities = 162/395 (41%), Positives = 229/395 (57%), Gaps = 14/395 (3%)
 Frame = +1

Query: 1    MSEYFSSFSFKNLGDSIANAAHRTQDKLS-------NAVANVNLNDPQTRLSIKTRTRYL 159
            MS YF + S   L +++ NAA +TQ KLS       +A+ N+ ++DP+T LS+KTR R L
Sbjct: 1    MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60

Query: 160  KETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWW 339
            +ETLG+  +IS+LPPQY  LERK DA+E+ CK++L+V++TFEVEGYDYPPN  ES SDWW
Sbjct: 61   QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120

Query: 340  SGS-------KEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQN 498
            + S       K G  G+ KQ ED +   Q  GSS  P    +  +A   +     E  + 
Sbjct: 121  NTSTKETRFLKFGKGGTDKQKEDKQK--QAAGSSDPPSFAHALHRAAKGSQGIIQELKEQ 178

Query: 499  SQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFK 678
            +++ ++++++ DED  +L++MF T +    N+D  K EMD+ + +EFN+KL+ LL  +FK
Sbjct: 179  AEEEQEQEVEIDEDVESLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLEVEFK 238

Query: 679  KIHVLRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKNQQXXXXXXXXXX 858
            K H LR KVE SRL FDT++YE                  D   + K  +          
Sbjct: 239  KGHTLRRKVEESRLTFDTLKYEQH--------------ERDAALAKKQDE---------- 274

Query: 859  XXXXXXXXXXXQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGS 1038
                         T  T++S  +           LE  EDEFVSNT+EAVE MTSI + +
Sbjct: 275  ---AKQAEGATPSTGVTQSSTADLAFYAQ-----LEDAEDEFVSNTAEAVEFMTSIADAT 326

Query: 1039 EILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLE 1143
            +++ L+KLFQN QLVY+R+CVQE+E SL  L  LE
Sbjct: 327  KLISLVKLFQNFQLVYHRKCVQELEVSLNSLTSLE 361

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
            Ashbya gossypii AFR309C
          Length = 393

 Score =  275 bits (702), Expect = 9e-89
 Identities = 160/401 (39%), Positives = 231/401 (57%), Gaps = 21/401 (5%)
 Frame = +1

Query: 1    MSEYFSSFSFKNLGDSIANAAHRTQDKLS-------NAVANVNLNDPQTRLSIKTRTRYL 159
            MS YFS+FS   +  +I  AAH+TQ KL+       +A+ ++NL+DPQT LS++TR   L
Sbjct: 1    MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60

Query: 160  KETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWW 339
            +ETLG + +ISKLPP+Y  LERK DA EK C R+L+V++TFEV+GYDYPPNL ES SDWW
Sbjct: 61   QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120

Query: 340  SGSKE------GWFGSTKQDED-GESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQN 498
              S +      G+   +K D++  E K   +  S +  +P SFAQAI+KA+ +     + 
Sbjct: 121  GSSSKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSNEGYIPPSFAQAISKAADDSITILK- 179

Query: 499  SQKSEKKQID-------EDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQ 657
             + +E++ ++       EDED  +L+ +    +    NIDE K +MD+ +  EFN KL+ 
Sbjct: 180  -ELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDS 238

Query: 658  LLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKNQQXXX 837
            L+N DF K+  LR KVE SRLKFDT+RYE+ +               +    N   +   
Sbjct: 239  LVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDK--- 295

Query: 838  XXXXXXXXXXXXXXXXXXQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETM 1017
                               + T   +S+ E   E  +   LLE+ EDEFVSNT++AV  M
Sbjct: 296  --------ENEDNLKPTIHNNTGIGSSSDE---EDQKFRLLLEKAEDEFVSNTTDAVAYM 344

Query: 1018 TSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDL 1140
            T I +   +  L+KLF N QL+Y+++CVQE++ASL  +N L
Sbjct: 345  TQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTL 385

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] {ON}
            Anc_3.491 YPR148C
          Length = 473

 Score =  261 bits (666), Expect = 2e-82
 Identities = 170/473 (35%), Positives = 245/473 (51%), Gaps = 95/473 (20%)
 Frame = +1

Query: 13   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEIS 192
            FSSFS   + +SI NAA +  + L+NA+      DPQT+LSIK++TR  +E LG + +IS
Sbjct: 2    FSSFSLDKITNSIGNAAQKATNTLNNAINTAT--DPQTKLSIKSQTRLFQEQLGTIHDIS 59

Query: 193  KLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFGST 372
            KLP QY  LE K+D+LEK+ KR+LLV++TFE+EGYDYPPNL ESFSDWW+ +K+      
Sbjct: 60   KLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHRK 119

Query: 373  KQ-------------DEDGESKIQ--TDGSSKDPLMPRSFAQAIAKASHECGEAYQ---- 495
            KQ             D D  + ++   +  +    +PRSFAQAI+K++ +C + YQ    
Sbjct: 120  KQISVNNKKKNNTDNDHDNATNVEPIENDITSSSFLPRSFAQAISKSAMDCTDIYQQLSI 179

Query: 496  ----------------------NSQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKD 609
                                  ++ + E++  D+DED  NL++ F + S CY+NID+GK 
Sbjct: 180  QETATKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWSNCYKNIDQGKS 239

Query: 610  EMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXT 789
            EMD  + +EFN+KLE L+N +FKK++ LR KV +SRLKFDT+R+E+++            
Sbjct: 240  EMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKIKEEEQDQKEKQA 299

Query: 790  ANADEGPSNKNQQXXXXXXXXXXXXXXXXXXXXXQHTTKTENSNKEPMV----EKPEDNK 957
                +  + + +Q                           E+  KE ++    +KPE   
Sbjct: 300  QAQAQAQAQEQEQEQEQGEKAKKEQEEEQEQAQLGDNVIEESKKKEEVIKDEKKKPEIKS 359

Query: 958  LLE----QLEDEF---------VSNTS------------------------------EAV 1008
              E    QLE E          V++TS                              E V
Sbjct: 360  GTETTSKQLETEAEPKAEVEAKVNDTSKDQLKKEDDAEKQDEQDDSEEHKLLEQLEDEFV 419

Query: 1009 ETMTSIVE-------GSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLEN 1146
             +  S VE        S I+ L+KLFQN QLVYYRQCVQE+EA+LK LN+L++
Sbjct: 420  SSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLKTLNELDH 472

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar to
            uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  256 bits (653), Expect = 2e-81
 Identities = 152/367 (41%), Positives = 210/367 (57%), Gaps = 22/367 (5%)
 Frame = +1

Query: 112  NDPQTRLSIKTRTRYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVE 291
            NDP+T+LSIK +TR+L+E +G   +ISKLPPQYV+LE+K D++EK  KR+L+VT+T+E+E
Sbjct: 25   NDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEIE 84

Query: 292  GYDYPPNLPESFSDWWSGSKEGWF-------------GSTKQDEDGESKIQTDGSSKDPL 432
            GYDYPPN+ ES S WW  +KE WF             G+ ++     SK  TD       
Sbjct: 85   GYDYPPNISESLSSWWQ-TKE-WFNISELTKNVIPKHGNVEKAGTEASKTLTDKEVSHE- 141

Query: 433  MPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDE 612
             P SFA AIA+A  +    +++    E K  DE ED   LV++F   S C+  I + K E
Sbjct: 142  GPPSFASAIARAGKDSQLIFES---IETKDEDEKEDIDELVKIFKIWSDCFYEISDSKTE 198

Query: 613  MDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXT- 789
            MD+ + +EFN KLE  L ++F+KIH LR KVE SRL FDTMRYE+               
Sbjct: 199  MDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYEVAQTSKQTDSKELGNE 258

Query: 790  -----ANADEGPSNKNQQXXXXXXXXXXXXXXXXXXXXXQHTTKTENSNKEPMVEKPE-- 948
                 ++ D   +N  ++                     +     +  + E + E  +  
Sbjct: 259  DETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETKETKDTKDSEDLKEDSKTS 318

Query: 949  -DNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLK 1125
             D +LLEQLEDEFVSNT+EAVE MT + E SE+L L+KLFQ  QL Y++ CV+ +E SLK
Sbjct: 319  TDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQSLK 378

Query: 1126 GLNDLEN 1146
             LN ++N
Sbjct: 379  DLNAIDN 385

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  237 bits (604), Expect = 2e-73
 Identities = 119/261 (45%), Positives = 176/261 (67%), Gaps = 14/261 (5%)
 Frame = +1

Query: 13  FSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEIS 192
           FS+FS   + +S+A AA +T D LSNA+      DP T+LS++++ R  +E++G V +IS
Sbjct: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT--DPATKLSLRSQKRLFQESIGTVHDIS 59

Query: 193 KLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFGST 372
            LP QY  LE ++DALEK  +R+L+V++TFE+EGYDYPPNL ESFSDWWS S +      
Sbjct: 60  TLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSLSSKKKKEQE 119

Query: 373 KQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQ--------------NSQKS 510
           K+D+ G              +PRSFAQAI+ ++ +C E YQ              N+++ 
Sbjct: 120 KEDKKG-------------FLPRSFAQAISNSAEDCVEIYQHVNDGDDEDKEENANNEEE 166

Query: 511 EKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHV 690
            +++ +EDED  NL++ F++ + CY+NID+GK EMD  + +EFN KLE+LLN +FKK+H 
Sbjct: 167 NEEEDEEDEDVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEFKKVHT 226

Query: 691 LRNKVENSRLKFDTMRYEMRL 753
           LR +V++SRLKFDT+RYE+++
Sbjct: 227 LRKRVKDSRLKFDTVRYELKV 247

 Score = 93.6 bits (231), Expect = 3e-20
 Identities = 46/66 (69%), Positives = 56/66 (84%)
 Frame = +1

Query: 946  EDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLK 1125
            E++KLLEQLED FVS+T+ AVE M  I + SEI+ L+KLFQN QLVYYRQCVQE+EA+LK
Sbjct: 378  EEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLK 437

Query: 1126 GLNDLE 1143
             LN+LE
Sbjct: 438  TLNELE 443

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
            Anc_3.491 YPR148C
          Length = 415

 Score =  229 bits (585), Expect = 5e-71
 Identities = 153/448 (34%), Positives = 225/448 (50%), Gaps = 71/448 (15%)
 Frame = +1

Query: 13   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVD--E 186
            FS+F+F  + +SI+ AA   Q K+++ +      D QT+L  K   R+ +E +G +   E
Sbjct: 2    FSNFNFDKITNSISTAAQSAQQKINDTILTP---DVQTKLHFKKTARFWQEKVGQIPDKE 58

Query: 187  ISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFG 366
            ISKLP  Y+ LE K DALEK  KR+L+VT+T+E+EGYDYPPNL ES +DWW      W  
Sbjct: 59   ISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWW------WSD 112

Query: 367  STKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEK---------- 516
              K  +  E         K   M  SF  AI+KA+ +      + ++ ++          
Sbjct: 113  LKKSKKHQE---------KSSFMNNSFPMAISKAAFDSKSILDDLKEKQQDLPKEGEEPE 163

Query: 517  KQIDEDEDD--VNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHV 690
            ++++E++DD  +NL+E+FN+LS CY+NID+ K EMD  I +EFN KLE L+N DFKK+  
Sbjct: 164  EEVEEEDDDEFLNLLEVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSK 223

Query: 691  LRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKNQQXXXXXXXXXXXXXX 870
            LR KV++SRL+FDT+R+E++L              A E    +N Q              
Sbjct: 224  LRTKVQDSRLEFDTLRHEIKLKEL-----------AQESIRQENSQ-----KTDVFKEDS 267

