Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D10010g3.491ON38238218450.0
Skud_16.4433.491ON42042310161e-136
Suva_16.4773.491ON4234319631e-128
YPR148C3.491ON4354379311e-122
Smik_16.4013.491ON4274319241e-122
Kwal_55.212273.491ON3763899041e-119
TDEL0D055903.491ON3443858981e-119
KLTH0F14806g3.491ON3583858841e-117
SAKL0F02794g3.491ON3974038771e-115
Kpol_1017.73.491ON3783917931e-102
KLLA0E04621g3.491ON3894127452e-95
TPHA0D032703.491ON3884097234e-92
Ecym_12383.491ON3934047053e-89
AFR309C3.491ON3644006963e-88
CAGL0L08492g3.491ON3853706392e-79
NDAI0B058503.491ON4732895913e-71
NCAS0F035403.491ON4442615797e-70
TBLA0D029803.491ON4432725735e-69
KAFR0G036803.491ON4152614835e-56
KNAG0A079303.491ON4521543081e-30
ZYRO0D16522g7.221ON3582062063e-17
KLTH0A03894g7.221ON3232631955e-16
Kwal_47.181487.221ON3232571948e-16
Kpol_478.227.221ON3501981941e-15
KLLA0E04511g7.221ON3022501883e-15
SAKL0F08162g7.221ON3302451894e-15
NDAI0A026607.221ON3642051895e-15
TDEL0H022407.221ON3382401851e-14
ADL115W7.221ON3332391806e-14
Ecym_43777.221ON3332041771e-13
KAFR0I019507.221ON3302481743e-13
Kpol_1070.197.221ON3112011691e-12
KNAG0D017607.221ON3422001567e-11
CAGL0L00891g7.221ON3412381541e-10
TPHA0B027507.221ON3631961542e-10
TBLA0D042007.221ON3312441522e-10
NCAS0A133807.221ON3292381487e-10
Suva_9.1597.221ON3251981381e-08
Skud_9.1287.221ON3291981381e-08
TBLA0B015807.221ON3862121363e-08
Smik_9.1507.221ON3261981353e-08
TPHA0C012307.221ON3052121344e-08
YIL041W (GVP36)7.221ON3261981327e-08
TDEL0F017606.175ON709119703.9
NDAI0D031304.340ON149564686.9
TPHA0F002604.21ON52643677.8
TBLA0B048708.85ON46949678.2
TDEL0H026107.186ON1170126678.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D10010g
         (382 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} simila...   715   0.0  
Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {...   395   e-136
Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {...   375   e-128
YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON} ...   363   e-122
Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {...   360   e-122
Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {...   352   e-119
TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa] ...   350   e-119
KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]...   345   e-117
SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} simila...   342   e-115
Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137...   310   e-102
KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some s...   291   2e-95
TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {O...   283   4e-92
Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar t...   276   3e-89
AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}...   272   3e-88
CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} simil...   250   2e-79
NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa] ...   232   3e-71
NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {O...   227   7e-70
TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.4...   225   5e-69
KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {O...   190   5e-56
KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa] ...   123   1e-30
ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]...    84   3e-17
KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {O...    80   5e-16
Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {O...    79   8e-16
Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON} (67833..6...    79   1e-15
KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {O...    77   3e-15
SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {O...    77   4e-15
NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221     77   5e-15
TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.2...    76   1e-14
ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic ho...    74   6e-14
Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}...    73   1e-13
KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.22...    72   3e-13
Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON} (45405.....    70   1e-12
KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.2...    65   7e-11
CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} simil...    64   1e-10
TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.2...    64   2e-10
TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7....    63   2e-10
NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {...    62   7e-10
Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W (...    58   1e-08
Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W (...    58   1e-08
TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.2...    57   3e-08
Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W (...    57   3e-08
TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.22...    56   4e-08
YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR do...    55   7e-08
TDEL0F01760 Chr6 complement(328784..330913) [2130 bp, 709 aa] {O...    32   3.9  
NDAI0D03130 Chr4 (742587..747074) [4488 bp, 1495 aa] {ON} Anc_4....    31   6.9  
TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21 ...    30   7.8  
TBLA0B04870 Chr2 (1146824..1148233) [1410 bp, 469 aa] {ON} Anc_8...    30   8.2  
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....    30   8.9  

>ZYRO0D10010g Chr4 (845993..847141) [1149 bp, 382 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 382

 Score =  715 bits (1845), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/382 (91%), Positives = 350/382 (91%)

Query: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 60
           MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV
Sbjct: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 60

Query: 61  DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW 120
           DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW
Sbjct: 61  DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW 120

Query: 121 FGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDED 180
           FGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDED
Sbjct: 121 FGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDED 180

Query: 181 DVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRL 240
           DVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRL
Sbjct: 181 DVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRL 240

Query: 241 KFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKNQQXXXXXXXXXXXXXXXXXXXXXQHT 300
           KFDTMRYEMRL           TANADEGPSNKNQQ                     QHT
Sbjct: 241 KFDTMRYEMRLKEKEEKEENENTANADEGPSNKNQQEPTNEPAKEEEKPTPAEPAEAQHT 300

Query: 301 TKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQL 360
           TKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQL
Sbjct: 301 TKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQL 360

Query: 361 VYYRQCVQEMEASLKGLNDLEN 382
           VYYRQCVQEMEASLKGLNDLEN
Sbjct: 361 VYYRQCVQEMEASLKGLNDLEN 382

>Skud_16.443 Chr16 complement(780561..781823) [1263 bp, 420 aa] {ON}
           YPR148C (REAL)
          Length = 420

 Score =  395 bits (1016), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 209/423 (49%), Positives = 274/423 (64%), Gaps = 44/423 (10%)

Query: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVA--NVNLNDPQTRLSIKTRTRYLKETLG 58
           MS YFS FS   + DSIA AAH+TQD L+NA+A  NVNLNDP+TRLSIK+RTR+++E+LG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALASANVNLNDPETRLSIKSRTRFVQESLG 60

Query: 59  AVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKE 118
            V +ISKLPPQY  LE+KSD+LEK C+R+LLV++TFEVEGYDYPPNL ES SDWWS +K+
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCRRILLVSKTFEVEGYDYPPNLTESISDWWSVNKD 120

Query: 119 GWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDED 178
           GWFGS K +   + K+    +  D  +PRSFAQAI+KA+ +C   +Q+ ++ EK  + + 
Sbjct: 121 GWFGSRKSENANKKKV---SNHDDAFLPRSFAQAISKAAVDCECEFQSLKQDEKAGLKKK 177

Query: 179 EDD----------------------VNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDK 216
            +                        NL+++F++ S CY+NIDEGK EMD ++ +EFN K
Sbjct: 178 SESNETAQDAEAQEEDEEDEEDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSTMIKEFNKK 237

Query: 217 LEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXT----------ANA 266
           LE+L+N+DFKK+H LR KVE+SRLKFDTMRYE++            T          ANA
Sbjct: 238 LEKLINKDFKKVHELRKKVEDSRLKFDTMRYEVKSKEAKLKAQKAETSKEVDDKAVSANA 297

Query: 267 ----DEGPSNKNQQXXXXXXXXXXXXXXXXXXXXXQHTTKTE---NSNKEPMVEKPEDNK 319
               DE P+ +++                          K +   N   EP +E  E+NK
Sbjct: 298 PISPDENPTTEDESPISKDLEGDSKKETSGSAADDAAVVKEDSKANQGDEPTIEDLEENK 357

Query: 320 LLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLND 379
           LLE+LEDEFVSNT+ AVE M  I + S+IL L+KLFQN QLVY+RQCVQE+EA+LK LN 
Sbjct: 358 LLEKLEDEFVSNTTTAVEIMEEITDSSDILGLVKLFQNFQLVYFRQCVQEVEANLKVLNS 417

Query: 380 LEN 382
           LEN
Sbjct: 418 LEN 420

>Suva_16.477 Chr16 complement(823311..824582) [1272 bp, 423 aa] {ON}
           YPR148C (REAL)
          Length = 423

 Score =  375 bits (963), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 206/431 (47%), Positives = 271/431 (62%), Gaps = 57/431 (13%)

Query: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVAN--VNLNDPQTRLSIKTRTRYLKETLG 58
           MS Y++  +     DSIA AAH+TQD L++A+AN  VNLNDPQTRLSIK+RTR+++E+LG
Sbjct: 1   MSGYWNKIT-----DSIATAAHKTQDTLNSALANANVNLNDPQTRLSIKSRTRFVQESLG 55

Query: 59  AVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKE 118
            V +ISKLPPQY  LE+KSD+LEK CKR+LLV++TFEVEGYDYPPNL ES SDWWS +K+
Sbjct: 56  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 115

Query: 119 GWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDED 178
           GWFGS K +   + K   D +  D  +PRSFAQAI+KA+ +C   ++N +++EK+ + + 
Sbjct: 116 GWFGSKKTEHASKKK---DSNHDDTFLPRSFAQAISKAAVDCESEFKNLEQNEKEDLKQK 172

Query: 179 EDD--------------------------VNLVEMFNTLSICYRNIDEGKDEMDKSIARE 212
           ++                            NL+++F++ S CY+NIDEGK EMD  + +E
Sbjct: 173 KEAKKTTQETAEQEEEEEEEEEEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDSMMVKE 232

Query: 213 FNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXTAN-ADEGPS 271
           FN KLE+L+N DFKK+H LR KVE SRLKFDTMRYE +            T+  AD   +
Sbjct: 233 FNKKLEKLINEDFKKVHELRRKVEESRLKFDTMRYEGKSKEEQLRAQKDETSKEADNNDN 292

Query: 272 NKNQQXXXXXXXXXXXXXXXXXXXXXQH---------TT-----------KTENSNKEPM 311
           + N                       +          TT           K + +N +P 
Sbjct: 293 SANSTSLEEALTAEKKAEKEDDAKVPEEEPKKVETDVTTANDDIDTNENPKQQPTNNQPP 352

Query: 312 VEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEME 371
           VE  E+NKLLE+LEDEFVSNT+ AVETM  I + SEIL L+KLFQN QLVY+RQC QE+E
Sbjct: 353 VEDSEENKLLEKLEDEFVSNTTAAVETMEEITDSSEILSLVKLFQNFQLVYFRQCAQEVE 412

Query: 372 ASLKGLNDLEN 382
           A+LK LN +EN
Sbjct: 413 ANLKVLNGMEN 423

>YPR148C Chr16 complement(826833..828140) [1308 bp, 435 aa] {ON}
           Protein of unknown function that may interact with
           ribosomes, based on co-purification experiments; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 435

 Score =  363 bits (931), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 213/437 (48%), Positives = 270/437 (61%), Gaps = 59/437 (13%)

Query: 1   MSEYFSSFSFKNLGDSIANAAHRTQD--KLSNAVANVNLNDPQTRLSIKTRTRYLKETLG 58
           MS YFS FS   + DSIA AAH+TQD    + A ANVNLNDPQTRLSIK+RTR+++E+LG
Sbjct: 1   MSGYFSGFSLNKITDSIATAAHKTQDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 59  AVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKE 118
            V +ISKLPPQY  LE+KSD+LEK CKR+LLV++TFEVEGYDYPPNL ES SDWWS +K+
Sbjct: 61  TVSDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 119 GWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQN------------ 166
           GWFGS K      S  +   +  D  +PRSFAQAI+KA+ +C   +QN            
Sbjct: 121 GWFGSKKS---ESSTKKKGSNHDDAFLPRSFAQAISKAAVDCECEFQNLEHNEKAELKKK 177

