Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D09988g3.492ON99499443040.0
YGR130C3.492ON8163595903e-63
Smik_6.2263.492ON8393545843e-62
Suva_7.4183.492ON8313385816e-62
Skud_7.4413.492ON8073645743e-61
CAGL0I10516g3.492ON8133755568e-59
NCAS0E008103.492ON6923495446e-58
SAKL0F02772g3.492ON7733435433e-57
TDEL0D056003.492ON7003145341e-56
NDAI0G009403.492ON6563284418e-45
KLLA0D16236g3.492ON8713594424e-44
Kpol_480.143.492ON6993444171e-41
KLTH0F14828g3.492ON8363644192e-41
Kwal_55.212293.492ON7873593674e-35
TPHA0D042503.492ON6292753582e-34
KNAG0B008103.492ON7572722523e-21
Ecym_12373.492ON7272862193e-17
TBLA0C044803.492ON802921997e-15
KAFR0C019603.492ON5632671961e-14
AFR310C3.492ON6232751942e-14
KAFR0G036903.492ON363981422e-08
KNAG0A079403.492ON2751481242e-06
NDAI0B058603.492ON68162970.007
NCAS0F035503.492ON44164920.024
TPHA0F012502.253ON127896850.23
Smik_14.651.81ON79038800.90
KNAG0A043208.443ON153095754.1
Kwal_56.225993.111ON24676715.9
Kwal_49.19399singletonON24676715.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= ZYRO0D09988g
         (994 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly...  1662   0.0  
YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON} C...   231   3e-63
Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON...   229   3e-62
Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON...   228   6e-62
Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON...   225   3e-61
CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} simi...   218   8e-59
NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.4...   214   6e-58
SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} simila...   213   3e-57
TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa] ...   210   1e-56
NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.4...   174   8e-45
KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]...   174   4e-44
Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON} (29882..3...   165   1e-41
KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]...   166   2e-41
Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {...   145   4e-35
TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {O...   142   2e-34
KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.4...   101   3e-21
Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar t...    89   3e-17
TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa] ...    81   7e-15
KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {O...    80   1e-14
AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}...    79   2e-14
KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {O...    59   2e-08
KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {...    52   2e-06
NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa] ...    42   0.007
NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {O...    40   0.024
TPHA0F01250 Chr6 (286089..289925) [3837 bp, 1278 aa] {ON} Anc_2....    37   0.23 
Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {O...    35   0.90 
KNAG0A04320 Chr1 complement(591254..595846) [4593 bp, 1530 aa] {...    33   4.1  
Kwal_56.22599 s56 (197120..197860) [741 bp, 246 aa] {ON} YOL088C...    32   5.9  
Kwal_49.19399 s49 complement(145..885) [741 bp, 246 aa] {ON} YOL...    32   5.9  

>ZYRO0D09988g Chr4 (842706..845690) [2985 bp, 994 aa] {ON} weakly
           similar to uniprot|P53278 Saccharomyces cerevisiae
           YGR130C Protein of unknown function green fluorescent
           protein (GFP)-fusion protein localizes to the cytoplasm
           in a punctate pattern
          Length = 994

 Score = 1662 bits (4304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 849/994 (85%), Positives = 849/994 (85%)

Query: 1   MFRSKRPDPFTGLYEEAHRREQARKGTFLTQVVNSDGANLLDVADXXXXXXXXXXXXXXX 60
           MFRSKRPDPFTGLYEEAHRREQARKGTFLTQVVNSDGANLLDVAD               
Sbjct: 1   MFRSKRPDPFTGLYEEAHRREQARKGTFLTQVVNSDGANLLDVADRAEKSPSIKSSSRAS 60

Query: 61  XXXXHLGEFASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAK 120
               HLGEFASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAK
Sbjct: 61  ARKSHLGEFASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAK 120

Query: 121 DIQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDYTEXXXXXXXXXXXXXXXXX 180
           DIQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDYTE                 
Sbjct: 121 DIQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDYTEGGKKKSGAKKGVKSTKS 180