Query: 871  XXXXXXXQHTTKTENSNKEPMVEKPEDNKLLEQ------LEDEFVSNTSEA--------- 1005
                   + +TK E  N+E   E+ E  K+ E       +E + V   +EA         
Sbjct: 268  TKEVPPKEESTKEEQVNEESNKEETEKKKITEDKPAEDVVEKKTVEEQAEAKETEKPAKE 327

Query: 1006 ------------------------------------------VETMTSIVEGSEILRLMK 1059
                                                      VE MT + E SE++ L+K
Sbjct: 328  GSSKEEAPKEDVKHNGSSEEETEEYKLLEKLEDEFVSNTGAAVELMTELTETSEVINLVK 387

Query: 1060 LFQNLQLVYYRQCVQEMEASLKGLNDLE 1143
            LFQN QL++Y+QCVQE+E ++K L+ LE
Sbjct: 388  LFQNFQLIHYKQCVQEIENNMKFLDQLE 415

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] {ON}
            Anc_3.491 YPR148C
          Length = 452

 Score =  219 bits (559), Expect = 9e-67
 Identities = 151/461 (32%), Positives = 218/461 (47%), Gaps = 84/461 (18%)
 Frame = +1

Query: 13   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV--DE 186
            FS+FS   L  +I NAA   QD + N + +    D QT+L     TRY +E +G +  DE
Sbjct: 2    FSNFSLDKLTSTITNAAQSAQDTIHNTILSP---DAQTKLQFLKTTRYFQEKVGTISEDE 58

Query: 187  ISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFG 366
            I+KLP  Y  L+ KS+A+EK  KR+L+VT+TFE+EGYDYPPN+ ES + WW+        
Sbjct: 59   IAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWN-------- 110

Query: 367  STKQDEDGESKIQTDGSSKDPLMPRSFAQAI----------------------------- 459
               +DE+ + K Q  G S   ++ RSFA AI                             
Sbjct: 111  ---EDENKKKKTQDFGDSS--ILNRSFAIAIGKAVLDSQYILSDLKEQQKTRGTEEKKVK 165

Query: 460  ----AKASHECGEAYQNSQKSEKKQIDEDEDDV-NLVEMFNTLSICYRNIDEGKDEMDKS 624
                A+A+ E  EA    Q++E ++ +E++ D+ N++  F   S CY+NID+ K EMD  
Sbjct: 166  REEEAEAAEEEDEADDGEQEAEDEEEEEEDIDMNNMISAFGLWSNCYKNIDQSKAEMDSM 225

Query: 625  IAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRL-------XXXXXXXXXX 783
            I +EFN KL  +L  DFK +H L  +V++SRL+FDT+R++++L                 
Sbjct: 226  IVKEFNQKLTDMLEIDFKTVHKLCTRVQDSRLEFDTLRHKLKLKELEKEARRQVMEEVAE 285

Query: 784  XTANADEGPSNKNQQXXXXXXXXXXXXXXXXXXXXXQHTTKTENSNK------------- 924
              A A   P  K +                           ++ S K             
Sbjct: 286  QQAEASGEPVRKRKSRAHGAQGGRKSTTEEAEKTSASENDSSKKSGKASGKSKKGKETAE 345

Query: 925  EPMVEKPEDNKLLEQLEDEFVSNTSEA----------------------------VETMT 1020
            EP  E  E     E  E+     T+ A                            VE MT
Sbjct: 346  EPQTEPKEAPPAAEAKEEPPAKETAPAKESNEAEEEENKLLERLEDEFVSNITAAVEKMT 405

Query: 1021 SIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLE 1143
             + + SE++ L+KLFQN+QLV+YRQCVQE+EAS+K L++LE
Sbjct: 406  ELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 85.9 bits (211), Expect = 7e-18
 Identities = 56/198 (28%), Positives = 86/198 (43%), Gaps = 2/198 (1%)
 Frame = +1

Query: 151 RYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFS 330
           RY++E LG   +IS++P +Y+ L  K DA++      L VTQ ++ E YDYP  + ES +
Sbjct: 37  RYMQEKLGHATDISEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKYINESIN 96

Query: 331 DW--WSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQ 504
           ++    GSK           +  S +   G SKDP         ++  S EC E      
Sbjct: 97  EFSRTVGSKIQELSHASSAHEAHSILSAPGPSKDPKTLNYALSRVSLVSSECMEHLST-- 154

Query: 505 KSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKI 684
                      DD  L       S     + + +   D  +   FN KL + ++ + K+ 
Sbjct: 155 ----------HDDALLASYLMKYSDIQSRVAQARLHQDSLVQTHFNAKLREEIDGNLKRA 204

Query: 685 HVLRNKVENSRLKFDTMR 738
           H +R  VEN RL +D  R
Sbjct: 205 HRVRRDVENKRLTYDASR 222

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 85.1 bits (209), Expect = 9e-18
 Identities = 69/257 (26%), Positives = 108/257 (42%), Gaps = 19/257 (7%)
 Frame = +1

Query: 25  SFKNLGDSIANAAHRTQDKLSNAVANVNLN----DPQTRLSIKTRT-------------R 153
           SF +  DS+         ++S       L+    D  T +S KT+              R
Sbjct: 2   SFNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQKTQDFTTQLPSLAQSTQR 61

Query: 154 YLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSD 333
            ++E LG V +IS+LP  YV LE K D ++   +  L VTQ +E E YDYP N+ +S ++
Sbjct: 62  LMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVNE 121

Query: 334 WWS--GSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQK 507
           + S  G+K           + +S + + G  KD   P++   A++K +    E    S  
Sbjct: 122 FSSIVGTKLHELSRATSTNEAQSVLISPGPHKD---PKTLNYALSKVALTSSEYLNKSPG 178

Query: 508 SEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIH 687
           +E  ++                S     I + +   D  I  +FN KL   L  D  +  
Sbjct: 179 AEDSEVSSS---------LLKYSDVQAKIAQARLHQDTLIQTKFNKKLRAALADDLNRAQ 229

Query: 688 VLRNKVENSRLKFDTMR 738
             R  VEN RL++D  R
Sbjct: 230 KARKNVENKRLQYDIAR 246

 Score = 38.9 bits (89), Expect = 0.017
 Identities = 20/57 (35%), Positives = 30/57 (52%)
 Frame = +1

Query: 961  LEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGL 1131
            +E LEDEF   T +AV  M  + E SE+L+ ++     Q  YY+Q  + +   L  L
Sbjct: 264  MESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVAAQAEYYKQSAELLSEFLPQL 320

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 85.1 bits (209), Expect = 1e-17
 Identities = 60/240 (25%), Positives = 116/240 (48%), Gaps = 8/240 (3%)
 Frame = +1

Query: 43  DSIANAAHRTQDKLSNAVAN----VNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPPQY 210
           +S  N+ ++   +LS  V+      + N P      ++  R ++E LG V +IS+LP +Y
Sbjct: 5   NSFTNSFNKRLQELSTTVSQKTQEFSTNMPDINSLAQSTQRMVQERLGQVTDISQLPEEY 64

Query: 211 VLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFGSTKQDEDG 390
           + LERK D ++      L VT TFE + YDYP    ES  ++   +       +      
Sbjct: 65  LQLERKIDTIKSVYDNFLSVTNTFEHQSYDYPNVARESVIEFSKSAVSKVEELSHATSAS 124

Query: 391 ESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNT 570
           E++     +S     P++   A++KAS        + Q +++   D+D +  +  ++ ++
Sbjct: 125 EAQQILTNNSNQIKEPKTLNYALSKAS-----LISSEQLNKQFSTDDDNNSNSDFKLVSS 179

Query: 571 LSICYRNID----EGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMR 738
           + + + +I     + + + D  I ++FN+ L   LN  F++   +R  V+N RL++D  R
Sbjct: 180 ILLKFSDIQAKIAQARLQQDLLIKQKFNNNLRNDLNTSFERAQKVRKDVQNKRLQYDVAR 239

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 82.8 bits (203), Expect = 6e-17
 Identities = 76/259 (29%), Positives = 117/259 (45%), Gaps = 21/259 (8%)
 Frame = +1

Query: 25  SFKNLGDSI--------ANAAHRTQDK--------LSNAVANVNLNDPQTRLS--IKTRT 150
           SF N  DS+        +  + R QD         LS+AV+     D  T+L    ++  
Sbjct: 2   SFNNFADSVNKKLQELSSQVSQRAQDAQLDKKFRDLSSAVSQ-RTQDLTTQLPSFAQSTQ 60

Query: 151 RYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPES-- 324
           R ++E LG V +IS+LP +YV LE K D +    +  L VTQ +E E YDYP N+ +S  
Sbjct: 61  RLVQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVRDSVN 120

Query: 325 -FSDWWSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNS 501
            FS   +G       +T  +E  +S +   G  KD   P++   A++K +    E Y N 
Sbjct: 121 EFSSVVAGKLHDLSRATSTNE-AQSVLIAPGPHKD---PKTLNYALSKVALTSSE-YLN- 174

Query: 502 QKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKK 681
                K +  D+ +V+        S     + + + + D  I   FN KL  +L  D  +
Sbjct: 175 -----KSVGGDDSEVS--NALLKYSDVQAKVAQARLQQDTLIQTRFNKKLRDILANDLNE 227

Query: 682 IHVLRNKVENSRLKFDTMR 738
               R  VE+ RL++D  R
Sbjct: 228 AQKARKNVEHKRLQYDIAR 246

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 82.8 bits (203), Expect = 6e-17
 Identities = 68/245 (27%), Positives = 112/245 (45%), Gaps = 8/245 (3%)
 Frame = +1

Query: 28  FKNLGDSIANAAHRTQ-DK----LSNAVANVNLNDPQTRLSIKTRT-RYLKETLGAVDEI 189
           F+ L  S++  A   Q DK    LS AV+    +   +  S+   T R ++E LG V +I
Sbjct: 14  FQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQRLVQERLGQVTDI 73

Query: 190 SKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWS--GSKEGWF 363
           S+LP +Y+ LE + D +    +  L VTQ +E E YDYP N+ +S +++     SK    
Sbjct: 74  SQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVNEFSKTVSSKLHEL 133

Query: 364 GSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDD 543
                 ++ ++ + + G +KD   P++   A++K +    E    S            +D
Sbjct: 134 SHASSTDEAQNILISPGPAKD---PKTLNYALSKVALTSSEYLSKS----------GHED 180

Query: 544 VNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLK 723
             +       S     I + + + D  I  +FN KL + L  D  K    R +VEN RL+
Sbjct: 181 ETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQ 240

Query: 724 FDTMR 738
           +D  R
Sbjct: 241 YDIAR 245

 Score = 36.2 bits (82), Expect = 0.12
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = +1

Query: 961  LEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYR 1092
            +E LEDEF   T +A   M  ++  SE L+ +    + QL YY+
Sbjct: 263  MESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSAQLAYYK 306

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 81.6 bits (200), Expect = 1e-16
 Identities = 69/250 (27%), Positives = 113/250 (45%), Gaps = 4/250 (1%)
 Frame = +1

Query: 1   MSEYFSSFSFK--NLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLG 174
           MS+YF SFS K   L  S++  A   Q  L     ++  N P   L   +  R L+E LG
Sbjct: 1   MSQYFDSFSKKVQELSTSVSQKAQEAQ--LDQKFKDLKTNLP---LLANSTQRMLQEKLG 55

Query: 175 AVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWS--GS 348
            V +IS+LP +YV LE + + ++   +  L VT+ +E E YDYP N+ ES  ++    G 
Sbjct: 56  QVTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFSKLVGG 115