Query: 167 ------SQKSEKKQIDEDEDDV-------------NLVEMFNTLSICYRNIDEGKDEMDK 207
                 +Q +E +  D +E+D              NL+++F++ S CY+NIDEGK EMD 
Sbjct: 178 KESIKTAQTTEAQGADHNEEDEEDEEDEEDDEDLSNLIKVFDSWSTCYKNIDEGKAEMDS 237

Query: 208 SIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXXXXXXXX------ 261
            + +EFN KLE L+N+DFKK+H LR KVE SRLKFDTMRYE++                 
Sbjct: 238 MMVKEFNKKLETLINQDFKKVHDLRKKVEESRLKFDTMRYEVKAKEAELEAKKAEATGEA 297

Query: 262 -------------XTANADEGPSNKNQQXXXXXXXXXXXXXXXXXX----XXXQHTTKTE 304
                         T + DE PS ++++                         +   K+ 
Sbjct: 298 HSKDVSAKDISANTTTSFDETPSTEDEKPKSEGAEEESKKEANEPTVDDVADRKEDLKSN 357

Query: 305 NSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYR 364
             N EP +E+ EDNKLLE+LEDEFVSNT+ AVETM  I + SEIL L+KLFQN QLVY+R
Sbjct: 358 KVNDEPPIEESEDNKLLEKLEDEFVSNTTAAVETMEEITDSSEILGLIKLFQNFQLVYFR 417

Query: 365 QCVQEMEASLKGLNDLE 381
           QCVQE+EA+LK LN LE
Sbjct: 418 QCVQEVEANLKVLNGLE 434

>Smik_16.401 Chr16 complement(698791..700074) [1284 bp, 427 aa] {ON}
           YPR148C (REAL)
          Length = 427

 Score =  360 bits (924), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 207/431 (48%), Positives = 268/431 (62%), Gaps = 53/431 (12%)

Query: 1   MSEYFSSFSFKNLGDSIANAAHRTQD--KLSNAVANVNLNDPQTRLSIKTRTRYLKETLG 58
           MS YFSSFS   + DSIA AAH+T D    + A ANVNLNDPQTRLSIK+RTR+++E+LG
Sbjct: 1   MSGYFSSFSLNKITDSIATAAHKTHDTLNNALANANVNLNDPQTRLSIKSRTRFVQESLG 60

Query: 59  AVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKE 118
            + +ISKLPPQY  LE+KSD+LEK CKR+LLV++TFEVEGYDYPPNL ES SDWWS +K+
Sbjct: 61  TISDISKLPPQYQFLEKKSDSLEKVCKRILLVSKTFEVEGYDYPPNLTESISDWWSLNKD 120

Query: 119 GWFGSTKQDEDGESKIQTDGSSK-DPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDE 177
           GWFGS K +   + K    GS+  D  +PRSFAQAI+KA+ +C   +QN +  EK ++ +
Sbjct: 121 GWFGSKKSEITNKKK----GSNHDDAFLPRSFAQAISKAAVDCEFEFQNLENDEKAELKK 176

Query: 178 DEDDV----------------------------NLVEMFNTLSICYRNIDEGKDEMDKSI 209
             +                              NL+++F++ S CY+NIDEGK EMD  +
Sbjct: 177 KRESTKNAQTTGAQDEENEEDEDEEEEEDEDLSNLIKVFDSWSTCYKNIDEGKTEMDSMM 236

Query: 210 AREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXX----------XXXX 259
            +EFN KLE+L+N+DFK++H LR KVE SRLKFDTMRYE++                   
Sbjct: 237 VKEFNKKLEKLINQDFKRVHELRKKVEISRLKFDTMRYEVKAKEAQLDAQKPGVTEEAHT 296

Query: 260 XXXTANA----DEGPSNKNQQXXXXXXXXXXXXXXXXXXXXXQHTTKTENSNKEPMVEKP 315
              +AN     +E PS  +++                           E+   +   + P
Sbjct: 297 KDVSANTATSLNEIPSTVDEKQKSNVNTEAESKKEANEQVADDAVVMKEDPKDDKKDDTP 356

Query: 316 ----EDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEME 371
               E+NKLLE+LEDEFVSNT+ AVETM  I + SEIL L+KLFQN QLVY+RQCVQE+E
Sbjct: 357 LEESEENKLLEKLEDEFVSNTTAAVETMEEIADSSEILGLIKLFQNFQLVYFRQCVQEVE 416

Query: 372 ASLKGLNDLEN 382
           A+LK LN LEN
Sbjct: 417 ANLKVLNGLEN 427

>Kwal_55.21227 s55 complement(739317..740447) [1131 bp, 376 aa] {ON}
           YPR148C - Hypothetical ORF [contig 130] FULL
          Length = 376

 Score =  352 bits (904), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 195/389 (50%), Positives = 249/389 (64%), Gaps = 23/389 (5%)

Query: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 60
           MS YF  FSF  L D++ NAAH+TQD LS A+AN+ L+DPQ  LS+K R  YL+ETLG +
Sbjct: 1   MSSYFGGFSFNKLTDTLTNAAHKTQDTLSTAIANIQLDDPQAILSLKARKHYLQETLGTI 60

Query: 61  DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW 120
           ++ISKLPPQY LLE+K D+LEKAC+RML+VT+TFEVEGYDYPPNL ES SDWWS +KEG 
Sbjct: 61  EDISKLPPQYQLLEKKCDSLEKACRRMLVVTKTFEVEGYDYPPNLSESLSDWWSSNKEGL 120

Query: 121 FG---STKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQ----NSQKSEKK 173
           FG   S+K+D+  ES      ++K  LMPRSFAQAIAKA+ + G+         Q++   
Sbjct: 121 FGLMSSSKKDKGAESAA----AAKSALMPRSFAQAIAKAAKDSGDVLAALKDQEQQASAD 176

Query: 174 QIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRN 233
           + DEDED   L++MF+  S C   ID+GK EMD  +A+EFN KL  L+   FK   VLR 
Sbjct: 177 EEDEDEDITPLIKMFSAWSECQYKIDQGKAEMDALMAKEFNQKLNALIEEKFKNASVLRR 236

Query: 234 KVENSRLKFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKNQQXXXXXXXXXXXXXXXXX 293
           KVE+SRLKFDTMRYE++L                   + +N++                 
Sbjct: 237 KVEDSRLKFDTMRYEVKLTEQQSKQ------------AMENEKAQFKESDLSSKEEGADA 284

Query: 294 XXXXQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMK 353
                   K+    KE         +LLE+LEDEFVSNT+EAVETM  I + +E+L L+K
Sbjct: 285 NETSNEVGKSVTKTKEEQATNDAAQELLEKLEDEFVSNTTEAVETMGEITDSAELLNLVK 344

Query: 354 LFQNLQLVYYRQCVQEMEASLKGLNDLEN 382
           LF N QLVY+RQCVQ++EASL  LN+LE 
Sbjct: 345 LFHNFQLVYHRQCVQDLEASLSTLNELEG 373

>TDEL0D05590 Chr4 complement(1008107..1009141) [1035 bp, 344 aa]
           {ON} Anc_3.491 YPR148C
          Length = 344

 Score =  350 bits (898), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 263/385 (68%), Gaps = 47/385 (12%)

Query: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 60
           MS Y S+FS   + D++ANAAH+TQD L++A+ANV+  DPQ +LS+K RTRYL+ETLG +
Sbjct: 1   MSGYLSNFSLNKITDTLANAAHKTQDTLNSAIANVS--DPQAKLSLKARTRYLQETLGTI 58

Query: 61  DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW 120
           D+ SKLPPQY  LE+KSDALEK CKR+LLVT+TFEVEGYDYPPNL ES SDWWS +K+GW
Sbjct: 59  DDKSKLPPQYQSLEKKSDALEKCCKRILLVTRTFEVEGYDYPPNLTESISDWWSLNKDGW 118

Query: 121 FGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDED 180
           FG+ K ++       +DGS  D  +PRSF+QAI+KA+++C   + N Q  E    DE+++
Sbjct: 119 FGTKKPEKTKND--SSDGS--DAFLPRSFSQAISKAANDCNSVFTNLQ--EHGDEDEEDE 172

Query: 181 DV-NLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSR 239
           DV N+ +MF++ S CY+NIDEGK EMD  I +EFN KLE+++N DFKK+H  R KVE SR
Sbjct: 173 DVSNVAKMFDSWSKCYKNIDEGKHEMDSMIRKEFNTKLEKIINEDFKKVHASRKKVEESR 232

Query: 240 LKFDTMRYEMRLXXXXXXXXXXXT--ANADEGPSNKNQQXXXXXXXXXXXXXXXXXXXXX 297
           LKFDT+RYE++L           T  A+ DE                             
Sbjct: 233 LKFDTVRYEIKLKETENAKKSTETDEASKDE----------------------------- 263

Query: 298 QHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQN 357
              TKTE   +EP  +  E++KLLE+LEDEFVSNT+ AVE M  + E +EIL L KLFQN
Sbjct: 264 ---TKTE---EEP-PKTSEEDKLLEELEDEFVSNTTAAVEIMGEVTESAEILGLAKLFQN 316

Query: 358 LQLVYYRQCVQEMEASLKGLNDLEN 382
            QLVY+RQCVQE+EASLK L  LE+
Sbjct: 317 FQLVYFRQCVQEVEASLKILGALES 341

>KLTH0F14806g Chr6 complement(1212362..1213438) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score =  345 bits (884), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 185/385 (48%), Positives = 242/385 (62%), Gaps = 35/385 (9%)

Query: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 60
           MS YF  FS   L +SI N AH+TQD LS A+AN+ L+DPQ +LS+K R  YL+ETLG +
Sbjct: 1   MSNYFGGFSLNKLTNSITNVAHKTQDTLSTAIANIQLDDPQAKLSLKARKHYLQETLGTI 60

Query: 61  DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW 120
           ++ISKLPPQY  LE+K D+LEK C+RML+VT+T+EVEGYDYPPNL ES SDWWS +KEG 
Sbjct: 61  EDISKLPPQYQFLEKKCDSLEKVCRRMLVVTKTYEVEGYDYPPNLSESLSDWWSSNKEGL 120

Query: 121 FGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAY----QNSQKSEKKQID 176
           FG     +  E K++    SK+ LMPRSFAQAI+KA+ + GE         QK+  ++ +
Sbjct: 121 FGFVSSSKK-EKKLEPAEDSKEALMPRSFAQAISKAAKDSGEVMTALKTEEQKASAEEDE 179

Query: 177 EDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVE 236
           EDED  +L++MF   S C  N+D+ K EMD  + +EFN KL   +   FK    LR KVE
Sbjct: 180 EDEDITSLIKMFEAWSACQHNMDQSKAEMDALMVKEFNHKLTAFVEEKFKNARTLRKKVE 239

Query: 237 NSRLKFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKNQQXXXXXXXXXXXXXXXXXXXX 296
           +SRLKFDTMRYE+++              A +  S K Q+                    
Sbjct: 240 DSRLKFDTMRYELKMAEEQGKTEEA----AQQTESQKPQEDEA----------------- 278

Query: 297 XQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQ 356
               +K  +S+ E         KLLE+LEDEFVSNT+EAVETM  I + +EI+ L+KLF 
Sbjct: 279 --EASKDSDSSDEA-------QKLLEKLEDEFVSNTTEAVETMGEITDSAEIINLVKLFH 329