Query: 181 XXXXXXXXXXXXXXVSKSNDELETIPDNEVGSQYTFETLPDGASYDYLIETEEVPAGAAH 240
                         VSKSNDELETIPDNEVGSQYTFETLPDGASYDYLIETEEVPAGAAH
Sbjct: 181 KPSAKSPGKPAIKAVSKSNDELETIPDNEVGSQYTFETLPDGASYDYLIETEEVPAGAAH 240

Query: 241 GKMSSKPVKLVRKGEKESKKEEATPDAESFNSKGPSPEPATPEAGLKSKAEEQAGNELKE 300
           GKMSSKPVKLVRKGEKESKKEEATPDAESFNSKGPSPEPATPEAGLKSKAEEQAGNELKE
Sbjct: 241 GKMSSKPVKLVRKGEKESKKEEATPDAESFNSKGPSPEPATPEAGLKSKAEEQAGNELKE 300

Query: 301 VPXXXXXXXXXXXXXXXXXXDVVGDEKAEKAEKTENLLDRSEPLDAAKDSADKATRFKEG 360
           VP                  DVVGDEKAEKAEKTENLLDRSEPLDAAKDSADKATRFKEG
Sbjct: 301 VPETSSTSKKAESKVESSAKDVVGDEKAEKAEKTENLLDRSEPLDAAKDSADKATRFKEG 360

Query: 361 PVEKIPDTVIGDETLEIAPEKGAHGAAADVKKGAKEAKKQSESDEGVVEATKVAAGEPES 420
           PVEKIPDTVIGDETLEIAPEKGAHGAAADVKKGAKEAKKQSESDEGVVEATKVAAGEPES
Sbjct: 361 PVEKIPDTVIGDETLEIAPEKGAHGAAADVKKGAKEAKKQSESDEGVVEATKVAAGEPES 420

Query: 421 YEGAGVTENDSTPGXXXXXXXXXXXXXXXXXXYAAVPRVVTFPEVEKKRSIFSIFGRKKK 480
           YEGAGVTENDSTPG                  YAAVPRVVTFPEVEKKRSIFSIFGRKKK
Sbjct: 421 YEGAGVTENDSTPGPMVDDVHSDVSVTSPPVDYAAVPRVVTFPEVEKKRSIFSIFGRKKK 480

Query: 481 SQNRAPNPLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEK 540
           SQNRAPNPLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEK
Sbjct: 481 SQNRAPNPLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEK 540

Query: 541 QVDYDNRXXXXXXXXXXXXXSMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFH 600
           QVDYDNR             SMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFH
Sbjct: 541 QVDYDNRLEELKKEVEKLEESMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFH 600

Query: 601 ETKAIQDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMY 660
           ETKAIQDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMY
Sbjct: 601 ETKAIQDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMY 660

Query: 661 SLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHEID 720
           SLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHEID
Sbjct: 661 SLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHEID 720

Query: 721 DKISNLLGELSVIKQESANEKLKLGSITKKLESERQAHXXXXXXXXXXXXXXXXXXXXXQ 780
           DKISNLLGELSVIKQESANEKLKLGSITKKLESERQAH                     Q
Sbjct: 721 DKISNLLGELSVIKQESANEKLKLGSITKKLESERQAHEEQLKLEAEERERKEKDLLGKQ 780

Query: 781 REEHEAVAAGLKKQHEEELRKMKQDYEKRLQELKEHQSKQXXXXXXXXXXXXXXXXHGGV 840
           REEHEAVAAGLKKQHEEELRKMKQDYEKRLQELKEHQSKQ                HGGV
Sbjct: 781 REEHEAVAAGLKKQHEEELRKMKQDYEKRLQELKEHQSKQTAEAEATKARAAENETHGGV 840

Query: 841 ATHSVKXXXXXXXXXTDGIKSTGAKSTGAKSTGAKSTDAKSTGAKSTDAKSTDAKPNATK 900
           ATHSVK         TDGIKSTGAKSTGAKSTGAKSTDAKSTGAKSTDAKSTDAKPNATK
Sbjct: 841 ATHSVKSSGASGASGTDGIKSTGAKSTGAKSTGAKSTDAKSTGAKSTDAKSTDAKPNATK 900