Query: 349 KEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQID 528
           K          E  ++ + +    K+   P++   A++K +    E              
Sbjct: 116 KLHDLSKVTNREQAQNVLLSSPQMKE---PKTLNYALSKVALTSSEHV------------ 160

Query: 529 EDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVE 708
           EDE   N +  +   S     I + + + D  I  +FN  +++ L +D +     R  VE
Sbjct: 161 EDESLANFLAKY---SDSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVE 217

Query: 709 NSRLKFDTMR 738
             RL++D +R
Sbjct: 218 QKRLQYDVVR 227

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 81.3 bits (199), Expect = 2e-16
 Identities = 55/196 (28%), Positives = 90/196 (45%)
 Frame = +1

Query: 151 RYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFS 330
           R +KE LG VD+IS LP +Y+ LE K D  +   +  L +T  +E E YDYP    ES +
Sbjct: 37  RMVKEKLGQVDDISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEFSESVN 96

Query: 331 DWWSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKS 510
           ++        +       +  + + T+GSS     PR+   A++K S    E +Q     
Sbjct: 97  EFTDSIGNKMY-------EFSNGVSTEGSSGK--TPRTLNYAVSKVSMGASEQFQKL--- 144

Query: 511 EKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHV 690
                  D DD  +  +   +     +I E +   D SI  +FN +L + + +  ++   
Sbjct: 145 ------HDTDDKRIANLLTNVGNAEASIAEARLLQDHSIQAKFNFQLREEIAQSIERASK 198

Query: 691 LRNKVENSRLKFDTMR 738
            R +V + RLK+D  R
Sbjct: 199 YRKEVYHKRLKYDIAR 214

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 80.1 bits (196), Expect = 6e-16
 Identities = 63/240 (26%), Positives = 104/240 (43%), Gaps = 2/240 (0%)
 Frame = +1

Query: 25  SFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPP 204
           +F N  +S+          +S     ++ N P    S +   R ++E LG V +IS+LP 
Sbjct: 3   TFNNFTNSLNQKFQELSTAVSQRTQEISTNLPSLTQSTQ---RLVQERLGQVTDISQLPR 59

Query: 205 QYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWS--GSKEGWFGSTKQ 378
           +Y+ LERK D ++   +  L VT  +E E YDYP  + ES +D+      K         
Sbjct: 60  EYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVTESVNDFSKIVAHKVQELSHASS 119

Query: 379 DEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVE 558
             + ++ + T   +K+   PR+   A++K S            SE      D D+  +  
Sbjct: 120 ASEAQNILITPTPAKE---PRTLNYALSKVS---------LISSEYLNHIGDHDEAQVAS 167

Query: 559 MFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMR 738
           +    S     + + + + D  I   FN +L+  L  +FKK    R  VE  RL++D  R
Sbjct: 168 VLLKYSDLQAKVAQARLQQDTMIQTRFNKQLKDNLEHNFKKAQKARKDVEYKRLQYDVAR 227

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 77.8 bits (190), Expect = 3e-15
 Identities = 62/238 (26%), Positives = 106/238 (44%), Gaps = 2/238 (0%)
 Frame = +1

Query: 31  KNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPPQY 210
           K L D   + + RTQD  SN  +             +T  R ++E LG V +IS++P +Y
Sbjct: 32  KKLKDLSLSVSQRTQDLTSNLPSLA-----------QTTQRRVQERLGQVTDISQMPEEY 80

Query: 211 VLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWS--GSKEGWFGSTKQDE 384
           V LE++ D  +      L V+Q +E E YDYP ++ +S +D+      K          E
Sbjct: 81  VELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVNDFSKTVTGKVQELTKATTTE 140

Query: 385 DGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMF 564
           + +S + + G +++   P++   A++K +    E    S            DDV   ++ 
Sbjct: 141 EAQSILISPGPARN---PKTLNYALSKVALTSSEYLSKS----------GSDDVVTADIL 187

Query: 565 NTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMR 738
              S     I + + + D  I   FN +L + LN  F +    R +V+  RL++D  R
Sbjct: 188 LKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQYDIAR 245

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 75.1 bits (183), Expect = 3e-14
 Identities = 65/233 (27%), Positives = 109/233 (46%), Gaps = 4/233 (1%)
 Frame = +1

Query: 52  ANAAHRTQDKLSNAVANVNLNDPQTRLSI-KTRTRYLKETLGAVDEISKLPPQYVLLERK 228
           AN   R +D LS  V     +   T  SI +T  R ++E LG + +IS++P +YV +E++
Sbjct: 28  ANLDKRFKD-LSMTVTQKTQDLTSTLPSIAQTTHRMVQEKLGQITDISQMPEEYVHMEKR 86

Query: 229 SDALEKACKRMLLVTQTFEVEGYDYPPNLPES---FSDWWSGSKEGWFGSTKQDEDGESK 399
            D +    +  L VTQ +E E YDYP ++ ES    S   +G  +    +T   E+ ++ 
Sbjct: 87  VDKIRLIYENFLKVTQIYESETYDYPQHVSESVNEISKTVTGKIQELTKAT-STEEAQNI 145

Query: 400 IQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLSI 579
           + + G +KD   P++   A++K S    E    S            D     ++    S 
Sbjct: 146 LISPGPAKD---PKTLNYALSKVSLTSSEYLSKS----------GSDSNVTADILLKYSD 192

Query: 580 CYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMR 738
               I + + + D  I   FN +L++ LN +F      R +V+N RL++D  R
Sbjct: 193 IQAQIAQARLQQDMLIRTRFNKQLKEKLNNEFAAAARARKEVDNKRLQYDIAR 245

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 74.7 bits (182), Expect = 3e-14
 Identities = 61/238 (25%), Positives = 111/238 (46%), Gaps = 3/238 (1%)
 Frame = +1

Query: 43  DSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRT-RYLKETLGAVDEISKLPPQYVLL 219
           +S  N+  +   +LS AV+        +  ++   T R ++E LG V +IS+LP +Y+ L
Sbjct: 4   NSFTNSLSQKFQELSTAVSEKTQEFSTSIPTLAESTQRLVQEKLGNVTDISQLPQEYIEL 63

Query: 220 ERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWS--GSKEGWFGSTKQDEDGE 393
           ER+ D ++   +  L +T  +E E YDYP  + +S +D+     +K          ++ +
Sbjct: 64  ERQVDTIKLVYEHFLQITAIYENESYDYPKYVSDSVNDFSKVFANKVTELSHATSAQEAQ 123

Query: 394 SKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNTL 573
           + + T G +K+   PR+   A++K +        NS +S  +  D +E  V   +     
Sbjct: 124 NILVTPGPAKE---PRTLNYALSKVA-------LNSSESLAQLADPNEGPV--ADALLKF 171

Query: 574 SICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEM 747
           S     I + +   D  I  +FN +L + L  D  K    R  V+  RL++D  R ++
Sbjct: 172 SDVQAKIAQTRLHQDTLIQTKFNKQLREKLELDIGKASKARKDVQYKRLQYDVARSKL 229

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 73.6 bits (179), Expect = 8e-14
 Identities = 63/247 (25%), Positives = 115/247 (46%), Gaps = 2/247 (0%)
 Frame = +1

Query: 4   SEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVD 183
           +E+ +SF+ K   +   + + RTQ+ LSN +  +           ++  R ++E LG V 
Sbjct: 5   NEFTNSFT-KRFQELSTSVSQRTQE-LSNNLPTL----------AQSTQRLVQEKLGQVT 52

Query: 184 EISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDW--WSGSKEG 357
           +IS+LP +Y+ LE+K D+++   +  L VT  +E E YDYP  + +S +D+     +K  
Sbjct: 53  DISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIKDSVNDFSKTMAAKIT 112

Query: 358 WFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDE 537
                    + ++ + + G  +D   P++   A++K S    E       +     +E  
Sbjct: 113 DLSHASSASEAQNILISPGPIRD---PKTLNYALSKVSLTASEVINQVGSTP----NESA 165

Query: 538 DDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSR 717
               L+E  N  S     I + + + D  I  +FN  L   L+    K +  R +V+N R
Sbjct: 166 LSSKLLEFSNVQS----KIAQARLQQDTLIQTKFNKALRDDLSTSLAKANKFRKEVQNKR 221

Query: 718 LKFDTMR 738
           L++D  R
Sbjct: 222 LQYDVAR 228

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 71.2 bits (173), Expect = 5e-13
 Identities = 57/242 (23%), Positives = 107/242 (44%), Gaps = 6/242 (2%)
 Frame = +1

Query: 43  DSIANAAHRTQDKLSNAVAN----VNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPPQY 210
           +S AN+        SN V+     ++ N P    S +   R ++E LG V +IS+LP +Y
Sbjct: 5   NSFANSLRENLQSFSNTVSQKTHELSTNIPTLAQSTQ---RMVQEKLGQVTDISQLPQEY 61

Query: 211 VLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWS--GSKEGWFGSTKQDE 384
           + LE K D ++   +  L VT  +E E YDYP  + ES +++     +K           
Sbjct: 62  LELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAAKVQELSKATSAT 121

Query: 385 DGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMF 564
           + ++ +   G  K+   P++   A++K +    E   +S         +D  D  L ++ 
Sbjct: 122 EAQNILVAPGPVKE---PKTLNYAMSKVALNASEYLNHS--------FDDPMDAKLSKVL 170

Query: 565 NTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYE 744
              S     + + + + D  I  +FN  + + L     + +  R  V++ RL++D  R  
Sbjct: 171 LNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRLQYDVARTN 230

Query: 745 MR 750
           ++
Sbjct: 231 LQ 232

 Score = 34.7 bits (78), Expect = 0.39
 Identities = 16/58 (27%), Positives = 28/58 (48%)
 Frame = +1

Query: 961  LEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLN 1134
            +E LED+F   T +A   M  ++  +  L  +K     QL YY Q  + M+  +  ++
Sbjct: 246  METLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQSAKLMKEFISSVD 303

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 70.1 bits (170), Expect = 1e-12
 Identities = 57/243 (23%), Positives = 104/243 (42%), Gaps = 1/243 (0%)
 Frame = +1

Query: 25  SFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPP 204
           SF NL  SI  A     + +S     +    P      + + R  +E LG + +IS++P 
Sbjct: 2   SFNNLKSSIGQALQGLSESVSQKTQEMASTWPAYA---QVQQRLAQEKLGQITDISQMPR 58

Query: 205 QYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFGSTKQDE 384
           +Y+ LE + D L+ + + +L VT+ +E   YD+P +  ES  DW         GS  Q+ 
Sbjct: 59  EYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQESVQDWSRA-----IGSRVQEL 113

Query: 385 DGESKIQTDGS-SKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEM 561
              S     G+  K P+ P +  + +  A  +   A      S     + +     L+  
Sbjct: 114 SRASSASEAGNLLKSPVGPENGPRTLNYALSQASLAVSTLTSSNMPGPNGEGLSSGLIAY 173

Query: 562 FNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRY 741
            +T +     + + +   D  +  +FN +L ++LN    K +  R  V+  R+ +D  R 
Sbjct: 174 SDTQA----KLAQIRIAQDTQVQTKFNKQLREILNNPIAKANKYRKDVQYKRVLYDIART 229

Query: 742 EMR 750
            ++
Sbjct: 230 NLQ 232

 Score = 32.0 bits (71), Expect = 2.7
 Identities = 19/60 (31%), Positives = 30/60 (50%)
 Frame = +1

Query: 961  LEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDL 1140
            +E LED+F   T EA   M   +  + +L+ +     +Q  YY+Q       SL+ +NDL
Sbjct: 246  METLEDQFAQITEEATIVMQETLSNTHLLKNVAELAEIQKNYYKQ-------SLELMNDL 298