Query: 357 NLQLVYYRQCVQEMEASLKGLNDLE 381
           N QL+YY+QCVQ +E S+  LN+LE
Sbjct: 330 NFQLIYYKQCVQNLETSINSLNELE 354

>SAKL0F02794g Chr6 (238272..239465) [1194 bp, 397 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 397

 Score =  342 bits (877), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 192/403 (47%), Positives = 255/403 (63%), Gaps = 28/403 (6%)

Query: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 60
           MS YFSSFS   L +SI++AAH+TQDKLS A+AN+ L+DPQ +LS+K R  YL+ETLGA+
Sbjct: 1   MSGYFSSFSLDKLTNSISSAAHKTQDKLSTAIANIQLDDPQAKLSLKVRKHYLQETLGAI 60

Query: 61  DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGW 120
           D+ISKLPPQY  LE+K D+LEK C+RML+VT+TFEVEGYDYPPNL ES SDWW  ++ G 
Sbjct: 61  DDISKLPPQYQFLEKKCDSLEKICRRMLVVTKTFEVEGYDYPPNLSESISDWWGANRSGL 120

Query: 121 --FGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDED 178
             F   K+ E   +K + +    +  +PRSFAQA++KA+ + G+  + + K E+K+  +D
Sbjct: 121 LSFMDGKKGEGSRAKAE-EKDENEGFLPRSFAQALSKAAKDSGDVLR-TLKDEQKEPPQD 178

Query: 179 EDDV------NLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLR 232
           ED+       +L+ MF   S C + ID+ K EMD  +A+EFN KL++L+N DFKK+H LR
Sbjct: 179 EDEDEDEDINSLITMFEAWSKCEQKIDQEKAEMDSLMAKEFNKKLDKLINEDFKKVHSLR 238

Query: 233 NKVENSRLKFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKNQQXXXXXXXXXXXXXXXX 292
            KVE SRLKFDT+RYE+ L            A A E  + K                   
Sbjct: 239 KKVEESRLKFDTLRYELNLKEKEQQK-----AKAKEEENEKVDVVEQNAPEEKAKTEGQE 293

Query: 293 XXXXXQHTTKTENSNKEPMVEK-PE------------DNKLLEQLEDEFVSNTSEAVETM 339
                +H  K +    E    K PE            ++KLLE+LEDEFVS+T+EAVE M
Sbjct: 294 TSEGKEHDLKADEKLSEDTASKIPESVENEEVDNEDPEHKLLEKLEDEFVSSTTEAVEIM 353

Query: 340 TSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLEN 382
             I + SEIL L+KLF   QL+Y+RQCVQE+EAS K L+ L+N
Sbjct: 354 GEITDSSEILSLVKLFHKFQLIYHRQCVQELEASTKILDGLDN 396

>Kpol_1017.7 s1017 (27496..28272,28322..28330,28419..28769) [1137
           bp, 378 aa] {ON}
           (27496..28272,28322..28330,28419..28769) [1137 nt, 379
           aa]
          Length = 378

 Score =  310 bits (793), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/391 (46%), Positives = 240/391 (61%), Gaps = 29/391 (7%)

Query: 5   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVN------LNDPQTRLSIKTRTRYLKETLG 58
           FS FS   L DSI+N A +TQ+ L+NA++NVN      LNDP T+LSIK++ R+++E LG
Sbjct: 2   FSGFSIDKLTDSISNVALKTQENLTNALSNVNENLENYLNDPNTKLSIKSKARFIQEKLG 61

Query: 59  AV-DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSK 117
            + D+ SKLPP Y  LE K+DA+EKA KR+L VT+T+E EGYDYPPNL ES SDWW+   
Sbjct: 62  TINDQPSKLPPTYTDLELKTDAIEKALKRLLTVTKTYETEGYDYPPNLTESLSDWWTNDD 121

Query: 118 EGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGE---AYQNSQKSEKKQ 174
                 T  DE+ E+ IQ++ S     +PRSFAQAI+ AS +      +  N+ K   K 
Sbjct: 122 ----NVTNTDENDEN-IQSNKS----FLPRSFAQAISNASFDAASNVNSVTNTIKLNHKD 172

Query: 175 IDEDEDDV----NLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHV 230
            +E+E+D     +L ++F +L  CYRNID GK EMDK I  EFN+KL+ L+N +FK +H 
Sbjct: 173 DEEEEEDDEEWSDLHKIFESLGNCYRNIDNGKTEMDKLIVNEFNNKLKDLINTEFKNVHQ 232

Query: 231 LRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKNQQXXXXXXXXXXXXXX 290
           LR  VENSRLKFDTMRYE+++           T    E     +                
Sbjct: 233 LRKSVENSRLKFDTMRYELKI------KEWKRTXXXMEAEDKSDVSKKGTSKKETPKKEA 286

Query: 291 XXXXXXXQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILR 350
                  +   K E+   E   E   DNKLLE+LEDEFVSNT  AVE M  + + S+I+ 
Sbjct: 287 SKKETPKKEINKKEDITNEGNTENDNDNKLLEKLEDEFVSNTQNAVEKMEELTDNSKIIN 346

Query: 351 LMKLFQNLQLVYYRQCVQEMEASLKGLNDLE 381
           L+KL+QN QLVYY+QC+QE+E++LK LN LE
Sbjct: 347 LVKLYQNFQLVYYKQCIQEIESNLKILNGLE 377

>KLLA0E04621g Chr5 (412009..413178) [1170 bp, 389 aa] {ON} some
           similarites with uniprot|Q06523 Saccharomyces cerevisiae
           YPR148C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 389

 Score =  291 bits (745), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 166/412 (40%), Positives = 246/412 (59%), Gaps = 61/412 (14%)

Query: 5   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEIS 64
           FS  S  N+ DSI+NAA RTQ++ S+A+  ++L+DP+TRLSI  R   L+ETLG V +IS
Sbjct: 2   FSKLSLNNITDSISNAAQRTQEQFSSAIEKIHLDDPETRLSILKRRHQLQETLGTVHDIS 61

Query: 65  KLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFGST 124
           +LP QY  LE+KSDALEK CKR+LLVT+TFEVEGYDYPPNL ESF+DWWSG+K+  F  +
Sbjct: 62  QLPIQYKFLEQKSDALEKICKRLLLVTKTFEVEGYDYPPNLTESFNDWWSGNKDSIFSFS 121

Query: 125 KQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECG---------EAYQNSQKSE---- 171
           K+    E   +   ++++ L+PRSFAQA++KA+ +           E   N ++S+    
Sbjct: 122 KK--KAEVSPEVKETAENGLLPRSFAQALSKAATDSALILKQLKAEETRTNQEESQEGAD 179

Query: 172 KKQIDEDEDD-----------------VNLVEMFNTLSICYRNIDEGKDEMDKSIAREFN 214
           +K  +E + +                  NL++ F + + C  +ID+ K EMD  + +EFN
Sbjct: 180 QKPAEETKAEPELEAEADEDEDEDEDVDNLIKAFESWTKCQLSIDQSKAEMDSLMVKEFN 239

Query: 215 DKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKN 274
            KL +L+  DFKK H LR KV+++RL FDT+R+E++L            A+++E      
Sbjct: 240 AKLSKLIETDFKKGHELRAKVQDARLNFDTLRHEIKL----KLQEKEVVASSEEAEKKVA 295

Query: 275 QQXXXXXXXXXXXXXXXXXXXXXQHTTKTENSNKEPM----VEKPEDNKLLEQLEDEFVS 330
            +                        T  + +N+EP+     E+  D+KL E+LED+FVS
Sbjct: 296 TETPE---------------------TPEKKTNEEPVDMAKTEEDPDSKLFERLEDQFVS 334

Query: 331 NTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLEN 382
            TSE VE +  + + SEI+ L+KLF N QL++Y+QCV+ +E  L+ LN L++
Sbjct: 335 ATSETVEFLGELTDSSEIISLVKLFHNFQLIHYKQCVKSLEEDLEVLNSLDS 386

>TPHA0D03270 Chr4 complement(673063..674229) [1167 bp, 388 aa] {ON}
           Anc_3.491 YPR148C
          Length = 388

 Score =  283 bits (723), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 178/409 (43%), Positives = 230/409 (56%), Gaps = 57/409 (13%)

Query: 5   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVN------LNDPQTRLSIKTRTRYLKETLG 58
           FS+FS   L DSI+N A +TQ+  +NA+ ++N      LNDP T+LSI+ R+RY++E LG
Sbjct: 2   FSNFSLDKLTDSISNVALKTQENFTNAITDLNNNIETILNDPNTKLSIRARSRYIQEQLG 61

Query: 59  AVD-EISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSK 117
            +D EISKLP QYV LE K+D++EK  KR+LLVT TF  EGYDYPPNL ES SDWW+   
Sbjct: 62  TLDDEISKLPQQYVELEIKTDSVEKILKRLLLVTNTFATEGYDYPPNLTESISDWWA--- 118

Query: 118 EGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHEC------GEAYQNSQKSE 171
                   +DE  E+K           +PRSFAQA+AKA  +        E     Q S 
Sbjct: 119 --------EDETTENK---------NFLPRSFAQALAKAYSDSKLITDKAERNIKLQTSP 161

Query: 172 KKQIDEDEDD-------------------VNLVEMFNTLSICYRNIDEGKDEMDKSIARE 212
           K    +DE+                    V L + F  LS  + NID GK+EMD  I  E
Sbjct: 162 KNTGTKDENPEAGAEEEVEADDDEEDEDLVTLGKAFKALSNSFTNIDNGKNEMDTMIVNE 221

Query: 213 FNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXTANADEGPSN 272
           FN KLE LL  +FK++  LR  VENSRLKFDTMRY+++L              A E  ++
Sbjct: 222 FNKKLEHLLEVEFKEVAQLRRNVENSRLKFDTMRYDVKLKEAKAEQEE-----AKEVSTD 276

Query: 273 KNQQXXXXXXXXXXXXXXXXXXXXXQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNT 332
           K  +                     + T + +   +     + ED KLLEQLEDEFVSNT
Sbjct: 277 KEIEKKESETKEPETKGTEEKEPETKDTEEKDPVKENEGENEDEDYKLLEQLEDEFVSNT 336

Query: 333 SEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLE 381
           S AVE M  + + ++IL L+KLFQN QLVYYRQCVQE+E +LK ++DLE
Sbjct: 337 SSAVEKMEELTDSAKILDLVKLFQNFQLVYYRQCVQEIENNLKTISDLE 385

>Ecym_1238 Chr1 (489922..491103) [1182 bp, 393 aa] {ON} similar to
           Ashbya gossypii AFR309C
          Length = 393

 Score =  276 bits (705), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 166/404 (41%), Positives = 235/404 (58%), Gaps = 43/404 (10%)

Query: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKL-------SNAVANVNLNDPQTRLSIKTRTRYL 53
           MS YFS+FS   +  +I  AAH+TQ KL       ++A+ ++NL+DPQT LS++TR   L
Sbjct: 1   MSSYFSNFSLDKIASTINTAAHKTQQKLNETQEQLTHAIHSINLDDPQTMLSLRTRKHQL 60

Query: 54  KETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWW 113
           +ETLG + +ISKLPP+Y  LERK DA EK C R+L+V++TFEV+GYDYPPNL ES SDWW
Sbjct: 61  QETLGTIKDISKLPPRYQFLERKCDAFEKVCSRILVVSKTFEVDGYDYPPNLAESISDWW 120