Query: 901 SGVGATTKSTGPQATDSTSGKVHNPFTDSGVTKSKETRELTDNQGKPSGVVPYGSNVASG 960
           SGVGATTKSTGPQATDSTSGKVHNPFTDSGVTKSKETRELTDNQGKPSGVVPYGSNVASG
Sbjct: 901 SGVGATTKSTGPQATDSTSGKVHNPFTDSGVTKSKETRELTDNQGKPSGVVPYGSNVASG 960

Query: 961 STANDNRNTKQNPSASRESSLFDYETEEEIRSVY 994
           STANDNRNTKQNPSASRESSLFDYETEEEIRSVY
Sbjct: 961 STANDNRNTKQNPSASRESSLFDYETEEEIRSVY 994

>YGR130C Chr7 complement(751394..753844) [2451 bp, 816 aa] {ON}
           Component of the eisosome with unknown function;
           GFP-fusion protein localizes to the cytoplasm;
           specifically phosphorylated in vitro by mammalian
           diphosphoinositol pentakisphosphate (IP7)
          Length = 816

 Score =  231 bits (590), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 130/359 (36%), Positives = 212/359 (59%), Gaps = 6/359 (1%)

Query: 463 PEVEKKRSIFSIF-----GRKKKSQNRAP-NPLATPENPEILVKTDREGFLSKAVYDKVK 516
           P  +++  IF+++        +KS+  AP NP+ATPENPE++VKT   G+LSKAVYDK+ 
Sbjct: 367 PSRKERTGIFALWKSPTSSSTQKSKTAAPSNPVATPENPELIVKTKEHGYLSKAVYDKIN 426

Query: 517 YENHKHSEWLTEFISSEKKRYEEKQVDYDNRXXXXXXXXXXXXXSMQEIKDDANELIEIR 576
           Y+   H  WL +  + EK +Y+ K  +Y  +             SM+ ++++ +E IE+ 
Sbjct: 427 YDEKIHQAWLADLRAKEKDKYDAKNKEYKEKLQDLQNQIDEIENSMKAMREETSEKIEVS 486

Query: 577 HGRLSKKFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQKEIAALNAEKDN 636
             RL KK ++   ++  KK  I  +T+ +++QK +E +E+  +Q  V+ EI  LN EK N
Sbjct: 487 KNRLVKKIIDVNAEHNNKKLMILKDTENMKNQKLQEKNEVLDKQTNVKSEIDDLNNEKTN 546

Query: 637 IHREFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKET 696
           + +EF  WT  L++ S  LDA+++ ++ +  K  K Q +ID L  KK  L  +   +K+ 
Sbjct: 547 VQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQGKVQNEIDNLEKKKEDLVTQTEENKKL 606

Query: 697 HAKNTKAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKLESERQ 756
           H KN + +E   NKEYLP++++ID++IS+LL E+++IKQE+ANEK +L +ITK+LE ER+
Sbjct: 607 HEKNVQVLESVENKEYLPQINDIDNQISSLLNEVTIIKQENANEKTQLSAITKRLEDERR 666

Query: 757 AHXXXXXXXXXXXXXXXXXXXXXQREEHEAVAAGLKKQHEEELRKMKQDYEKRLQELKE 815
           AH                     QR+E E  A   +  HE+++ ++KQ Y  +L EL++
Sbjct: 667 AHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQQITQVKQTYNDQLTELQD 725

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/101 (45%), Positives = 67/101 (66%), Gaps = 6/101 (5%)

Query: 68  EFASPFRL------ESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKD 121
           E+ SPFR       ++N    E  + ++FPTVS  S +SK  PK+LGY+ + + ++RAKD
Sbjct: 52  EWVSPFRQDALANRQNNRAYGEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKD 111

Query: 122 IQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDYT 162
           I+FP YL +NE RQ QLLTE+E++E+ L Y+K  Q + D T
Sbjct: 112 IRFPTYLTQNEERQYQLLTELELKEKHLKYLKKCQKITDLT 152

>Smik_6.226 Chr6 complement(369198..371717) [2520 bp, 839 aa] {ON}
           YGR130C (REAL)
          Length = 839

 Score =  229 bits (584), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 125/354 (35%), Positives = 209/354 (59%), Gaps = 6/354 (1%)