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 68.9 bits (167), Expect = 3e-12
 Identities = 59/238 (24%), Positives = 110/238 (46%), Gaps = 6/238 (2%)
 Frame = +1

Query: 43  DSIANAAHRTQDKLSNAVAN----VNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPPQY 210
           +S  N+  +T  +LS+ V+     ++ N P    S +   R ++E LG V +IS+LP +Y
Sbjct: 5   NSFTNSFSKTLSELSSTVSQKTQELSTNLPNLAQSTQ---RMVQERLGQVTDISQLPEEY 61

Query: 211 VLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDW--WSGSKEGWFGSTKQDE 384
           + LE K D++++     L V+  +E + YDYP    ES  ++   + SK           
Sbjct: 62  LELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHASSAH 121

Query: 385 DGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMF 564
           + ++ + T  SS     P++   A++K + +  E           Q +++E   +     
Sbjct: 122 EAQNILTT--SSTQIKEPKTLNFALSKVALKSSE--------HLNQFNDNEAFKSSASAL 171

Query: 565 NTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMR 738
              S     I + + + D  I ++FND L   L  +  K   +R +V++ RL++D  R
Sbjct: 172 LNFSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIAR 229

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 68.6 bits (166), Expect = 4e-12
 Identities = 49/200 (24%), Positives = 87/200 (43%)
 Frame = +1

Query: 139 KTRTRYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLP 318
           +T  R ++E LG V +IS+LP +Y+ LE++ DAL+   +  L VT  +E E YDYP  + 
Sbjct: 38  QTTQRLVQEKLGQVTDISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVR 97

Query: 319 ESFSDWWSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQN 498
           +S ++ WS +        +             +      P++   A++K       A   
Sbjct: 98  DSVNE-WSRTVATRVSELRHVSSAAEAQHVIAAPTQETEPKTLHYALSKV------ALNG 150

Query: 499 SQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFK 678
           SQ  +         +  L       S     + + + E D ++  +FN+KL   L+ +  
Sbjct: 151 SQLVDNLDAPRTPRETQLSSGLLEFSGVEAELAQARLEQDAAVKAQFNEKLRGQLSGEIA 210

Query: 679 KIHVLRNKVENSRLKFDTMR 738
           +    R +V   RL++D  R
Sbjct: 211 RAAAARKEVFQKRLQYDVAR 230

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 68.2 bits (165), Expect = 6e-12
 Identities = 50/196 (25%), Positives = 87/196 (44%)
 Frame = +1

Query: 151 RYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFS 330
           R +KE LG   +IS LP +YV LE K D +++  +  L VT  +E E YDYP    ESF 
Sbjct: 37  RLMKEKLGQAKDISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGESFW 96

Query: 331 DWWSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKS 510
           ++     E +      + + + KI           P++   A+                +
Sbjct: 97  EFTDSVGEKFSALNISEHNNKVKI-----------PKTLNYALHNVF---------LTAN 136

Query: 511 EKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHV 690
           EK ++  +  D +L E   +LS    +I E +   D  +    N +L++ L+++F++   
Sbjct: 137 EKVKLLHEPLDNSLSETLASLSETEADIAEARLHQDSLVKSRINYQLKEELSQNFERAAK 196

Query: 691 LRNKVENSRLKFDTMR 738
            R  V + R  +D  +
Sbjct: 197 YRKAVHHKRFNYDVAK 212

 Score = 33.1 bits (74), Expect = 1.2
 Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 4/70 (5%)
 Frame = +1

Query: 940  KPEDNKLLEQ----LEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQE 1107
            KPE    L      L+DEF   T +A   M  I+  S +  ++K     QLVY+++    
Sbjct: 219  KPEKQATLSAQADILKDEFEQATKDATIVMQEIISNSRLEHILKELAVSQLVYHQRSTDL 278

Query: 1108 MEASLKGLND 1137
            +   L   ND
Sbjct: 279  LNKFLDAQND 288

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 64.3 bits (155), Expect = 1e-10
 Identities = 58/234 (24%), Positives = 103/234 (44%), Gaps = 2/234 (0%)
 Frame = +1

Query: 43  DSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPPQYVLLE 222
           ++ A++  +   +LS +V+    + P    S +   R ++E LG V +IS+LP +Y  LE
Sbjct: 4   NAFASSLSKKLQELSTSVSERTQDLPNLAQSTQ---RMVQERLGQVTDISQLPREYTELE 60

Query: 223 RKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWS--GSKEGWFGSTKQDEDGES 396
            K D ++      L VT  +E   YDYP  + ES +++ S   SK             ++
Sbjct: 61  DKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSSSLASKLTELTHATSASQAQN 120

Query: 397 KIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLS 576
            +   G  K+   P++   A++K +        NS +   K    +E    L       S
Sbjct: 121 ILVAPGPIKE---PKTLNYALSKVA-------LNSSECLNKMFPTEEQP--LASSLLQFS 168

Query: 577 ICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMR 738
                I + + + D  I  +FN KL + ++ +  K    R +V + RL++D  R
Sbjct: 169 DVQAKIAQARIQQDTLIQTKFNKKLRERVSFEIGKADKCRKEVHSMRLRYDVAR 222

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 63.9 bits (154), Expect = 2e-10
 Identities = 46/203 (22%), Positives = 92/203 (45%), Gaps = 6/203 (2%)
 Frame = +1

Query: 157 LKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDW 336
           ++E  G V +IS LP +Y+ LE++ D+++      L +T  +E E YDYP ++ +S +++
Sbjct: 1   MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITEF 60

Query: 337 WSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQK--- 507
              +         +  +      + GS +      S   +I   +        N+     
Sbjct: 61  QKTASSRVQELQTKISNSSDNSHSSGSVEPMRTSVSSVGSINNYNQNSPRTLNNALSKAA 120

Query: 508 ---SEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFK 678
              +E+ ++D+D   V     F++ S     I + + + DK I + FN +L+ +L     
Sbjct: 121 LFAAEQLKMDKDSSTV-----FHSFSEAESIISDERIKQDKIIQKSFNTELKNVLTNRID 175

Query: 679 KIHVLRNKVENSRLKFDTMRYEM 747
             +  R  V+N RL++D  R ++
Sbjct: 176 VANKHRKDVQNKRLQYDISRTKL 198

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 62.8 bits (151), Expect = 3e-10
 Identities = 56/246 (22%), Positives = 108/246 (43%), Gaps = 5/246 (2%)
 Frame = +1

Query: 25  SFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPP 204
           SF +   S+          +S    ++  + P    S +   R ++E LG V +IS+LP 
Sbjct: 2   SFNDFASSLTQKFQELSTVVSERTQDLGTSIPSIASSTQ---RLVQEKLGNVTDISQLPQ 58

Query: 205 QYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWS--GSKEGWFGSTKQ 378
           +Y+ LE++ D ++   +  L +T  ++ E YDYP  + +S +D+     SK         
Sbjct: 59  EYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPKYVSDSVNDYSKLFQSKIEDLSRATS 118

Query: 379 DEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVE 558
            E+ ++ + T G   +   PR+   A++K +    E+    Q            D N+  
Sbjct: 119 AEEAQNILVTPGPITE---PRTLNYALSKVALTSSESLNQLQ------------DPNVSA 163

Query: 559 MFNTL---SICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFD 729
           + +TL   S     I + + + D  I  + N  +++ L+   +K    R  V+  RL++D
Sbjct: 164 VASTLLKFSDMQTKIAQQRLQQDTLIQTKVNKVIKEKLSSLIEKATKSRRDVQYKRLQYD 223

Query: 730 TMRYEM 747
             R ++
Sbjct: 224 VARSKL 229

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 62.4 bits (150), Expect = 4e-10
 Identities = 56/234 (23%), Positives = 101/234 (43%), Gaps = 2/234 (0%)
 Frame = +1

Query: 43  DSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPPQYVLLE 222
           ++ A++  +   ++S +V+      P    S +   R ++E LG V +IS+LP +Y  LE
Sbjct: 4   NAFASSLSKKLQEISTSVSEKTQELPSLAQSTQ---RMVQERLGQVTDISQLPREYTELE 60

Query: 223 RKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWS--GSKEGWFGSTKQDEDGES 396
            K D ++      L VT  +E   YDYP  + ES +++     SK           + ++
Sbjct: 61  EKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHATSASEAQN 120

Query: 397 KIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLS 576
            +   G  K+   P++   A++K +        NS +   K +  +E    L       S
Sbjct: 121 ILVAPGPIKE---PKTLNYALSKVA-------LNSSECLNKMLPTEEQP--LASALLQFS 168

Query: 577 ICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMR 738
                I + + + D  I  +FN  L + L+ +  K    R  V + RL++D  R
Sbjct: 169 DVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKTRKDVHSMRLRYDVAR 222

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 62.4 bits (150), Expect = 4e-10
 Identities = 58/234 (24%), Positives = 101/234 (43%), Gaps = 2/234 (0%)
 Frame = +1

Query: 43  DSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPPQYVLLE 222
           ++ A++  +   ++S +V+      P    S +   R ++E LG V +IS+LP +Y  LE
Sbjct: 4   NAFASSLSKKLQEISTSVSERTQELPNFAQSTQ---RMVQERLGQVTDISQLPREYTELE 60

Query: 223 RKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWS--GSKEGWFGSTKQDEDGES 396
            K D ++      L VT  +E   YDYP  + ES +++     SK           + ++
Sbjct: 61  DKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHATSASEAQN 120

Query: 397 KIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLS 576
            +   G  K+   P++   A++K S        NS +   K    +E    L       S
Sbjct: 121 ILVAPGPIKE---PKTLNYALSKVS-------LNSSECLNKMFPAEEQP--LASALLQFS 168

Query: 577 ICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMR 738
                I + + + D  I  +FN KL + L+ +  K    R  V + RL++D  R
Sbjct: 169 DVQAKIAQTRIQQDTLIQTKFNKKLRERLSFEIGKADKCRKDVHSMRLRYDVAR 222

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 60.8 bits (146), Expect = 1e-09
 Identities = 56/234 (23%), Positives = 100/234 (42%), Gaps = 2/234 (0%)
 Frame = +1

Query: 43  DSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPPQYVLLE 222
           ++ A++  +   ++S +V+      P    S +   R ++E LG V +IS+LP +Y  LE
Sbjct: 4   NAFASSLSKKLQEISTSVSEKTQELPSLAQSTQ---RMVQERLGQVTDISQLPREYTELE 60

Query: 223 RKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWS--GSKEGWFGSTKQDEDGES 396
            K D ++      L VT  +E   YDYP  + ES +++     SK           + ++
Sbjct: 61  DKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVNEFSRSVASKLTELTHATSASEAQN 120

Query: 397 KIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLS 576
            +   G  K+   P++   A++K +        NS +   K    +E    L       S
Sbjct: 121 ILVAPGPIKE---PKTLNYALSKVA-------LNSSECLNKMFPTEEQP--LASALLQFS 168

Query: 577 ICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMR 738
                I + + + D  I  +FN  L + L+ +  K    R  V + RL++D  R
Sbjct: 169 DVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKADKCRKDVHSMRLRYDVAR 222

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
            YFR031C
          Length = 1170

 Score = 41.2 bits (95), Expect = 0.005
 Identities = 31/128 (24%), Positives = 65/128 (50%), Gaps = 3/128 (2%)
 Frame = +1

Query: 370  TKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVN 549
            T+  E+ ESK+Q   S ++ L   +    +A+ S E  +A    +K+E+   + DE    
Sbjct: 701  TRDLEEQESKLQKTRSVRNDLNLATHKLTLAQRSLESNQAAHIIRKNEELIKEIDESQKE 760