Query: 114 SGS--KEG--W-FG-STKQDED-GESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQN 166
             S  K+G  W FG  +K D++  E K   +  S +  +P SFAQAI+KA+ +     + 
Sbjct: 121 GSSSKKDGVFWGFGKKSKNDKNKAEQKSSAEKKSNEGYIPPSFAQAISKAADDSITILK- 179

Query: 167 SQKSEKKQID-------EDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQ 219
            + +E++ ++       EDED  +L+ +    +    NIDE K +MD+ +  EFN KL+ 
Sbjct: 180 -ELNEEQLVNPSNGAETEDEDVDSLMPILEAWAEAQSNIDEAKQQMDQFMINEFNKKLDS 238

Query: 220 LLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXTANADEGPSNKNQQXXX 279
           L+N DF K+  LR KVE SRLKFDT+RYE+ +               +    N   +   
Sbjct: 239 LVNNDFLKVRALRKKVEESRLKFDTLRYELEMRKSGASQTKETFTTIESQQVNDKDK--- 295

Query: 280 XXXXXXXXXXXXXXXXXXQHTTKTENSNKEPMVEKPEDNK---LLEQLEDEFVSNTSEAV 336
                              + T   +S+ E      ED K   LLE+ EDEFVSNT++AV
Sbjct: 296 --------ENEDNLKPTIHNNTGIGSSSDE------EDQKFRLLLEKAEDEFVSNTTDAV 341

Query: 337 ETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDL 380
             MT I +   +  L+KLF N QL+Y+++CVQE++ASL  +N L
Sbjct: 342 AYMTQITDSVNLSTLVKLFHNFQLIYHKKCVQELQASLNVINTL 385

>AFR309C Chr6 complement(1000078..1001172) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR148C
          Length = 364

 Score =  272 bits (696), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 170/400 (42%), Positives = 231/400 (57%), Gaps = 58/400 (14%)

Query: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKLS-------NAVANVNLNDPQTRLSIKTRTRYL 53
           MS YF + S   L +++ NAA +TQ KLS       +A+ N+ ++DP+T LS+KTR R L
Sbjct: 1   MSAYFGAISLDKLANTLNNAAQKTQQKLSETQEHLTHAIQNIKIDDPKTILSLKTRKRQL 60

Query: 54  KETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWW 113
           +ETLG+  +IS+LPPQY  LERK DA+E+ CK++L+V++TFEVEGYDYPPN  ES SDWW
Sbjct: 61  QETLGSAKDISQLPPQYGFLERKCDAIEQVCKKILVVSKTFEVEGYDYPPNPTESISDWW 120

Query: 114 SGS-------KEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAI---AKASHECGEA 163
           + S       K G  G+ KQ ED +   Q  GSS  P    SFA A+   AK S    + 
Sbjct: 121 NTSTKETRFLKFGKGGTDKQKEDKQK--QAAGSSDPP----SFAHALHRAAKGSQGIIQE 174

Query: 164 YQNSQKSEKKQIDEDEDDV-NLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLN 222
            +   + E++Q  E ++DV +L++MF T +    N+D  K EMD+ + +EFN+KL+ LL 
Sbjct: 175 LKEQAEEEQEQEVEIDEDVESLIKMFGTWADAQYNMDIAKREMDQFMVKEFNEKLKHLLE 234

Query: 223 RDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXTANADEG-PSNKNQQXXXXX 281
            +FKK H LR KVE SRL FDT++YE                 A+   PS          
Sbjct: 235 VEFKKGHTLRRKVEESRLTFDTLKYEQHERDAALAKKQDEAKQAEGATPS---------- 284

Query: 282 XXXXXXXXXXXXXXXXQHTTKTENSNKEPMVEKPEDNKLLEQLEDEFVSNTSEAVETMTS 341
                             T  T++S  +           LE  EDEFVSNT+EAVE MTS
Sbjct: 285 ------------------TGVTQSSTADLAFYAQ-----LEDAEDEFVSNTAEAVEFMTS 321

Query: 342 IVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLE 381
           I + ++++ L+KLFQN QLVY+R+CVQE+E SL  L  LE
Sbjct: 322 IADATKLISLVKLFQNFQLVYHRKCVQELEVSLNSLTSLE 361

>CAGL0L08492g Chr12 (931048..932205) [1158 bp, 385 aa] {ON} similar
           to uniprot|Q06523 Saccharomyces cerevisiae YPR148c
          Length = 385

 Score =  250 bits (639), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 156/370 (42%), Positives = 210/370 (56%), Gaps = 32/370 (8%)

Query: 37  LNDPQTRLSIKTRTRYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEV 96
            NDP+T+LSIK +TR+L+E +G   +ISKLPPQYV+LE+K D++EK  KR+L+VT+T+E+
Sbjct: 24  FNDPKTKLSIKAKTRFLQEAIGNERDISKLPPQYVVLEKKCDSIEKVLKRILIVTKTYEI 83

Query: 97  EGYDYPPNLPESFSDWWSGSKEGWF-------------GSTKQDEDGESKIQTDGSSKDP 143
           EGYDYPPN+ ES S WW  +KE WF             G+ ++     SK  TD      
Sbjct: 84  EGYDYPPNISESLSSWWQ-TKE-WFNISELTKNVIPKHGNVEKAGTEASKTLTDKEVSHE 141

Query: 144 LMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKD 203
             P SFA AIA+A  +    +++    E K  DE ED   LV++F   S C+  I + K 
Sbjct: 142 -GPPSFASAIARAGKDSQLIFES---IETKDEDEKEDIDELVKIFKIWSDCFYEISDSKT 197

Query: 204 EMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRLXXXXXXXXXXXT 263
           EMD+ + +EFN KLE  L ++F+KIH LR KVE SRL FDTMRYE  +            
Sbjct: 198 EMDQMMIKEFNVKLEDYLQKNFQKIHTLRAKVEESRLNFDTMRYE--VAQTSKQTDSKEL 255

Query: 264 ANADEG-PSNKNQQXXXXXXXXXXXXXXXXXXXXXQHTTKTENSNKEPMVEKPEDNK--- 319
            N DE  PS+ +                        + T  + + +    +  ED K   
Sbjct: 256 GNEDETKPSSMDANKTNTEEKEAANDKVETKEKTETNATIADETKETKDTKDSEDLKEDS 315

Query: 320 -------LLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEA 372
                  LLEQLEDEFVSNT+EAVE MT + E SE+L L+KLFQ  QL Y++ CV+ +E 
Sbjct: 316 KTSTDGQLLEQLEDEFVSNTTEAVEVMTEVSENSELLSLIKLFQTFQLSYHQHCVKSLEQ 375

Query: 373 SLKGLNDLEN 382
           SLK LN ++N
Sbjct: 376 SLKDLNAIDN 385

>NDAI0B05850 Chr2 complement(1418191..1419612) [1422 bp, 473 aa]
           {ON} Anc_3.491 YPR148C
          Length = 473

 Score =  232 bits (591), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 125/289 (43%), Positives = 180/289 (62%), Gaps = 45/289 (15%)

Query: 5   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEIS 64
           FSSFS   + +SI NAA +  + L+NA+      DPQT+LSIK++TR  +E LG + +IS
Sbjct: 2   FSSFSLDKITNSIGNAAQKATNTLNNAINTAT--DPQTKLSIKSQTRLFQEQLGTIHDIS 59

Query: 65  KLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFGST 124
           KLP QY  LE K+D+LEK+ KR+LLV++TFE+EGYDYPPNL ESFSDWW+ +K+      
Sbjct: 60  KLPDQYKSLELKTDSLEKSIKRILLVSKTFEMEGYDYPPNLTESFSDWWNITKKSSSHRK 119

Query: 125 KQ-------------DEDGESK---IQTDGSSKDPLMPRSFAQAIAKASHECGEAYQN-- 166
           KQ             D D  +    I+ D +S    +PRSFAQAI+K++ +C + YQ   
Sbjct: 120 KQISVNNKKKNNTDNDHDNATNVEPIENDITSS-SFLPRSFAQAISKSAMDCTDIYQQLS 178

Query: 167 -SQKSEKKQIDEDEDDV-----------------------NLVEMFNTLSICYRNIDEGK 202
             + + K+   +DE++                        NL++ F + S CY+NID+GK
Sbjct: 179 IQETATKETTIKDENEAQEEDDEDAGEEEEEDDDDDEDIQNLIKAFESWSNCYKNIDQGK 238

Query: 203 DEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMRYEMRL 251
            EMD  + +EFN+KLE L+N +FKK++ LR KV +SRLKFDT+R+E+++
Sbjct: 239 SEMDSMMTKEFNNKLEDLINNEFKKVNTLRKKVADSRLKFDTVRHEIKI 287

 Score = 99.8 bits (247), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 58/67 (86%)

Query: 316 EDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLK 375
           E++KLLEQLEDEFVS+T+ AVE MT I E S I+ L+KLFQN QLVYYRQCVQE+EA+LK
Sbjct: 406 EEHKLLEQLEDEFVSSTASAVEMMTEITESSSIIGLIKLFQNFQLVYYRQCVQEIEANLK 465

Query: 376 GLNDLEN 382
            LN+L++
Sbjct: 466 TLNELDH 472

>NCAS0F03540 Chr6 complement(707257..708591) [1335 bp, 444 aa] {ON}
           Anc_3.491 YPR148C
          Length = 444

 Score =  227 bits (579), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 115/261 (44%), Positives = 172/261 (65%), Gaps = 29/261 (11%)

Query: 5   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEIS 64
           FS+FS   + +S+A AA +T D LSNA+      DP T+LS++++ R  +E++G V +IS
Sbjct: 2   FSNFSLDKITNSLATAAQKTSDTLSNAITTAT--DPATKLSLRSQKRLFQESIGTVHDIS 59

Query: 65  KLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFGST 124
            LP QY  LE ++DALEK  +R+L+V++TFE+EGYDYPPNL ESFSDWWS S +      
Sbjct: 60  TLPEQYTTLEARTDALEKCLRRILIVSKTFEMEGYDYPPNLSESFSDWWSLSSKKKKEQE 119

Query: 125 KQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDV-- 182
           K+D+ G              +PRSFAQAI+ ++ +C E YQ+    + +  +E+ ++   
Sbjct: 120 KEDKKG-------------FLPRSFAQAISNSAEDCVEIYQHVNDGDDEDKEENANNEEE 166

Query: 183 ------------NLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHV 230
                       NL++ F++ + CY+NID+GK EMD  + +EFN KLE+LLN +FKK+H 
Sbjct: 167 NEEEDEEDEDVKNLIKTFDSWAKCYKNIDQGKAEMDSMMMKEFNAKLEKLLNEEFKKVHT 226

Query: 231 LRNKVENSRLKFDTMRYEMRL 251
           LR +V++SRLKFDT+RYE+++
Sbjct: 227 LRKRVKDSRLKFDTVRYELKV 247

 Score = 96.3 bits (238), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 46/66 (69%), Positives = 56/66 (84%)

Query: 316 EDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLK 375
           E++KLLEQLED FVS+T+ AVE M  I + SEI+ L+KLFQN QLVYYRQCVQE+EA+LK
Sbjct: 378 EEHKLLEQLEDTFVSSTASAVEMMEEITDSSEIIGLVKLFQNFQLVYYRQCVQEIEANLK 437

Query: 376 GLNDLE 381
            LN+LE
Sbjct: 438 TLNELE 443

>TBLA0D02980 Chr4 (723788..725119) [1332 bp, 443 aa] {ON} Anc_3.491
           YPR148C
          Length = 443

 Score =  225 bits (573), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 174/272 (63%), Gaps = 26/272 (9%)

Query: 1   MSEYFSSFSFKNLGDSIANAAHRTQDKLSNAVANVNL--NDPQTRLSIKTRTRYLKETLG 58
           MS YFS+FS   L DS+ +AA +TQD LSNA+ NVN+  NDPQTRL++ ++  YL+E++G
Sbjct: 26  MSGYFSNFSLDKLADSLQSAAQKTQDTLSNAIQNVNIDWNDPQTRLTLLSKQHYLQESIG 85

Query: 59  AVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKE 118
            ++EISKLP QY  LERK+DALEK  KR+L+VT TFE+EGYDYPPNL ES S+WW     
Sbjct: 86  QINEISKLPSQYNALERKTDALEKIIKRILIVTNTFEIEGYDYPPNLSESISEWWLNDPL 145

Query: 119 GWFGSTKQDEDGESKIQTDGSSKDP-----------LMPRSFAQAIAKASHECGEAYQNS 167
            +    + +++   K +++ +  D             +PRSF  AI+KAS +      N 
Sbjct: 146 AFL---RDNDNTNDKNKSNSNPPDTKSKSDSDSESSFLPRSFPHAISKASSDSSAILTNL 202

Query: 168 QKSEKKQIDEDEDDVN----------LVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKL 217
             +EK +  + + +            L+++F++ S+C +NID+ K + D+ I ++FN KL
Sbjct: 203 NNNEKLEFAKTKTEDEEYEDDEDIQLLIKVFDSWSLCNKNIDKSKFQRDQLIIKQFNKKL 262

Query: 218 EQLLNRDFKKIHVLRNKVENSRLKFDTMRYEM 249
             LL+ +FK +  LR KV+++RLKFDTMRYE+
Sbjct: 263 TSLLDVEFKNVKALRLKVQDARLKFDTMRYEI 294

 Score = 88.6 bits (218), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/65 (64%), Positives = 53/65 (81%)

Query: 316 EDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLK 375
           ED KLLE LEDEFVS+TS AVETM  I E S+IL L+KLFQN QL++Y+QC++E+E ++K
Sbjct: 376 EDEKLLEHLEDEFVSHTSAAVETMEEITESSKILDLIKLFQNFQLLHYQQCIKEVETNMK 435

Query: 376 GLNDL 380
            L DL
Sbjct: 436 LLTDL 440

>KAFR0G03680 Chr7 complement(760604..761851) [1248 bp, 415 aa] {ON}
           Anc_3.491 YPR148C
          Length = 415

 Score =  190 bits (483), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 114/261 (43%), Positives = 161/261 (61%), Gaps = 32/261 (12%)

Query: 5   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV--DE 62
           FS+F+F  + +SI+ AA   Q K+++ +      D QT+L  K   R+ +E +G +   E
Sbjct: 2   FSNFNFDKITNSISTAAQSAQQKINDTILTP---DVQTKLHFKKTARFWQEKVGQIPDKE 58

Query: 63  ISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFG 122
           ISKLP  Y+ LE K DALEK  KR+L+VT+T+E+EGYDYPPNL ES +DWW      W  
Sbjct: 59  ISKLPEGYLNLENKVDALEKILKRLLIVTKTYEIEGYDYPPNLSESLNDWW------WSD 112

Query: 123 STKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECG-------EAYQNSQKSEKKQI 175
             K      SK   + SS    M  SF  AI+KA+ +         E  Q+  K  ++  
Sbjct: 113 LKK------SKKHQEKSS---FMNNSFPMAISKAAFDSKSILDDLKEKQQDLPKEGEEPE 163

Query: 176 DEDEDD-----VNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHV 230
           +E E++     +NL+E+FN+LS CY+NID+ K EMD  I +EFN KLE L+N DFKK+  
Sbjct: 164 EEVEEEDDDEFLNLLEVFNSLSNCYKNIDKSKAEMDAMIVKEFNFKLEHLINNDFKKVSK 223

Query: 231 LRNKVENSRLKFDTMRYEMRL 251
           LR KV++SRL+FDT+R+E++L
Sbjct: 224 LRTKVQDSRLEFDTLRHEIKL 244

 Score = 89.0 bits (219), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 42/69 (60%), Positives = 56/69 (81%)

Query: 313 EKPEDNKLLEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEA 372
           E+ E+ KLLE+LEDEFVSNT  AVE MT + E SE++ L+KLFQN QL++Y+QCVQE+E 
Sbjct: 347 EETEEYKLLEKLEDEFVSNTGAAVELMTELTETSEVINLVKLFQNFQLIHYKQCVQEIEN 406

Query: 373 SLKGLNDLE 381
           ++K L+ LE
Sbjct: 407 NMKFLDQLE 415

>KNAG0A07930 Chr1 complement(1265981..1267339) [1359 bp, 452 aa]
           {ON} Anc_3.491 YPR148C
          Length = 452

 Score =  123 bits (308), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 93/154 (60%), Gaps = 18/154 (11%)

Query: 5   FSSFSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV--DE 62
           FS+FS   L  +I NAA   QD + N + +    D QT+L     TRY +E +G +  DE
Sbjct: 2   FSNFSLDKLTSTITNAAQSAQDTIHNTILS---PDAQTKLQFLKTTRYFQEKVGTISEDE 58

Query: 63  ISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFG 122
           I+KLP  Y  L+ KS+A+EK  KR+L+VT+TFE+EGYDYPPN+ ES + WW+        
Sbjct: 59  IAKLPEGYQRLQEKSEAMEKVLKRLLVVTKTFELEGYDYPPNVTESLNHWWN-------- 110

Query: 123 STKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKA 156
              +DE+ + K Q  G S   ++ RSFA AI KA
Sbjct: 111 ---EDENKKKKTQDFGDSS--ILNRSFAIAIGKA 139

 Score = 82.0 bits (201), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 48/56 (85%)

Query: 326 DEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEMEASLKGLNDLE 381
           DEFVSN + AVE MT + + SE++ L+KLFQN+QLV+YRQCVQE+EAS+K L++LE
Sbjct: 391 DEFVSNITAAVEKMTELTDSSELISLVKLFQNIQLVHYRQCVQELEASMKSLDELE 446

>ZYRO0D16522g Chr4 complement(1371404..1372480) [1077 bp, 358 aa]
           {ON} similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 358

 Score = 84.0 bits (206), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 57/206 (27%), Positives = 88/206 (42%), Gaps = 14/206 (6%)

Query: 46  IKTRTRYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNL 105
           I    RY++E LG   +IS++P +Y+ L  K DA++      L VTQ ++ E YDYP  +
Sbjct: 32  IPVTHRYMQEKLGHATDISEMPQEYIDLTTKVDAIKLIYNHFLQVTQVYDNESYDYPKYI 91

Query: 106 PESFSDW--WSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEA 163
            ES +++    GSK           +  S +   G SKDP         ++  S EC E 
Sbjct: 92  NESINEFSRTVGSKIQELSHASSAHEAHSILSAPGPSKDPKTLNYALSRVSLVSSECMEH 151

Query: 164 YQNSQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNR 223
                           DD  L       S     + + +   D  +   FN KL + ++ 
Sbjct: 152 LST------------HDDALLASYLMKYSDIQSRVAQARLHQDSLVQTHFNAKLREEIDG 199

Query: 224 DFKKIHVLRNKVENSRLKFDTMRYEM 249
           + K+ H +R  VEN RL +D  R  +
Sbjct: 200 NLKRAHRVRRDVENKRLTYDASRTHL 225

>KLTH0A03894g Chr1 complement(328648..329619) [972 bp, 323 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 323

 Score = 79.7 bits (195), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 78/263 (29%), Positives = 119/263 (45%), Gaps = 41/263 (15%)

Query: 8   FSFKNLGDSI--------ANAAHRTQDK--------LSNAVANVNLNDPQTRLS--IKTR 49
            SF N  DS+        +  + R QD         LS+AV+     D  T+L    ++ 
Sbjct: 1   MSFNNFADSVNKKLQELSSQVSQRAQDAQLDKKFRDLSSAVSQ-RTQDLTTQLPSFAQST 59

Query: 50  TRYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPES- 108
            R ++E LG V +IS+LP +YV LE K D +    +  L VTQ +E E YDYP N+ +S 
Sbjct: 60  QRLVQEKLGQVTDISQLPQEYVELENKIDRVRLVYENFLKVTQVYENESYDYPNNVRDSV 119

Query: 109 --FSDWWSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQN 166
             FS   +G       +T  +E  +S +   G  KD   P++   A++K +    E Y N
Sbjct: 120 NEFSSVVAGKLHDLSRATSTNE-AQSVLIAPGPHKD---PKTLNYALSKVALTSSE-YLN 174

Query: 167 SQKSEKKQIDEDEDDVNLVEMFNTL---SICYRNIDEGKDEMDKSIAREFNDKLEQLLNR 223
                 K +  D+ +V+     N L   S     + + + + D  I   FN KL  +L  
Sbjct: 175 ------KSVGGDDSEVS-----NALLKYSDVQAKVAQARLQQDTLIQTRFNKKLRDILAN 223

Query: 224 DFKKIHVLRNKVENSRLKFDTMR 246
           D  +    R  VE+ RL++D  R
Sbjct: 224 DLNEAQKARKNVEHKRLQYDIAR 246

 Score = 32.3 bits (72), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 25/46 (54%)

Query: 321 LEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQC 366
           +E LEDEF   T +AV  M  +   SE+L+ ++     Q  Y++Q 
Sbjct: 264 MESLEDEFAQATDDAVVVMQKVAGSSELLKELRELVAAQADYHKQS 309

>Kwal_47.18148 s47 complement(708086..709057) [972 bp, 323 aa] {ON}
           YIL041W - Hypothetical ORF [contig 197] FULL
          Length = 323

 Score = 79.3 bits (194), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 119/257 (46%), Gaps = 28/257 (10%)

Query: 5   FSSFS------FKNLGDSIANAAHRTQ-DK----LSNAVANVNLNDPQTRLS--IKTRTR 51
           F+SF+      F+ +   ++  A   Q DK    LS AV+     D  T+L    ++  R
Sbjct: 3   FNSFADSVNRKFQEISSQVSQRAQEAQLDKKFKDLSTAVSQ-KTQDFTTQLPSLAQSTQR 61

Query: 52  YLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSD 111
            ++E LG V +IS+LP  YV LE K D ++   +  L VTQ +E E YDYP N+ +S ++
Sbjct: 62  LMQEKLGQVTDISQLPQDYVELENKIDRMKLVYENFLKVTQVYENESYDYPNNVRDSVNE 121

Query: 112 WWS--GSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQK 169
           + S  G+K           + +S + + G  KD   P++   A++K +    E    S  
Sbjct: 122 FSSIVGTKLHELSRATSTNEAQSVLISPGPHKD---PKTLNYALSKVALTSSEYLNKSPG 178

Query: 170 SEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIH 229
           +E  ++       +L++     S     I + +   D  I  +FN KL   L  D  +  
Sbjct: 179 AEDSEVSS-----SLLKY----SDVQAKIAQARLHQDTLIQTKFNKKLRAALADDLNRAQ 229

Query: 230 VLRNKVENSRLKFDTMR 246
             R  VEN RL++D  R
Sbjct: 230 KARKNVENKRLQYDIAR 246

 Score = 37.0 bits (84), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 27/48 (56%)

Query: 321 LEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQ 368
           +E LEDEF   T +AV  M  + E SE+L+ ++     Q  YY+Q  +
Sbjct: 264 MESLEDEFAQATDDAVVIMQKVAESSELLKDLRELVAAQAEYYKQSAE 311