Query: 550  LVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQL---LNRDFKKIHVLRNKVENSRL 720
            +    +++S C + I   + ++ +  + +   KL+QL   +++ FK+I +L  KVE+   
Sbjct: 761  IASKRSSISDCEKEIQRIQTDIQE-FSTDKGSKLKQLKDEVSKLFKEIGILETKVESKYD 819

Query: 721  KFDTMRYE 744
             + T + +
Sbjct: 820  SYQTFQLD 827

>TPHA0C02900 Chr3 (630971..635239) [4269 bp, 1422 aa] {ON} Anc_2.201
            YNL088W
          Length = 1422

 Score = 35.0 bits (79), Expect = 0.40
 Identities = 20/65 (30%), Positives = 36/65 (55%), Gaps = 1/65 (1%)
 Frame = +1

Query: 376  QDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAY-QNSQKSEKKQIDEDEDDVNL 552
            ++E GES I +D     PL PR+  +  A+A+    ++Y +    S+   ++E+E+D+  
Sbjct: 1358 EEESGESNIDSDVDDDIPLKPRT--KRAARATTTAKKSYTETVDLSDDSFVEEEEEDIGS 1415

Query: 553  VEMFN 567
             E FN
Sbjct: 1416 DESFN 1420

>ZYRO0G16170g Chr7 (1327801..1328277) [477 bp, 158 aa] {ON} similar
           to uniprot|P36053 Saccharomyces cerevisiae YKL160W ELF1
           Protein of unknown function deletion inhibits Brome
           mosaic virus expression
          Length = 158

 Score = 33.5 bits (75), Expect = 0.45
 Identities = 35/147 (23%), Positives = 66/147 (44%), Gaps = 5/147 (3%)
 Frame = +1

Query: 118 PQTRLSIKTRTRYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFE--VE 291
           PQ RL++K  T++          ++        L++K+      CK   +  Q+F+  + 
Sbjct: 11  PQRRLALKLDTKFNCLFCNHDKSVN------CTLDKKNSIGSLQCK---ICGQSFQTRIN 61

Query: 292 GYDYPPNLPESFSDWWSGSKE---GWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIA 462
           G   P ++   +SDW+   +E   G    +++DED +S  ++D   + P          A
Sbjct: 62  GLSQPVDV---YSDWFDAVEEVNTGRGSESEEDEDSDSDYESDSDEEKPTRG-------A 111

Query: 463 KASHECGEAYQNSQKSEKKQIDEDEDD 543
            A    G+   +S + E +Q +ED+DD
Sbjct: 112 TAGAGKGDII-DSDEEEVEQDEEDDDD 137

>Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {ON}
           YPL177C (REAL)
          Length = 295

 Score = 34.3 bits (77), Expect = 0.47
 Identities = 19/55 (34%), Positives = 32/55 (58%)
 Frame = +2

Query: 806 DLLTKINKSLPMNPLKRRKSQRLQNQLKLSILPRQKILIKNRW*KNLRITNYSNN 970
           D+LT++ +S+P    +  KS+R QN  + S LP++ + I N W     + N+ NN
Sbjct: 129 DMLTQVKRSIP--DFEDSKSKRKQNSGRRSNLPKETVQILNTW-----LLNHLNN 176

>Skud_1.42 Chr1 (90362..93742) [3381 bp, 1126 aa] {ON} YAL019W
           (REAL)
          Length = 1126

 Score = 34.7 bits (78), Expect = 0.52
 Identities = 47/217 (21%), Positives = 87/217 (40%), Gaps = 20/217 (9%)
 Frame = +1

Query: 58  AAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPPQYVLLERKSDA 237
           A+HR    L  A  + N ND      +  + +  + +  + +E  +L  +     R  +A
Sbjct: 312 ASHRPYASLG-AFIDTNFNDKDAEEGVANKRK--RRSAASANESERLLDKITQSIRGYNA 368

Query: 238 LEKACKRML----LVTQTF-----EVEGYDYPPNLPESFSDWWSGSKEGWFGSTKQDEDG 390
           +E   K+      LVT        +VEG +   NL     D          G    D+DG
Sbjct: 369 IESVIKKCSSYGDLVTSQMKKWGVQVEGDNSELNLMNLDED----------GDEDDDDDG 418

Query: 391 ESKIQT------DGSSKDPLMPRSFAQAIAKASHEC-----GEAYQNSQKSEKKQIDEDE 537
           +S          D   KD   P++  +   ++S E      G   + ++ + K Q+DE E
Sbjct: 419 DSNADAAAAAGADDIGKDKEEPKAVVEGFDESSAEPTPAPEGRETKRTRNTAKAQVDERE 478

Query: 538 DDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDK 648
           +D++L  + + L       D+ ++E +     ++ND+
Sbjct: 479 EDLDLDAIDDELPQSEHEEDDYEEEDE-----DYNDE 510

>TBLA0H00800 Chr8 (179344..180789) [1446 bp, 481 aa] {ON} Anc_8.408
           YDR200C
          Length = 481

 Score = 34.3 bits (77), Expect = 0.58
 Identities = 33/134 (24%), Positives = 64/134 (47%), Gaps = 14/134 (10%)
 Frame = +1

Query: 361 FGSTKQDEDGESKIQTDGSSKDP-LMPRSFAQAIAKASHECGEAYQ--NSQKSEKKQIDE 531
           FG     +DG++ +  D   KD  ++   F  +    S       +  N++ S    ++E
Sbjct: 236 FGDISDSQDGQADLNDDLLGKDTSILSGIFINSSTGTSPNIISMIKLLNTEIS----LEE 291

Query: 532 DEDDVNLVEM--------FNTLSICYRNIDEGKDE---MDKSIAREFNDKLEQLLNRDFK 678
            E+D  LV++         N  S+ YR+I+E +     +  SI + +N+KLE L  ++  
Sbjct: 292 YEND-KLVKLNKYLKDYRLNMKSLYYRDIEELQKNFKMVKDSITKNYNEKLETLTRKNNN 350

Query: 679 KIHVLRNKVENSRL 720
            + +LR ++E+ +L
Sbjct: 351 NLDILRAEIESLKL 364

>TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21
           YHL027W
          Length = 526

 Score = 34.3 bits (77), Expect = 0.60
 Identities = 16/43 (37%), Positives = 27/43 (62%)
 Frame = +1

Query: 484 EAYQNSQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDE 612
           E +  +QKS  K  D++ D+  LVE F+ LS+  RN ++ +D+
Sbjct: 428 EVFSTTQKSCGKMHDDENDEPALVESFSGLSVDVRNNEDDEDD 470

>Suva_4.61 Chr4 (114078..114923) [846 bp, 281 aa] {ON} YDL186W
           (REAL)
          Length = 281

 Score = 33.5 bits (75), Expect = 0.81
 Identities = 13/37 (35%), Positives = 23/37 (62%)
 Frame = +1

Query: 310 NLPESFSDWWSGSKEGWFGSTKQDEDGESKIQTDGSS 420
           ++ ESF+DWW  + + +F S + +E+ E     DG+S
Sbjct: 116 SIVESFTDWWKRNSKMFFHSEEHEEEEEGAHSEDGAS 152

>KAFR0A06420 Chr1 (1300149..1303031) [2883 bp, 960 aa] {ON}
           Anc_4.165 YLR336C
          Length = 960

 Score = 33.9 bits (76), Expect = 0.88
 Identities = 31/133 (23%), Positives = 60/133 (45%), Gaps = 5/133 (3%)
 Frame = +1

Query: 286 VEGYDYPPNLPESFSDWWSGSKEGWFGSTKQDEDGESKIQTDG-SSKDPLMPRSFAQAIA 462
           +EG D+  N   S  ++   + +    STK+D+D  S   +D     D L+  S     A
Sbjct: 275 LEGLDFFENYGASDGEYGEFALDRKKSSTKEDDDELSSDNSDEIDEADSLLESS--DGTA 332

Query: 463 KASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGK----DEMDKSIA 630
            +  +  ++ Q S + EKK I +    +   + +  + + Y +I + K    D  + +I 
Sbjct: 333 DSDSDLSDSDQYSVEEEKK-IKKKGKSIRCTQYYRRIWLVYSSIAKEKHLETDNGESAIV 391

Query: 631 REFNDKLEQLLNR 669
            E   K++ +LN+
Sbjct: 392 LEITKKVKSMLNK 404

>Smik_15.113 Chr15 (194228..195448) [1221 bp, 406 aa] {ON} YOL054W
           (REAL)
          Length = 406

 Score = 33.5 bits (75), Expect = 0.96
 Identities = 19/66 (28%), Positives = 32/66 (48%)
 Frame = +1

Query: 223 RKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFGSTKQDEDGESKI 402
           R++  L     R +++T   E EG ++  +  E  SD++  + EG+      DED +  I
Sbjct: 294 RRNLILSALNNRQVIITDDEEDEGREHTTDEEEHDSDFYEHNDEGFASGDSLDEDRKEAI 353

Query: 403 QTDGSS 420
           Q   SS
Sbjct: 354 QVQSSS 359

>Kpol_2001.32 s2001 complement(93914..95119) [1206 bp, 401 aa] {ON}
           complement(93914..95119) [1206 nt, 402 aa]
          Length = 401

 Score = 32.7 bits (73), Expect = 1.7
 Identities = 20/71 (28%), Positives = 40/71 (56%), Gaps = 1/71 (1%)
 Frame = +1

Query: 448 AQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDE-MDKS 624
           +QA++K      +  Q  ++ E+ + DE+E+ ++L  +  + S    + DE +DE  D+ 
Sbjct: 71  SQALSKKDKRKLKKQQMKEEQEQNEEDEEEETLDLNRLAESASESDDSEDEDEDEDEDEE 130

Query: 625 IAREFNDKLEQ 657
           I +E ND+ E+
Sbjct: 131 IEKEDNDEEEE 141

>TDEL0C01200 Chr3 (205482..206081) [600 bp, 199 aa] {ON} Anc_8.91
           YFR001W
          Length = 199

 Score = 32.0 bits (71), Expect = 1.9
 Identities = 17/74 (22%), Positives = 37/74 (50%)
 Frame = +1

Query: 517 KQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLR 696
           K++ +D D + L  +  T+   Y ++DE K E  + +    + K +++  ++ +K  VL 
Sbjct: 95  KKLMDDHDSLKLNRLIKTIGDKYDDLDESKLEKSRRLEEIRDLKRQEIEKKEAEKKEVLE 154

Query: 697 NKVENSRLKFDTMR 738
           +K +  + K    R
Sbjct: 155 DKKDEIKRKASVAR 168

>ZYRO0D17688g Chr4 complement(1464457..1465410) [954 bp, 317 aa]
           {ON} similar to uniprot|P53743 YNR054C Saccharomyces
           cerevisiae ESF2 Essential nucleolar protein involved in
           pre-18S rRNA processing
          Length = 317

 Score = 32.3 bits (72), Expect = 2.0
 Identities = 18/61 (29%), Positives = 29/61 (47%), Gaps = 6/61 (9%)
 Frame = +1

Query: 379 DEDGESKIQTDGSSKDPLMPRS------FAQAIAKASHECGEAYQNSQKSEKKQIDEDED 540
           D        +DG   +PL+ +S            K S E  E  ++S+K E+++ D+DED
Sbjct: 4   DHSDVDDFSSDGEESNPLLIKSDKKSQIHGDVFDKESDEEDEQSEHSEKEEEQEEDQDED 63