>Kpol_478.22 s478 (67833..68885) [1053 bp, 350 aa] {ON}
           (67833..68885) [1053 nt, 351 aa]
          Length = 350

 Score = 79.3 bits (194), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/198 (29%), Positives = 92/198 (46%), Gaps = 22/198 (11%)

Query: 51  RYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFS 110
           R +KE LG VD+IS LP +Y+ LE K D  +   +  L +T  +E E YDYP    ES +
Sbjct: 37  RMVKEKLGQVDDISPLPQEYLDLELKIDTYKSVYEHFLKITSIYERESYDYPKEFSESVN 96

Query: 111 DWWS--GSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQ 168
           ++    G+K   F +          + T+GSS     PR+   A++K S    E +Q   
Sbjct: 97  EFTDSIGNKMYEFSNG---------VSTEGSSGK--TPRTLNYAVSKVSMGASEQFQKLH 145

Query: 169 KSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKI 228
                    D DD  +  +   +     +I E +   D SI  +FN +L + + +  ++ 
Sbjct: 146 ---------DTDDKRIANLLTNVGNAEASIAEARLLQDHSIQAKFNFQLREEIAQSIERA 196

Query: 229 HVLRNKVENSRLKFDTMR 246
              R +V + RLK+D  R
Sbjct: 197 SKYRKEVYHKRLKYDIAR 214

>KLLA0E04511g Chr5 complement(406764..407672) [909 bp, 302 aa] {ON}
           similar to uniprot|P40531 Saccharomyces cerevisiae
           YIL041W GVP36 Golgi-vesicle protein of unknown function
           green fluorescent protein (GFP)-fusion protein localizes
           to the cytoplasm
          Length = 302

 Score = 77.0 bits (188), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 113/250 (45%), Gaps = 27/250 (10%)

Query: 1   MSEYFSSFSFK--NLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLG 58
           MS+YF SFS K   L  S++  A   Q  L     ++  N P   L   +  R L+E LG
Sbjct: 1   MSQYFDSFSKKVQELSTSVSQKAQEAQ--LDQKFKDLKTNLP---LLANSTQRMLQEKLG 55

Query: 59  AVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDW--WSGS 116
            V +IS+LP +YV LE + + ++   +  L VT+ +E E YDYP N+ ES  ++    G 
Sbjct: 56  QVTDISQLPDEYVQLEHRVETIKLIYENFLKVTKIYENESYDYPSNVKESVDEFSKLVGG 115

Query: 117 KEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQID 176
           K          E  ++ + +    K+   P++   A++K +    E              
Sbjct: 116 KLHDLSKVTNREQAQNVLLSSPQMKE---PKTLNYALSKVALTSSEHV------------ 160

Query: 177 EDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVE 236
           EDE   N +  +   S     I + + + D  I  +FN  +++ L +D +     R  VE
Sbjct: 161 EDESLANFLAKY---SDSQTKIAQLRLQQDTMIQTKFNKAIKEKLEQDIETSTKARKLVE 217

Query: 237 NSRLKFDTMR 246
             RL++D +R
Sbjct: 218 QKRLQYDVVR 227

>SAKL0F08162g Chr6 complement(622302..623294) [993 bp, 330 aa] {ON}
           highly similar to uniprot|Q75AN7 Ashbya gossypii ADL115W
           ADL115Wp and similar to YIL041W uniprot|P40531
           Saccharomyces cerevisiae YIL041W GVP36 Golgi-vesicle
           protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm
          Length = 330

 Score = 77.4 bits (189), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 68/245 (27%), Positives = 112/245 (45%), Gaps = 21/245 (8%)

Query: 10  FKNLGDSIANAAHRTQ-DK----LSNAVANVNLNDPQTRLSIKTRT-RYLKETLGAVDEI 63
           F+ L  S++  A   Q DK    LS AV+    +   +  S+   T R ++E LG V +I
Sbjct: 14  FQELSTSVSQKAQEAQLDKKFKDLSQAVSQRTQDLTTSLPSLAQSTQRLVQERLGQVTDI 73

Query: 64  SKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWS--GSKEGWF 121
           S+LP +Y+ LE + D +    +  L VTQ +E E YDYP N+ +S +++     SK    
Sbjct: 74  SQLPQEYLELENRIDRIRLVYENFLKVTQVYEHESYDYPNNVRDSVNEFSKTVSSKLHEL 133

Query: 122 GSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDD 181
                 ++ ++ + + G +KD   P++   A++K +    E    S            +D
Sbjct: 134 SHASSTDEAQNILISPGPAKD---PKTLNYALSKVALTSSEYLSKS----------GHED 180

Query: 182 VNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLK 241
             +       S     I + + + D  I  +FN KL + L  D  K    R +VEN RL+
Sbjct: 181 ETIATALLKYSDVQAKIAQARLQQDTLIQTKFNKKLRETLASDLNKAVKARKEVENKRLQ 240

Query: 242 FDTMR 246
           +D  R
Sbjct: 241 YDIAR 245

 Score = 34.7 bits (78), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 24/44 (54%)

Query: 321 LEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYR 364
           +E LEDEF   T +A   M  ++  SE L+ +    + QL YY+
Sbjct: 263 MESLEDEFAQATEDATGVMQDVIASSEFLKDLSELVSAQLAYYK 306

>NDAI0A02660 Chr1 (599113..600207) [1095 bp, 364 aa] {ON} Anc_7.221
          Length = 364

 Score = 77.4 bits (189), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 97/205 (47%), Gaps = 19/205 (9%)

Query: 51  RYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPES-- 108
           R ++E LG V +IS+LP +Y+ LERK D ++      L VT TFE + YDYP    ES  
Sbjct: 45  RMVQERLGQVTDISQLPEEYLQLERKIDTIKSVYDNFLSVTNTFEHQSYDYPNVARESVI 104

Query: 109 -FSDWWSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNS 167
            FS       E    +T   E    +I T+ S++    P++   A++KAS    E     
Sbjct: 105 EFSKSAVSKVEELSHATSASE--AQQILTNNSNQIK-EPKTLNYALSKASLISSEQL--- 158

Query: 168 QKSEKKQIDEDED-----DVNLV-EMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLL 221
                KQ   D+D     D  LV  +    S     I + + + D  I ++FN+ L   L
Sbjct: 159 ----NKQFSTDDDNNSNSDFKLVSSILLKFSDIQAKIAQARLQQDLLIKQKFNNNLRNDL 214

Query: 222 NRDFKKIHVLRNKVENSRLKFDTMR 246
           N  F++   +R  V+N RL++D  R
Sbjct: 215 NTSFERAQKVRKDVQNKRLQYDVAR 239

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 21/44 (47%)

Query: 321 LEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYR 364
           +E LED+F   T  A   M  I+E S  +  +      QL YY+
Sbjct: 257 MELLEDQFAQATEHATLVMNEIIENSNFMEYLNELARAQLAYYQ 300

>TDEL0H02240 Chr8 (377524..378540) [1017 bp, 338 aa] {ON} Anc_7.221
           YIL041W
          Length = 338

 Score = 75.9 bits (185), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 105/240 (43%), Gaps = 17/240 (7%)

Query: 9   SFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPP 68
           +F N  +S+          +S     ++ N P    S +   R ++E LG V +IS+LP 
Sbjct: 3   TFNNFTNSLNQKFQELSTAVSQRTQEISTNLPSLTQSTQ---RLVQERLGQVTDISQLPR 59

Query: 69  QYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDW--WSGSKEGWFGSTKQ 126
           +Y+ LERK D ++   +  L VT  +E E YDYP  + ES +D+      K         
Sbjct: 60  EYLELERKVDTIKLIYENFLHVTSIYENESYDYPKYVTESVNDFSKIVAHKVQELSHASS 119

Query: 127 DEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVE 186
             + ++ + T   +K+   PR+   A++K S    E Y N           D D+  +  
Sbjct: 120 ASEAQNILITPTPAKE---PRTLNYALSKVSLISSE-YLNHIG--------DHDEAQVAS 167

Query: 187 MFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMR 246
           +    S     + + + + D  I   FN +L+  L  +FKK    R  VE  RL++D  R
Sbjct: 168 VLLKYSDLQAKVAQARLQQDTMIQTRFNKQLKDNLEHNFKKAQKARKDVEYKRLQYDVAR 227

>ADL115W Chr4 (483164..484165) [1002 bp, 333 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL041W
          Length = 333

 Score = 73.9 bits (180), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 64/239 (26%), Positives = 109/239 (45%), Gaps = 28/239 (11%)

Query: 11  KNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPPQY 70
           K L D   + + RTQD  SN  +             +T  R ++E LG V +IS++P +Y
Sbjct: 32  KKLKDLSLSVSQRTQDLTSNLPSLA-----------QTTQRRVQERLGQVTDISQMPEEY 80

Query: 71  VLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPES---FSDWWSGSKEGWFGSTKQD 127
           V LE++ D  +      L V+Q +E E YDYP ++ +S   FS   +G  +    +T   
Sbjct: 81  VELEQRVDRTKLIYDNFLKVSQIYESESYDYPQHISDSVNDFSKTVTGKVQELTKATT-T 139

Query: 128 EDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEM 187
           E+ +S + + G +++   P++   A++K +    E    S            DDV   ++
Sbjct: 140 EEAQSILISPGPARN---PKTLNYALSKVALTSSEYLSKS----------GSDDVVTADI 186

Query: 188 FNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMR 246
               S     I + + + D  I   FN +L + LN  F +    R +V+  RL++D  R
Sbjct: 187 LLKYSDVQAKIAQARLQQDTLIQTRFNRRLREKLNTQFAEAMQSRKQVDQKRLQYDIAR 245

>Ecym_4377 Chr4 complement(796971..797972) [1002 bp, 333 aa] {ON}
           similar to Ashbya gossypii ADL115W
          Length = 333

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 56/204 (27%), Positives = 99/204 (48%), Gaps = 19/204 (9%)

Query: 47  KTRTRYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLP 106
           +T  R ++E LG + +IS++P +YV +E++ D +    +  L VTQ +E E YDYP ++ 
Sbjct: 57  QTTHRMVQEKLGQITDISQMPEEYVHMEKRVDKIRLIYENFLKVTQIYESETYDYPQHVS 116

Query: 107 ES---FSDWWSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEA 163
           ES    S   +G  +    +T   E+ ++ + + G +KD   P++   A++K S    E 
Sbjct: 117 ESVNEISKTVTGKIQELTKATS-TEEAQNILISPGPAKD---PKTLNYALSKVSLTSSEY 172

Query: 164 YQNSQKSEKKQIDEDEDDVNL-VEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLN 222
              S             D N+  ++    S     I + + + D  I   FN +L++ LN
Sbjct: 173 LSKSG-----------SDSNVTADILLKYSDIQAQIAQARLQQDMLIRTRFNKQLKEKLN 221

Query: 223 RDFKKIHVLRNKVENSRLKFDTMR 246
            +F      R +V+N RL++D  R
Sbjct: 222 NEFAAAARARKEVDNKRLQYDIAR 245

>KAFR0I01950 Chr9 (398299..399291) [993 bp, 330 aa] {ON} Anc_7.221
           YIL041W
          Length = 330

 Score = 71.6 bits (174), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 66/248 (26%), Positives = 114/248 (45%), Gaps = 29/248 (11%)

Query: 3   EYFSSFS--FKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAV 60
           E+ +SF+  F+ L  S++    RTQ+ LSN       N P    S +   R ++E LG V
Sbjct: 6   EFTNSFTKRFQELSTSVS---QRTQE-LSN-------NLPTLAQSTQ---RLVQEKLGQV 51