Query: 541 D 543
           D
Sbjct: 64  D 64

>KLLA0D05731g Chr4 complement(493687..494325) [639 bp, 212 aa] {ON}
           highly similar to uniprot|P43557 Saccharomyces
           cerevisiae YFL046W FMP32 The authentic non-tagged
           protein was localized to the mitochondria
          Length = 212

 Score = 32.0 bits (71), Expect = 2.1
 Identities = 16/39 (41%), Positives = 24/39 (61%)
 Frame = +1

Query: 634 EFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMR 750
           +F+   EQLL  D  +IH L+N+ E  R   +TMR ++R
Sbjct: 94  DFSKLREQLLTADRSEIHNLQNEHERIRKDLETMRNKLR 132

>CAGL0K01551g Chr11 (136421..139330) [2910 bp, 969 aa] {ON} highly
           similar to uniprot|Q12389 Saccharomyces cerevisiae
           YDL031w
          Length = 969

 Score = 32.3 bits (72), Expect = 2.7
 Identities = 29/96 (30%), Positives = 43/96 (44%), Gaps = 2/96 (2%)
 Frame = +1

Query: 289 EGYDYPPNLPESFSDWWSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKA 468
           E  D   NL    SD  S S +   GS   DE+ +  I+     ++P  P   A+A+ K 
Sbjct: 19  EEIDIAGNLVADGSD--SESDDSSDGS---DEEVQDVIEYSSDEEEPAKP---AKAVKKK 70

Query: 469 SHECG--EAYQNSQKSEKKQIDEDEDDVNLVEMFNT 570
             +        +  + EKK++D D+DDVN     NT
Sbjct: 71  VEDKSFPSLELSDDEDEKKKVDNDDDDVNAYFSVNT 106

>TPHA0A02680 Chr1 complement(575046..578117) [3072 bp, 1023 aa] {ON}
           Anc_1.163 YJL176C
          Length = 1023

 Score = 32.3 bits (72), Expect = 2.7
 Identities = 28/91 (30%), Positives = 44/91 (48%), Gaps = 5/91 (5%)
 Frame = +1

Query: 367 STKQDEDG-ESKIQTDG-SSKDPLMPRS---FAQAIAKASHECGEAYQNSQKSEKKQIDE 531
           + KQ+EDG E K+ T   +SK P   ++       + +      E  QN    ++++ DE
Sbjct: 414 NNKQNEDGLERKLDTYAMNSKSPNPVKNDGIIDNNVVETDANHSEEEQNKANDQEEEDDE 473

Query: 532 DEDDVNLVEMFNTLSICYRNIDEGKDEMDKS 624
           D+DD + V+MFN         +  KDE D S
Sbjct: 474 DDDDDD-VDMFN---------ENSKDEEDPS 494

>KAFR0B03285 Chr2 (683307..687806) [4500 bp, 1499 aa] {ON}
          Length = 1499

 Score = 32.3 bits (72), Expect = 2.8
 Identities = 32/134 (23%), Positives = 56/134 (41%), Gaps = 1/134 (0%)
 Frame = +1

Query: 262 LLVTQTFEVEGYDYPPNLPES-FSDWWSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMP 438
           LL    +E  G +YP   PE  F+D   G     F     D  GE ++  D         
Sbjct: 212 LLNMANYENTGEEYPQGSPEHHFADTDFGKI---FTDISHDVHGEMEMAHDFQEPSKNQT 268

Query: 439 RSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMD 618
                 +   SH+     +  ++ + ++ +EDED+++ V + +T       ++E ++E  
Sbjct: 269 SGSMFDLVPLSHDQRSEMKEQEQEQGEEEEEDEDEMSAV-LSDTSIQREELLEESENENP 327

Query: 619 KSIAREFNDKLEQL 660
              A E N + EQL
Sbjct: 328 SEEAFESNSEDEQL 341

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 32.0 bits (71), Expect = 3.6
 Identities = 33/132 (25%), Positives = 62/132 (46%), Gaps = 4/132 (3%)
 Frame = +1

Query: 340  SGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKK 519
            S  K+G     K + + +   +  G+++  L    ++Q IA    E  +  Q + +S +K
Sbjct: 973  SKQKKGKASIKKAENELKKSAKIVGNTQKDL--DLYSQEIASLK-ENADNVQQTLESVEK 1029

Query: 520  QIDEDED-DVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQ---LLNRDFKKIH 687
             +DE +D    + E  + L      ++ G  E  KS+  E NDKLE+   LL    K++ 
Sbjct: 1030 SVDEQQDLSHEMNEKLDQLKQRLAQMEAGFTEF-KSLKIEINDKLEKLNALLGHITKEVR 1088

Query: 688  VLRNKVENSRLK 723
             L + + N +++
Sbjct: 1089 QLESDLNNLKIR 1100

>CAGL0E05500g Chr5 (539213..544144) [4932 bp, 1643 aa] {ON} highly
            similar to uniprot|P10964 Saccharomyces cerevisiae
            YOR341w RPA190 DNA-directed RNA polymerase I
          Length = 1643

 Score = 32.0 bits (71), Expect = 3.7
 Identities = 43/174 (24%), Positives = 77/174 (44%), Gaps = 9/174 (5%)
 Frame = +1

Query: 184  EISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWF 363
            ++SK   Q V+ E+   +LE    +   + +  +V   D    +P++ +    G+ EG  
Sbjct: 1285 DVSKQELQTVIAEKFLRSLEAIIVKE--IKKQKKVSSSDIGMAVPKAQTTM--GAVEG-- 1338

Query: 364  GSTKQDEDGESK---------IQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEK 516
             S K DED + +         +  D   +D +     A+   K+S E  ++   S KSE 
Sbjct: 1339 SSKKMDEDNDEEQYHNKTKQAVSYDEPDEDEIETMKEAE---KSSDEELDSDMES-KSES 1394

Query: 517  KQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFK 678
               ++D++DVN+ E  + ++    N+   KD+ D+  A   N K     N D K
Sbjct: 1395 SDSEDDDEDVNMDEFESHIAEANNNM--SKDQRDRQSAIITNHKFVTKYNFDDK 1446

>KLTH0E04686g Chr5 (420873..421382) [510 bp, 169 aa] {ON} weakly
           similar to uniprot|P00127 Saccharomyces cerevisiae
           YFR033C QCR6 ubiquinol-cytochrome c oxidoreductase
           subunit 6 (17 kDa)
          Length = 169

 Score = 30.8 bits (68), Expect = 3.9
 Identities = 21/78 (26%), Positives = 40/78 (51%)
 Frame = +1

Query: 373 KQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNL 552
           K ++DGE+    +G + D     + A+A  ++  + GE  ++  + E +  DEDED+   
Sbjct: 41  KPEDDGEA---AEGEAADAESADADAEAEGESDGDEGED-EDEDEDEDEDEDEDEDEEEQ 96

Query: 553 VEMFNTLSICYRNIDEGK 606
           V+  + L    +N +E K
Sbjct: 97  VDQMDALREECKNKEEAK 114

>Skud_6.123 Chr6 complement(219525..219962) [438 bp, 145 aa] {ON}
           YFR033C (REAL)
          Length = 145

 Score = 30.4 bits (67), Expect = 4.4
 Identities = 12/42 (28%), Positives = 24/42 (57%)
 Frame = +1

Query: 481 GEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGK 606
           G+A +  +  ++ + DEDED+  + +    L   ++N +EGK
Sbjct: 49  GDAEEEDEDEDEDEDDEDEDEEAVTDQLEDLREHFKNTEEGK 90

>TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.732
           YMR216C
          Length = 659

 Score = 31.6 bits (70), Expect = 4.4
 Identities = 14/48 (29%), Positives = 24/48 (50%)
 Frame = +1

Query: 400 IQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDD 543
           I  + S++ P+M    + A+AK SH         +K E    ++D+DD
Sbjct: 6   IYKNSSTQQPVMQSQLSLALAKQSHSVNTEVSIGKKDEYNDFNDDDDD 53

>TBLA0H00610 Chr8 complement(127408..129534) [2127 bp, 708 aa] {ON}
           Anc_8.431 YDR221W
          Length = 708

 Score = 31.6 bits (70), Expect = 4.4
 Identities = 28/96 (29%), Positives = 45/96 (46%), Gaps = 3/96 (3%)
 Frame = +1

Query: 451 QAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLSI---CYRNIDEGKDEMDK 621
           Q I K S+     Y+N++      I ED     L++ FN L+     Y+N+ E  DE+  
Sbjct: 214 QDILKKSNPIFYNYENNKNFNISLIKED-----LIKYFNELAKFDQSYKNLFEILDELSH 268

Query: 622 SIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFD 729
           S ++  NDK+  +    FK I + R+  +   L  D
Sbjct: 269 SYSKSLNDKV--VNENVFKFIKITRSNKDFQDLIVD 302

>Kwal_27.11118 s27 (644020..646203) [2184 bp, 727 aa] {ON} YPL180W
           (SHD7) - Hypothetical ORF [contig 31] FULL
          Length = 727

 Score = 31.6 bits (70), Expect = 4.4
 Identities = 35/147 (23%), Positives = 63/147 (42%), Gaps = 23/147 (15%)
 Frame = +1

Query: 379 DEDGESKIQTDGSSKDPLMPRSFAQAIAKASHE--CGEAYQNSQKSEKKQ---------- 522
           DE+ ES+  + GS    L PR  +Q + + S      E  QN++ SE+            
Sbjct: 169 DEEQESRHNSQGSPLRQLQPRDTSQDLRQDSQPDYAQEQEQNAEDSEEDHTLMGSDEGTS 228

Query: 523 ----IDEDEDDVNLVEMFNTL---SICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKK 681
               +++ +DD+   +  NT+    + YR     +D+ D  I+ E     E  LN D + 
Sbjct: 229 AHNVLEQSQDDLVSKDSHNTVVNNRLSYRAPSNLRDQNDDHISNEDRIGNENDLN-DVRN 287

Query: 682 I----HVLRNKVENSRLKFDTMRYEMR 750
           +    H+  + + +  +  D +R E R
Sbjct: 288 VGGDDHIGDDHIGDDHIGGDDLRAEDR 314

>TPHA0C03160 Chr3 complement(699424..701691) [2268 bp, 755 aa] {ON}
            Anc_2.248 YNL059C
          Length = 755

 Score = 31.6 bits (70), Expect = 4.5
 Identities = 18/68 (26%), Positives = 33/68 (48%)
 Frame = +1

Query: 925  EPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQ 1104
            E MVEK E+ +   QL+++FV  + + ++++       +     K   NL+    R    
Sbjct: 317  EKMVEKQEEWEYYSQLKEQFVDQSKKQIQSILENAGFDDERDFKKYLYNLEKSLKRAQAA 376

Query: 1105 EMEASLKG 1128
            E+  SL+G
Sbjct: 377  ELSESLEG 384

>TBLA0F03120 Chr6 complement(758028..760373) [2346 bp, 781 aa] {ON}
           Anc_3.384 YBR123C
          Length = 781

 Score = 31.6 bits (70), Expect = 4.5
 Identities = 15/47 (31%), Positives = 27/47 (57%)
 Frame = +1

Query: 526 DEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLN 666
           DEDEDD N  E F+  +  +++I +   ++D  +A   ++ L  L+N
Sbjct: 728 DEDEDDTNDEEDFDVNNANFQDIIDRISKLDPQVAMRLHNNLNGLIN 774

>TDEL0B00410 Chr2 complement(74062..76611) [2550 bp, 849 aa] {ON}
           Anc_8.872 YML093W
          Length = 849

 Score = 31.6 bits (70), Expect = 4.5
 Identities = 29/108 (26%), Positives = 46/108 (42%), Gaps = 3/108 (2%)
 Frame = +1

Query: 370 TKQDEDG---ESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDED 540
           T +D DG   E+K+Q  GS  + L                  A ++S+ S   + D+DED
Sbjct: 135 TNEDSDGDRPETKLQLKGSDDEDL-----------------SAEESSESSSADEGDDDED 177

Query: 541 DVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKI 684
                  F+ +S         +DE D  +    ND L+Q  N+ +KK+
Sbjct: 178 P------FDEIS---------EDEEDVELNTITNDLLKQTENKSYKKL 210

>KNAG0J00190 Chr10 complement(21137..23836) [2700 bp, 899 aa] {ON}
            Anc_8.872 YML093W
          Length = 899

 Score = 31.6 bits (70), Expect = 4.6
 Identities = 32/136 (23%), Positives = 56/136 (41%), Gaps = 13/136 (9%)
 Frame = +1

Query: 373  KQDEDGESKIQTDGSS----KDPLMPRS---------FAQAIAKASHECGEAYQNSQKSE 513
            K++ D E  + T G++    KDP              F Q    A    G+      + E
Sbjct: 712  KKNRDEELLLDTSGATTLDLKDPFGNNKEDDGSKQFMFQQQSVIAEAFAGDNVTAEFEEE 771

Query: 514  KKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVL 693
            KK++ EDEDD         +++       G     +   R+F  K+  ++N+D +K   L
Sbjct: 772  KKRVIEDEDDKE-----EDVTLPGWGDWAGAGAKPQKKKRKFIKKVAGVVNKDKRKDKHL 826

Query: 694  RNKVENSRLKFDTMRY 741
            +N + N ++    M+Y
Sbjct: 827  QNVILNEKVNKKNMKY 842

>NDAI0E03160 Chr5 complement(673686..676526) [2841 bp, 946 aa] {ON}
           Anc_8.484
          Length = 946

 Score = 31.6 bits (70), Expect = 4.6
 Identities = 22/78 (28%), Positives = 37/78 (47%), Gaps = 1/78 (1%)
 Frame = +1

Query: 493 QNSQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRD 672
           Q  Q+ +++Q  + + +V L E  N                +KSI  + N+K+  L N +
Sbjct: 378 QQQQQQQQQQQQQQQQNVKLNEEENN---------------NKSIIEKLNEKISTLKNSN 422

Query: 673 FKKIHVLRN-KVENSRLK 723
              +H L N K+EN+ LK
Sbjct: 423 DDLLHSLENFKLENNNLK 440

>Suva_15.269 Chr15 complement(454630..456861,456862..457827) [3198 bp,
            1065 aa] {ON} YHR077C (REAL)
          Length = 1065

 Score = 31.6 bits (70), Expect = 4.7
 Identities = 18/56 (32%), Positives = 29/56 (51%)
 Frame = +1

Query: 376  QDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDD 543
            ++ED E+    D   +D  +  S    I  AS +CGE  + S+  + +  D+DEDD
Sbjct: 840  EEEDDENDDGVDLLGEDEEVETSVPD-IESASGKCGEKREESEDDDDEDDDDDEDD 894

>TPHA0A02480 Chr1 (530188..531270) [1083 bp, 360 aa] {ON} Anc_3.389
           YBR128C
          Length = 360

 Score = 31.2 bits (69), Expect = 4.9
 Identities = 19/80 (23%), Positives = 38/80 (47%)
 Frame = +1

Query: 586 RNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXX 765
           R+ D+  D  +  I +   D  +++L++  +KI +L+ K++N+R+K    +   R+    
Sbjct: 59  RHQDQNIDGNNDKIFQTNTDIEQKILSQQLEKIDILKMKMKNNRIKIRIKQISERIYNRA 118

Query: 766 XXXXXXXTANADEGPSNKNQ 825
                  T    + PSN  Q
Sbjct: 119 KLLKEKETNYLKKIPSNAKQ 138

>TBLA0B04870 Chr2 (1146824..1148233) [1410 bp, 469 aa] {ON} Anc_8.85
           YPL004C
          Length = 469

 Score = 31.2 bits (69), Expect = 5.4
 Identities = 38/180 (21%), Positives = 81/180 (45%), Gaps = 7/180 (3%)
 Frame = +1

Query: 25  SFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQT---RLSIKTRTRYLKETLGAVDEISK 195
           S +N+  S+    +R +DK++NA+AN+   DPQ+   R   +   R   E+L A  ++S 
Sbjct: 131 SIRNIEASVQPTRYR-KDKITNAIANLKYRDPQSTKIRGLEQELVRAEAESLVAEAQLSN 189

Query: 196 L--PPQYVLLERKSDALEKACKRMLLVTQTFE--VEGYDYPPNLPESFSDWWSGSKEGWF 363
           +           K D+L +  ++  L+    +  +E  D  P  P         + +G+ 
Sbjct: 190 ITRDKMKAAFNYKFDSLREMSEKFALIAGYGKALLELLDDSPVTPGETRP----AYDGYE 245

Query: 364 GSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDD 543
            ST+   D E+ +++       + P       A+  +E   + ++    E+++ +E+E++
Sbjct: 246 ASTQIIMDAENALESWTLDVAEIKPTLSFYQTAEDVYEDVPSEEDEDALEQEEEEEEEEE 305

>SAKL0F02552g Chr6 (219380..220816) [1437 bp, 478 aa] {ON} similar
           to uniprot|Q06525 Saccharomyces cerevisiae YPR152C
           Hypothetical ORF
          Length = 478

 Score = 31.2 bits (69), Expect = 5.4
 Identities = 21/65 (32%), Positives = 35/65 (53%), Gaps = 2/65 (3%)
 Frame = +1

Query: 364 GSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDED--E 537
           GS+++D   +   +T  +SKD +   +  +  A    E  EA Q  ++ EKK+++ED   
Sbjct: 261 GSSRKDLFEQWCTETIANSKDAISDANINENDADQRQE-SEATQKEEQEEKKEVEEDGEP 319

Query: 538 DDVNL 552
           DD NL
Sbjct: 320 DDENL 324

>KAFR0A03900 Chr1 (793680..795569) [1890 bp, 629 aa] {ON} Anc_8.685
           YPL161C
          Length = 629

 Score = 31.2 bits (69), Expect = 5.7
 Identities = 20/88 (22%), Positives = 45/88 (51%)
 Frame = +1

Query: 457 IAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIARE 636
           IA A+ E  E  +  +++ ++  +E+E+D N   +++   +   ++   K E+D SI   
Sbjct: 233 IAVANSEDMELNEEIEENTEEGEEEEEEDPNTELLYDFTQMLEMSVSNEKVELDFSI--- 289

Query: 637 FNDKLEQLLNRDFKKIHVLRNKVENSRL 720
           + D + ++ NR    + +L  K   ++L
Sbjct: 290 YPDSVTKIQNRLLNSLEILSPKAFQNKL 317

>Suva_13.55 Chr13 (84186..86879) [2694 bp, 897 aa] {ON} YML093W
           (REAL)
          Length = 897

 Score = 31.2 bits (69), Expect = 6.0
 Identities = 22/80 (27%), Positives = 42/80 (52%)
 Frame = +1

Query: 505 KSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKI 684
           + EKK++ +DEDD    E+  TL         G    +K   R+F  K++ ++N+D +K 
Sbjct: 767 EQEKKRVIDDEDDK---EVDTTLPGWGEWAGVGSKPKNKR--RKFIKKVKGVVNKDKRKD 821

Query: 685 HVLRNKVENSRLKFDTMRYE 744
             L+N + N ++    ++Y+
Sbjct: 822 KSLQNVIINEKVNKKNLKYQ 841

>Skud_13.50 Chr13 (82470..85166) [2697 bp, 898 aa] {ON} YML093W
           (REAL)
          Length = 898

 Score = 31.2 bits (69), Expect = 6.0
 Identities = 22/80 (27%), Positives = 42/80 (52%)
 Frame = +1

Query: 505 KSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKI 684
           + EKK++ +DEDD    E+  TL         G    +K   R+F  K++ ++N+D +K 
Sbjct: 768 QEEKKRVIDDEDDK---EVDTTLPGWGEWAGAGAKSKNKR--RKFVKKVKGVVNKDKRKD 822

Query: 685 HVLRNKVENSRLKFDTMRYE 744
             L+N + N ++    ++Y+
Sbjct: 823 KHLQNVIINEKVNKKNLKYQ 842

>KLLA0D11880g Chr4 (1013755..1014711) [957 bp, 318 aa] {ON} some
           similarities with uniprot|Q03080 Saccharomyces
           cerevisiae YPL039W Hypothetical ORF
          Length = 318

 Score = 30.8 bits (68), Expect = 6.2
 Identities = 21/70 (30%), Positives = 34/70 (48%), Gaps = 1/70 (1%)
 Frame = +1

Query: 469 SHECGEAYQNSQKSEKKQIDEDEDDVNLVEM-FNTLSICYRNIDEGKDEMDKSIAREFND 645
           ++E   A QN+  S +  I      VN+    F T + CY N D+ +  +  S    FN+
Sbjct: 246 ANESNHASQNNTASMRGSI-ATRTTVNIRSTDFGTFTNCYTNQDDQETYLTPSDYESFNE 304

Query: 646 KLEQLLNRDF 675
             +Q++NR F
Sbjct: 305 MGKQMVNRTF 314

>CAGL0J06490g Chr10 (621951..622415) [465 bp, 154 aa] {ON} some
           similarities with uniprot|P38428 Saccharomyces
           cerevisiae YMR264w CUE1 or uniprot|Q04201 Saccharomyces
           cerevisiae YML101c
          Length = 154

 Score = 30.0 bits (66), Expect = 6.3
 Identities = 27/94 (28%), Positives = 42/94 (44%)
 Frame = +1

Query: 145 RTRYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPES 324
           R R  + T G ++ +S L P   + + K D LEK     L V +  + E +++PP   ES
Sbjct: 60  RRRKRRVTEGMIEIVSTLAPHLDVEQIKYD-LEKTGSVELTVERLLKGEEFEFPPKEDES 118

Query: 325 FSDWWSGSKEGWFGSTKQDEDGESKIQTDGSSKD 426
            +   S S E      + +ED      T+  S D
Sbjct: 119 STANNSKSNE----EPQNEEDYYEDYHTETDSSD 148

>CAGL0J09460g Chr10 complement(928455..929489) [1035 bp, 344 aa]
           {ON} similar to uniprot|P40507 Saccharomyces cerevisiae
           YIL079c and similar to uniprot|Q12476 Saccharomyces
           cerevisiae YDL175c
          Length = 344

 Score = 30.8 bits (68), Expect = 6.4
 Identities = 37/149 (24%), Positives = 60/149 (40%), Gaps = 3/149 (2%)
 Frame = +1

Query: 88  NAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLL 267
           +A A  NL D       + RT+Y K          KL  +     RK+++  K   +   
Sbjct: 200 SAFAGNNLRD-------ELRTKYYK----------KLDQERGKKGRKNNSKVKGNHKRFD 242

Query: 268 VTQTFEVEGYDYPPNLPESFSDWWSGSK--EGWFGSTKQDEDGESKIQTDGSSKDPL-MP 438
               F  + Y+Y     +S  D W  S+    + GSTK+    + + + + S +DPL  P
Sbjct: 243 DNNNFNYDDYEYD----DSIYDEWDNSQLDRKYSGSTKKKNTNKKQKKNNNSHRDPLEFP 298

Query: 439 RSFAQAIAKASHECGEAYQNSQKSEKKQI 525
           RS        S   G   +N  K++ K +
Sbjct: 299 RSKRNDFNDNSKR-GNFSRNDDKAKAKNM 326