Query: 61  DEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWS--GSKE 118
            +IS+LP +Y+ LE+K D+++   +  L VT  +E E YDYP  + +S +D+     +K 
Sbjct: 52  TDISQLPQEYLELEKKVDSIKLIHEHFLQVTSIYENESYDYPKVIKDSVNDFSKTMAAKI 111

Query: 119 GWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDED 178
                     + ++ + + G  +D   P++   A++K S    E           Q+   
Sbjct: 112 TDLSHASSASEAQNILISPGPIRD---PKTLNYALSKVSLTASEVI--------NQVGST 160

Query: 179 EDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENS 238
            ++  L       S     I + + + D  I  +FN  L   L+    K +  R +V+N 
Sbjct: 161 PNESALSSKLLEFSNVQSKIAQARLQQDTLIQTKFNKALRDDLSTSLAKANKFRKEVQNK 220

Query: 239 RLKFDTMR 246
           RL++D  R
Sbjct: 221 RLQYDVAR 228

 Score = 31.6 bits (70), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 16/51 (31%), Positives = 25/51 (49%)

Query: 321 LEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEME 371
           +E LEDEF   T  A   M  ++ GS+ L  +      QL Y++   Q ++
Sbjct: 246 MESLEDEFAQATENATLVMQEVIAGSDFLTSLNQMVAAQLEYFQTSAQLLQ 296

>Kpol_1070.19 s1070 (45405..46340) [936 bp, 311 aa] {ON}
           (45405..46340) [936 nt, 312 aa]
          Length = 311

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/201 (26%), Positives = 96/201 (47%), Gaps = 14/201 (6%)

Query: 51  RYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFS 110
           R ++E LG V +IS+LP +Y+ LER+ D ++   +  L +T  +E E YDYP  + +S +
Sbjct: 41  RLVQEKLGNVTDISQLPQEYIELERQVDTIKLVYEHFLQITAIYENESYDYPKYVSDSVN 100

Query: 111 DWWS--GSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQ 168
           D+     +K          ++ ++ + T G +K+   PR+   A++K +        NS 
Sbjct: 101 DFSKVFANKVTELSHATSAQEAQNILVTPGPAKE---PRTLNYALSKVAL-------NSS 150

Query: 169 KSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKI 228
           +S  +  D +E  V   +     S     I + +   D  I  +FN +L + L  D  K 
Sbjct: 151 ESLAQLADPNEGPV--ADALLKFSDVQAKIAQTRLHQDTLIQTKFNKQLREKLELDIGKA 208

Query: 229 HVLRNKVENSRLKFDTMRYEM 249
              R  V+  RL++D  R ++
Sbjct: 209 SKARKDVQYKRLQYDVARSKL 229

>KNAG0D01760 Chr4 (296169..297197) [1029 bp, 342 aa] {ON} Anc_7.221
           YIL041W
          Length = 342

 Score = 64.7 bits (156), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 49/200 (24%), Positives = 87/200 (43%), Gaps = 7/200 (3%)

Query: 47  KTRTRYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLP 106
           +T  R ++E LG V +IS+LP +Y+ LE++ DAL+   +  L VT  +E E YDYP  + 
Sbjct: 38  QTTQRLVQEKLGQVTDISQLPQEYLELEKRVDALKLVHEHFLQVTAIYENESYDYPKYVR 97

Query: 107 ESFSDWWSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQN 166
           +S ++ WS +        +             +      P++   A++K       A   
Sbjct: 98  DSVNE-WSRTVATRVSELRHVSSAAEAQHVIAAPTQETEPKTLHYALSKV------ALNG 150

Query: 167 SQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFK 226
           SQ  +         +  L       S     + + + E D ++  +FN+KL   L+ +  
Sbjct: 151 SQLVDNLDAPRTPRETQLSSGLLEFSGVEAELAQARLEQDAAVKAQFNEKLRGQLSGEIA 210

Query: 227 KIHVLRNKVENSRLKFDTMR 246
           +    R +V   RL++D  R
Sbjct: 211 RAAAARKEVFQKRLQYDVAR 230

>CAGL0L00891g Chr12 (108801..109826) [1026 bp, 341 aa] {ON} similar
           to uniprot|P40531 Saccharomyces cerevisiae YIL041w
          Length = 341

 Score = 63.9 bits (154), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 57/238 (23%), Positives = 105/238 (44%), Gaps = 20/238 (8%)

Query: 15  DSIANAAHRTQDKLSNAVAN----VNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPPQY 70
           +S AN+        SN V+     ++ N P    S +   R ++E LG V +IS+LP +Y
Sbjct: 5   NSFANSLRENLQSFSNTVSQKTHELSTNIPTLAQSTQ---RMVQEKLGQVTDISQLPQEY 61

Query: 71  VLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWS--GSKEGWFGSTKQDE 128
           + LE K D ++   +  L VT  +E E YDYP  + ES +++     +K           
Sbjct: 62  LELENKVDTIKIVYEHFLQVTAVYENESYDYPKYVSESVNEFSKNMAAKVQELSKATSAT 121

Query: 129 DGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMF 188
           + ++ +   G  K+   P++   A++K +    E   +S         +D  D  L ++ 
Sbjct: 122 EAQNILVAPGPVKE---PKTLNYAMSKVALNASEYLNHS--------FDDPMDAKLSKVL 170

Query: 189 NTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMR 246
              S     + + + + D  I  +FN  + + L     + +  R  V++ RL++D  R
Sbjct: 171 LNYSDVQTKVAQARLQQDTQIQTKFNKVIRENLAESIARANKARKDVQSKRLQYDVAR 228

 Score = 32.0 bits (71), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 16/50 (32%), Positives = 24/50 (48%)

Query: 321 LEQLEDEFVSNTSEAVETMTSIVEGSEILRLMKLFQNLQLVYYRQCVQEM 370
           +E LED+F   T +A   M  ++  +  L  +K     QL YY Q  + M
Sbjct: 246 METLEDQFAQATEDATVVMQEVIASANFLPSLKELATAQLEYYEQSAKLM 295

>TPHA0B02750 Chr2 (627808..628899) [1092 bp, 363 aa] {ON} Anc_7.221
           YIL041W
          Length = 363

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 50/196 (25%), Positives = 86/196 (43%), Gaps = 20/196 (10%)

Query: 51  RYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFS 110
           R +KE LG   +IS LP +YV LE K D +++  +  L VT  +E E YDYP    ESF 
Sbjct: 37  RLMKEKLGQAKDISTLPQEYVELETKIDTMKEIYEHFLKVTMVYEKESYDYPKEFGESFW 96

Query: 111 DWWSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKS 170
           ++     E +      + + + KI           P++   A+                 
Sbjct: 97  EFTDSVGEKFSALNISEHNNKVKI-----------PKTLNYALHNVFLTAN--------- 136

Query: 171 EKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHV 230
           EK ++  +  D +L E   +LS    +I E +   D  +    N +L++ L+++F++   
Sbjct: 137 EKVKLLHEPLDNSLSETLASLSETEADIAEARLHQDSLVKSRINYQLKEELSQNFERAAK 196

Query: 231 LRNKVENSRLKFDTMR 246
            R  V + R  +D  +
Sbjct: 197 YRKAVHHKRFNYDVAK 212

>TBLA0D04200 Chr4 (1038483..1039478) [996 bp, 331 aa] {ON} Anc_7.221
           YIL041W
          Length = 331

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/244 (23%), Positives = 104/244 (42%), Gaps = 13/244 (5%)

Query: 8   FSFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETLGAVDEISKLP 67
            SF NL  SI  A     + +S     +    P      + + R  +E LG + +IS++P
Sbjct: 1   MSFNNLKSSIGQALQGLSESVSQKTQEMASTWPAY---AQVQQRLAQEKLGQITDISQMP 57

Query: 68  PQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFGSTKQD 127
            +Y+ LE + D L+ + + +L VT+ +E   YD+P +  ES  DW         GS  Q+
Sbjct: 58  REYIDLEDRIDNLQNSIQVLLHVTRVYEEPAYDWPYSTQESVQDWSRA-----IGSRVQE 112

Query: 128 EDGESKIQTDGS-SKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVE 186
               S     G+  K P+ P +  + +  A  +   A      S     + +     L+ 
Sbjct: 113 LSRASSASEAGNLLKSPVGPENGPRTLNYALSQASLAVSTLTSSNMPGPNGEGLSSGLIA 172

Query: 187 MFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMR 246
             +T +     + + +   D  +  +FN +L ++LN    K +  R  V+  R+ +D  R
Sbjct: 173 YSDTQA----KLAQIRIAQDTQVQTKFNKQLREILNNPIAKANKYRKDVQYKRVLYDIAR 228

Query: 247 YEMR 250
             ++
Sbjct: 229 TNLQ 232

>NCAS0A13380 Chr1 complement(2633641..2634630) [990 bp, 329 aa] {ON}
           Anc_7.221
          Length = 329

 Score = 61.6 bits (148), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 59/238 (24%), Positives = 110/238 (46%), Gaps = 19/238 (7%)

Query: 15  DSIANAAHRTQDKLSNAVAN----VNLNDPQTRLSIKTRTRYLKETLGAVDEISKLPPQY 70
           +S  N+  +T  +LS+ V+     ++ N P    S +   R ++E LG V +IS+LP +Y
Sbjct: 5   NSFTNSFSKTLSELSSTVSQKTQELSTNLPNLAQSTQ---RMVQERLGQVTDISQLPEEY 61

Query: 71  VLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDW--WSGSKEGWFGSTKQDE 128
           + LE K D++++     L V+  +E + YDYP    ES  ++   + SK           
Sbjct: 62  LELEMKLDSIKQIYDNFLAVSSVYEQQSYDYPYVAKESLIEFSKTAASKVEELSHASSAH 121

Query: 129 DGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEKKQIDEDEDDVNLVEMF 188
           + ++ + T  SS     P++   A++K + +  E           Q +++E   +     
Sbjct: 122 EAQNILTT--SSTQIKEPKTLNFALSKVALKSSEHL--------NQFNDNEAFKSSASAL 171

Query: 189 NTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKIHVLRNKVENSRLKFDTMR 246
              S     I + + + D  I ++FND L   L  +  K   +R +V++ RL++D  R
Sbjct: 172 LNFSNIQAKIAQARLQQDLLIKQKFNDALRHDLATNIAKATKVRKEVQSKRLQYDIAR 229

>Suva_9.159 Chr9 (265174..266151) [978 bp, 325 aa] {ON} YIL041W
           (REAL)
          Length = 325

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/198 (25%), Positives = 86/198 (43%), Gaps = 14/198 (7%)

Query: 51  RYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFS 110
           R ++E LG V +IS+LP +Y  LE K D ++      L VT  +E   YDYP  + ES +
Sbjct: 37  RMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVN 96

Query: 111 DWWS--GSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQ 168
           ++ S   SK             ++ +   G  K+   P++   A++K +    E      
Sbjct: 97  EFSSSLASKLTELTHATSASQAQNILVAPGPIKE---PKTLNYALSKVALNSSECLNKMF 153

Query: 169 KSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKI 228
            +E++          L       S     I + + + D  I  +FN KL + ++ +  K 
Sbjct: 154 PTEEQP---------LASSLLQFSDVQAKIAQARIQQDTLIQTKFNKKLRERVSFEIGKA 204