>TBLA0B09220 Chr2 complement(2181788..2182849) [1062 bp, 353 aa] {ON}
            Anc_2.392 YDL078C
          Length = 353

 Score = 30.8 bits (68), Expect = 6.5
 Identities = 14/49 (28%), Positives = 26/49 (53%)
 Frame = +1

Query: 988  SNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLN 1134
            SN S     +  I  G+E   L++ +  L++ Y+   V+ M  ++KG+N
Sbjct: 263  SNVSSCFVYLNGITNGAEAQELIRKYTGLKVEYFALPVELMNGTVKGIN 311

>NCAS0B00990 Chr2 complement(154925..156103) [1179 bp, 392 aa] {ON}
           Anc_8.808 YOL054W
          Length = 392

 Score = 30.8 bits (68), Expect = 6.7
 Identities = 25/95 (26%), Positives = 39/95 (41%)
 Frame = +1

Query: 319 ESFSDWWSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQN 498
           ES S++ S   +G   +T  D + E   + DG S++       A  +     +  E+  N
Sbjct: 242 ESESEYDSHLNQGRNTNTIYDNEAEDDEENDGYSQEESRSEDDASDLNSFIEDDPESEDN 301

Query: 499 SQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEG 603
                   ID+D DD +  E  N+      N DEG
Sbjct: 302 EDGVTPMVIDDDADDAHSAEEHNS-DYYEHNDDEG 335

>Smik_14.191 Chr14 (349918..351222) [1305 bp, 434 aa] {ON} YNL136W
           (REAL)
          Length = 434

 Score = 30.8 bits (68), Expect = 6.9
 Identities = 31/125 (24%), Positives = 59/125 (47%), Gaps = 11/125 (8%)
 Frame = +1

Query: 376 QDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDE----DD 543
           +DE+ E+K + DG  ++ +  +   Q   K   E  E  Q  +++ K ++DE+     +D
Sbjct: 256 EDEERENKGEEDGKEENRIEGKEEEQKEEKERKEQIEEVQKMKENPKDEMDEENHRNGED 315

Query: 544 VNLVEMFNTLSICYRNIDEGK-DEMDKSIA------REFNDKLEQLLNRDFKKIHVLRNK 702
            N  E     S  Y N +  + +E+D+++       R+ ++K  +L   + KK      K
Sbjct: 316 YNEREK----STSYENSNGSESEEVDEALGYESERERDLSEKTPELGRDNSKK------K 365

Query: 703 VENSR 717
           VEN +
Sbjct: 366 VENKK 370

>AFR414W Chr6 (1176836..1177654) [819 bp, 272 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YJR060W (CBF1)
          Length = 272

 Score = 30.4 bits (67), Expect = 7.7
 Identities = 12/28 (42%), Positives = 22/28 (78%)
 Frame = +1

Query: 640 NDKLEQLLNRDFKKIHVLRNKVENSRLK 723
           N+KLE+ LN  FK+I  L+NK++++ ++
Sbjct: 244 NEKLEEELNNAFKEIETLKNKLKSAGIE 271

>KNAG0H02100 Chr8 (377648..380104) [2457 bp, 818 aa] {ON} Anc_2.273
           YNL041C
          Length = 818

 Score = 30.8 bits (68), Expect = 7.9
 Identities = 24/75 (32%), Positives = 39/75 (52%), Gaps = 7/75 (9%)
 Frame = +1

Query: 79  KLSNAVANVNLNDPQTRLSIKTRTRY---LKETLGAVDEISKLPPQYV-LLERK---SDA 237
           KLSN + N NLN+ Q+ L ++   +    L+ T  ++D  S + P YV  L RK   +D 
Sbjct: 130 KLSNVLNNFNLNNYQSALKLRNALKLLENLQNTGLSLDRESLITPDYVGTLSRKNLRNDL 189

Query: 238 LEKACKRMLLVTQTF 282
             +  K  ++V + F
Sbjct: 190 ETELLKEHIIVLEEF 204

>TPHA0D01440 Chr4 complement(296591..299176) [2586 bp, 861 aa] {ON}
           Anc_8.704 YPL174C
          Length = 861

 Score = 30.8 bits (68), Expect = 7.9
 Identities = 19/58 (32%), Positives = 27/58 (46%), Gaps = 1/58 (1%)
 Frame = +1

Query: 25  SFKNLGDSIANAAHRTQD-KLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEISK 195
           S KNL   I +        KL N  +N+ + D QTRL  +   +Y K  L  +D + K
Sbjct: 690 SLKNLMSQIESLKEEKNTLKLMNEKSNIEITDLQTRLEEEQLNKYFKIKLPGLDSLIK 747

>KLTH0F06424g Chr6 (556413..557303) [891 bp, 296 aa] {ON} some
           similarities with uniprot|P32447 Saccharomyces
           cerevisiae YJL115W ASF1 Nucleosome assembly factor
           involved in chromatin assembly after DNA replication
           anti- silencing protein that causes derepression of
           silent loci when overexpressed
          Length = 296

 Score = 30.4 bits (67), Expect = 8.0
 Identities = 21/91 (23%), Positives = 37/91 (40%)
 Frame = +1

Query: 289 EGYDYPPNLPESFSDWWSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKA 468
           +G +YPP  PE   +      E      +Q+ED E     +    +      +    A  
Sbjct: 157 QGEEYPPEQPELEEEEEDDEDE------EQEEDDEDDNDIEEEDDEEEKAPGYESKEASE 210

Query: 469 SHECGEAYQNSQKSEKKQIDEDEDDVNLVEM 561
           S +  E    ++K + K  DEDED+   +++
Sbjct: 211 SKDEKEEGPEAKKRKLKAEDEDEDEAEEIDL 241

>ZYRO0D12804g Chr4 complement(1079076..1082225) [3150 bp, 1049 aa]
           {ON} similar to uniprot|P27692 YML010W Saccharomyces
           cerevisiae SPT5 Protein that forms a complex with Spt4p
           and mediates both activation and inhibition of
           transcription elongation
          Length = 1049

 Score = 30.8 bits (68), Expect = 8.1
 Identities = 36/139 (25%), Positives = 59/139 (42%), Gaps = 3/139 (2%)
 Frame = +1

Query: 274 QTFEVEG-YDYPPNLPESFSDWWSGSKEGWFGSTKQDEDGESKIQTD-GSSKDPLMPRSF 447
           Q  E +G +  P    E  +D  +G + G       D+D E +   D G SK     R+ 
Sbjct: 113 QQEEAQGSHKRPREEAEGENDDENGDENGEDDDDDDDDDDEDEDDEDEGPSKKRRRERNK 172

Query: 448 AQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLV-EMFNTLSICYRNIDEGKDEMDKS 624
              I             ++ S+ ++ DEDE+D  LV E F         I  G DE +++
Sbjct: 173 FLDI------------EAEVSDDEEEDEDEEDSELVREGF---------ITRGDDEEEEA 211

Query: 625 IAREFNDKLEQLLNRDFKK 681
              + +D+L + L++D  K
Sbjct: 212 AGAQRDDRLHRQLDQDLNK 230

>Kwal_23.4776 s23 complement(859927..860520) [594 bp, 197 aa] {ON}
           YIL127C - Hypothetical ORF [contig 5] FULL
          Length = 197

 Score = 30.0 bits (66), Expect = 8.2
 Identities = 19/80 (23%), Positives = 35/80 (43%)
 Frame = +1

Query: 364 GSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDD 543
           GSTK DE+   ++     SK  L+  +  +A+     +     +  Q+S +KQI   +  
Sbjct: 23  GSTKIDENSSKRLSRTKGSKAQLINANLKKAVKVRESDAHGIKKREQRSRRKQIRARQVR 82

Query: 544 VNLVEMFNTLSICYRNIDEG 603
            +       L I  ++ +EG
Sbjct: 83  EDEANQLAKLEILKKHREEG 102

>NDAI0D03130 Chr4 (742587..747074) [4488 bp, 1495 aa] {ON} Anc_4.340
          Length = 1495

 Score = 30.8 bits (68), Expect = 8.3
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 11/64 (17%)
 Frame = +1

Query: 52   ANAAHRTQDKLSNAVANVNLNDPQTR----LSIK-------TRTRYLKETLGAVDEISKL 198
            A A H+     S  +A VNL DPQ +    L++K        +  Y KE L  + ++ ++
Sbjct: 1430 AVAHHKLSKDKSLGIAQVNLGDPQIQKDENLALKLNDGHVIIKLDYAKEALENIPDVPQI 1489

Query: 199  PPQY 210
            P QY
Sbjct: 1490 PEQY 1493

>TPHA0A04960 Chr1 (1115122..1121355) [6234 bp, 2077 aa] {ON}
           Anc_5.113 YGR217W
          Length = 2077

 Score = 30.8 bits (68), Expect = 8.5
 Identities = 21/68 (30%), Positives = 34/68 (50%), Gaps = 8/68 (11%)
 Frame = -3

Query: 499 NFDKLHHTHEMPWLSLVQMNVALMDP*RIHRFGSSILHLHP--------VLLIQTILLYY 344
           NFD     +E   L L   ++A+     + R+  + LH++P        +L+I TILL Y
Sbjct: 317 NFDDFFDKNEYNHLRLYGHSLAIFSETNLLRYRLAKLHVNPKYKLLYYMLLIIFTILLSY 376

Query: 343 QTTNLRNF 320
           +T N  N+
Sbjct: 377 RTYNPTNY 384

>ZYRO0F04422g Chr6 (373261..373881) [621 bp, 206 aa] {ON} similar to
           uniprot|P43586 Saccharomyces cerevisiae YFR001W LOC1
           Nuclear protein involved in asymmetric localization of
           ASH1 mRNA binds double-stranded RNA in vitro
          Length = 206

 Score = 30.0 bits (66), Expect = 8.5
 Identities = 22/82 (26%), Positives = 38/82 (46%)
 Frame = +1

Query: 505 KSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKI 684
           K  KK ID D D + L  +  T+   Y +IDE K E  + +      + +++  ++  K 
Sbjct: 95  KKGKKFID-DHDHLKLNLLLKTIGDKYDDIDESKLEKARRLEEIREMRRQEIEKKESSKN 153

Query: 685 HVLRNKVENSRLKFDTMRYEMR 750
            VL++K    + K    R + R
Sbjct: 154 EVLQDKKAELKRKASVARTQRR 175

>ZYRO0D09592g Chr4 (815689..817227) [1539 bp, 512 aa] {ON} similar
           to uniprot|P40010 Saccharomyces cerevisiae YER006W NUG1
           GTPase that associates with nuclear 60S pre- ribosomes
           required for export of 60S ribosomal subunits from the
           nucleus
          Length = 512

 Score = 30.4 bits (67), Expect = 9.6
 Identities = 19/66 (28%), Positives = 38/66 (57%)
 Frame = +1

Query: 454 AIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAR 633
           A+ +++    E Y+++   E   +DED+D+++++   N     Y + +EG  E+DKS  R
Sbjct: 113 ALVESAQHAAEEYEDAN-GEPDAMDEDDDNLDVI---NYNVDFYGDSEEGDSELDKS--R 166

Query: 634 EFNDKL 651
           +  DK+
Sbjct: 167 KAYDKI 172

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.128    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 93,922,147
Number of extensions: 1952561
Number of successful extensions: 8206
Number of sequences better than 10.0: 95
Number of HSP's gapped: 8088
Number of HSP's successfully gapped: 116
Length of query: 383
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 272
Effective length of database: 40,753,473
Effective search space: 11084944656
Effective search space used: 11084944656
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.4 bits)
S2: 34 (17.7 bits)