Query: 229 HVLRNKVENSRLKFDTMR 246
              R +V + RL++D  R
Sbjct: 205 DKCRKEVHSMRLRYDVAR 222

>Skud_9.128 Chr9 (245338..246327) [990 bp, 329 aa] {ON} YIL041W
           (REAL)
          Length = 329

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 51/198 (25%), Positives = 85/198 (42%), Gaps = 14/198 (7%)

Query: 51  RYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFS 110
           R ++E LG V +IS+LP +Y  LE K D ++      L VT  +E   YDYP  + ES +
Sbjct: 37  RMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVN 96

Query: 111 DWWS--GSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQ 168
           ++     SK           + ++ +   G  K+   P++   A++K S    E      
Sbjct: 97  EFSRSVASKLTELTHATSASEAQNILVAPGPIKE---PKTLNYALSKVSLNSSECLNKMF 153

Query: 169 KSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKI 228
            +E++          L       S     I + + + D  I  +FN KL + L+ +  K 
Sbjct: 154 PAEEQP---------LASALLQFSDVQAKIAQTRIQQDTLIQTKFNKKLRERLSFEIGKA 204

Query: 229 HVLRNKVENSRLKFDTMR 246
              R  V + RL++D  R
Sbjct: 205 DKCRKDVHSMRLRYDVAR 222

>TBLA0B01580 Chr2 (345206..346366) [1161 bp, 386 aa] {ON} Anc_7.221
           YIL041W
          Length = 386

 Score = 57.0 bits (136), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/212 (24%), Positives = 99/212 (46%), Gaps = 29/212 (13%)

Query: 53  LKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFSDW 112
           ++E  G V +IS LP +Y+ LE++ D+++      L +T  +E E YDYP ++ +S +++
Sbjct: 1   MQEKFGQVTDISPLPQEYLDLEQQVDSIKLVYDHFLRITTVYENESYDYPKDVRDSITEF 60

Query: 113 W-SGSKEGWFGSTK------------QDEDGESKIQTDGS--SKDPLMPRSFAQAIAKAS 157
             + S       TK              E   + + + GS  + +   PR+   A++KA+
Sbjct: 61  QKTASSRVQELQTKISNSSDNSHSSGSVEPMRTSVSSVGSINNYNQNSPRTLNNALSKAA 120

Query: 158 HECGEAYQNSQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKL 217
                        E+ ++D+D   V     F++ S     I + + + DK I + FN +L
Sbjct: 121 LFAA---------EQLKMDKDSSTV-----FHSFSEAESIISDERIKQDKIIQKSFNTEL 166

Query: 218 EQLLNRDFKKIHVLRNKVENSRLKFDTMRYEM 249
           + +L       +  R  V+N RL++D  R ++
Sbjct: 167 KNVLTNRIDVANKHRKDVQNKRLQYDISRTKL 198

>Smik_9.150 Chr9 (250717..251697) [981 bp, 326 aa] {ON} YIL041W
           (REAL)
          Length = 326

 Score = 56.6 bits (135), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 84/198 (42%), Gaps = 14/198 (7%)

Query: 51  RYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFS 110
           R ++E LG V +IS+LP +Y  LE K D ++      L VT  +E   YDYP  + ES +
Sbjct: 37  RMVQERLGQVTDISQLPREYTELEEKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVN 96

Query: 111 DWWS--GSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQ 168
           ++     SK           + ++ +   G  K+   P++   A++K +    E      
Sbjct: 97  EFSRSVASKLTELTHATSASEAQNILVAPGPIKE---PKTLNYALSKVALNSSECLNKML 153

Query: 169 KSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKI 228
            +E++          L       S     I + + + D  I  +FN  L + L+ +  K 
Sbjct: 154 PTEEQP---------LASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKA 204

Query: 229 HVLRNKVENSRLKFDTMR 246
              R  V + RL++D  R
Sbjct: 205 DKTRKDVHSMRLRYDVAR 222

>TPHA0C01230 Chr3 (280944..281861) [918 bp, 305 aa] {ON} Anc_7.221
           YIL041W
          Length = 305

 Score = 56.2 bits (134), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 54/212 (25%), Positives = 100/212 (47%), Gaps = 23/212 (10%)

Query: 45  SIKTRT-RYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPP 103
           SI + T R ++E LG V +IS+LP +Y+ LE++ D ++   +  L +T  ++ E YDYP 
Sbjct: 34  SIASSTQRLVQEKLGNVTDISQLPQEYLELEKEIDTIKLVYEHFLKITSIYDNESYDYPK 93

Query: 104 NLPESFSDW--WSGSKEGWFGSTKQDEDGESKIQTDGSSKDPLM-PRSFAQAIAKASHEC 160
            + +S +D+     SK          E+ ++ + T G    P+  PR+   A++K +   
Sbjct: 94  YVSDSVNDYSKLFQSKIEDLSRATSAEEAQNILVTPG----PITEPRTLNYALSKVALTS 149

Query: 161 GEAYQNSQKSEKKQIDEDEDDVNLVEMFNTL---SICYRNIDEGKDEMDKSIAREFNDKL 217
            E+    Q            D N+  + +TL   S     I + + + D  I  + N  +
Sbjct: 150 SESLNQLQ------------DPNVSAVASTLLKFSDMQTKIAQQRLQQDTLIQTKVNKVI 197

Query: 218 EQLLNRDFKKIHVLRNKVENSRLKFDTMRYEM 249
           ++ L+   +K    R  V+  RL++D  R ++
Sbjct: 198 KEKLSSLIEKATKSRRDVQYKRLQYDVARSKL 229

>YIL041W Chr9 (276525..277505) [981 bp, 326 aa] {ON}  GVP36BAR
           domain-containing protein that localizes to both early
           and late Golgi vesicles; required for adaptation to
           varying nutrient concentrations, fluid-phase
           endocytosis, polarization of the actin cytoskeleton, and
           vacuole biogenesis
          Length = 326

 Score = 55.5 bits (132), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/198 (24%), Positives = 84/198 (42%), Gaps = 14/198 (7%)

Query: 51  RYLKETLGAVDEISKLPPQYVLLERKSDALEKACKRMLLVTQTFEVEGYDYPPNLPESFS 110
           R ++E LG V +IS+LP +Y  LE K D ++      L VT  +E   YDYP  + ES +
Sbjct: 37  RMVQERLGQVTDISQLPREYTELEDKVDTIKLIYNHFLGVTAIYENGSYDYPKYINESVN 96

Query: 111 DWWS--GSKEGWFGSTKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQ 168
           ++     SK           + ++ +   G  K+   P++   A++K +    E      
Sbjct: 97  EFSRSVASKLTELTHATSASEAQNILVAPGPIKE---PKTLNYALSKVALNSSECLNKMF 153

Query: 169 KSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQLLNRDFKKI 228
            +E++          L       S     I + + + D  I  +FN  L + L+ +  K 
Sbjct: 154 PTEEQP---------LASALLQFSDVQAKIAQARIQQDTLIQTKFNKNLRERLSFEIGKA 204

Query: 229 HVLRNKVENSRLKFDTMR 246
              R  V + RL++D  R
Sbjct: 205 DKCRKDVHSMRLRYDVAR 222

>TDEL0F01760 Chr6 complement(328784..330913) [2130 bp, 709 aa] {ON}
           Anc_6.175 YPL180W
          Length = 709

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 56/119 (47%), Gaps = 14/119 (11%)

Query: 26  DKLSNAVANVNLNDPQTRLSIKTRTRYLKETLG------AVDEISKLPPQYVLLERKSDA 79
           D +SN+  NV   +  +  S+K + R   E +G       V+ +    P + + +R SD 
Sbjct: 291 DHISNSNLNVYDTETLSAHSLKRQGREFNE-MGEDEERNTVEAVPHQDPPFEVQDRNSD- 348

Query: 80  LEKACKRMLLVTQTFEVEGYDYPPNLPESFSDWWSGSKEGWFGSTKQDEDGESKIQTDG 138
           +E+    M+L   T  V  ++ PP++  S S+ +        GS ++D+    +I ++G
Sbjct: 349 IEQYMPSMILSQSTGAVRRFEQPPSIQNSLSNNYHN------GSIEEDDGNGDQIDSNG 401

>NDAI0D03130 Chr4 (742587..747074) [4488 bp, 1495 aa] {ON} Anc_4.340
          Length = 1495

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 31/64 (48%), Gaps = 11/64 (17%)

Query: 18   ANAAHRTQDKLSNAVANVNLNDPQTR----LSIK-------TRTRYLKETLGAVDEISKL 66
            A A H+     S  +A VNL DPQ +    L++K        +  Y KE L  + ++ ++
Sbjct: 1430 AVAHHKLSKDKSLGIAQVNLGDPQIQKDENLALKLNDGHVIIKLDYAKEALENIPDVPQI 1489

Query: 67   PPQY 70
            P QY
Sbjct: 1490 PEQY 1493

>TPHA0F00260 Chr6 (50020..51600) [1581 bp, 526 aa] {ON} Anc_4.21
           YHL027W
          Length = 526

 Score = 30.4 bits (67), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 27/43 (62%)

Query: 162 EAYQNSQKSEKKQIDEDEDDVNLVEMFNTLSICYRNIDEGKDE 204
           E +  +QKS  K  D++ D+  LVE F+ LS+  RN ++ +D+
Sbjct: 428 EVFSTTQKSCGKMHDDENDEPALVESFSGLSVDVRNNEDDEDD 470

>TBLA0B04870 Chr2 (1146824..1148233) [1410 bp, 469 aa] {ON} Anc_8.85
           YPL004C
          Length = 469

 Score = 30.4 bits (67), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 17/49 (34%), Positives = 30/49 (61%), Gaps = 6/49 (12%)

Query: 9   SFKNLGDSIANAAHRTQDKLSNAVANVNLNDPQTRLSIKTRTRYLKETL 57
           S +N+  S+    +R +DK++NA+AN+   DPQ+     T+ R L++ L
Sbjct: 131 SIRNIEASVQPTRYR-KDKITNAIANLKYRDPQS-----TKIRGLEQEL 173

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
           YFR031C
          Length = 1170

 Score = 30.4 bits (67), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 69/126 (54%), Gaps = 11/126 (8%)

Query: 124 TKQDEDGESKIQTDGSSKDPLMPRSFAQAIAKASHECGEAYQNSQKSEK--KQIDEDEDD 181
           T+  E+ ESK+Q   S ++ L   +    +A+ S E  +A    +K+E+  K+IDE + +
Sbjct: 701 TRDLEEQESKLQKTRSVRNDLNLATHKLTLAQRSLESNQAAHIIRKNEELIKEIDESQKE 760

Query: 182 VNLVEMFNTLSICYRNIDEGKDEMDKSIAREFNDKLEQL---LNRDFKKIHVLRNKVENS 238
           +      +++S C + I   + ++ +  + +   KL+QL   +++ FK+I +L  KVE+ 
Sbjct: 761 I--ASKRSSISDCEKEIQRIQTDI-QEFSTDKGSKLKQLKDEVSKLFKEIGILETKVES- 816

Query: 239 RLKFDT 244
             K+D+
Sbjct: 817 --KYDS 820

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.127    0.351 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,310,911
Number of extensions: 1732272
Number of successful extensions: 7534
Number of sequences better than 10.0: 112
Number of HSP's gapped: 7807
Number of HSP's successfully gapped: 138
Length of query: 382
Length of database: 53,481,399
Length adjustment: 111
Effective length of query: 271
Effective length of database: 40,753,473
Effective search space: 11044191183
Effective search space used: 11044191183
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 67 (30.4 bits)