Query: 468 KRSIFSIFGRK-----KKSQNRAP-NPLATPENPEILVKTDREGFLSKAVYDKVKYENHK 521
           K  IF+++        +KS   AP NP+ATPE PE++VKT   G+LSKAVYDK+ Y+   
Sbjct: 395 KTGIFALWKSSTSSSAQKSNTAAPSNPVATPEKPELIVKTKEHGYLSKAVYDKINYDEKV 454

Query: 522 HSEWLTEFISSEKKRYEEKQVDYDNRXXXXXXXXXXXXXSMQEIKDDANELIEIRHGRLS 581
           H  WLT+  + EK +Y+ K  +Y+ +             SM+ ++ + +E IE+   RL 
Sbjct: 455 HQAWLTDLRAREKAKYDAKNKEYEEKLQDLQNQIDEVEDSMKAMRKETSEKIEVSKNRLV 514

Query: 582 KKFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREF 641
           K+ ++    +  KK  IF +T+ +++QK +E + + ++Q  V+ +I  LN+EK N+ ++F
Sbjct: 515 KQIIDVNAAHNNKKLMIFKDTENMKNQKLEEKNVVLNKQTNVKSQIDELNSEKTNVQKDF 574

Query: 642 IGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNT 701
             WT  L++ S  LDA+++ ++ +  K +K Q +ID L  KK  L  +   +++ H KN 
Sbjct: 575 NDWTTNLSNLSQQLDAQIFKINQINLKQSKVQDEIDSLEQKKNALVTQTQENEKLHEKNV 634

Query: 702 KAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKLESERQAHXXX 761
           + +E   N+EYLP++++ID++IS LL E+++IKQE+ANEK +L +ITK+LE ER+AH   
Sbjct: 635 QVLESVENREYLPQINDIDNQISTLLNEMTIIKQENANEKTQLSAITKRLEDERRAHEEQ 694

Query: 762 XXXXXXXXXXXXXXXXXXQREEHEAVAAGLKKQHEEELRKMKQDYEKRLQELKE 815
                             QR+E E  A   +  HEE++ ++K+ Y  +L EL++
Sbjct: 695 LKLEAEERKRKEENLLEKQRQELEEQARQAQLDHEEQITQVKKTYNDQLTELQD 748

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 66/102 (64%), Gaps = 7/102 (6%)

Query: 68  EFASPFRLESNEKDAEKRRL-------QRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAK 120
           E+ SPFR ++        RL       ++FPTVS  S +SK  PK+LGY+ + + ++RAK
Sbjct: 52  EWISPFRQDALASKQNNNRLYVEDAKNRKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAK 111

Query: 121 DIQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDYT 162
           DI+FP YL +NE RQ QLLTE+E++E+ L Y+K  Q + D T
Sbjct: 112 DIRFPTYLTQNEERQYQLLTELELKEKHLQYLKKCQKITDLT 153

>Suva_7.418 Chr7 complement(721506..724001) [2496 bp, 831 aa] {ON}
           YGR130C (REAL)
          Length = 831

 Score =  228 bits (581), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 123/338 (36%), Positives = 202/338 (59%), Gaps = 1/338 (0%)

Query: 479 KKSQNRAP-NPLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRY 537
           KK    AP NP+ATPENPE++VKT   G+LSKAVYDK+ Y+   H  WL +  + EK +Y
Sbjct: 402 KKGAATAPLNPVATPENPELIVKTKEHGYLSKAVYDKINYDEKIHQAWLVDLRAREKAKY 461

Query: 538 EEKQVDYDNRXXXXXXXXXXXXXSMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNA 597
           + K  +Y  +             SM++++++ ++ IE+   RL K+ ++   ++  KK  
Sbjct: 462 DAKNTEYKEKLQDLQNQIDEIENSMKQLREETSQKIEVNKNRLVKQIIDINTEHNNKKLM 521

Query: 598 IFHETKAIQDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDA 657
           IF +T+ ++ QK +E +E+ ++Q  V+ EI  LN+EK N+ +EF  WT  L+  S  LDA
Sbjct: 522 IFKDTENMKKQKLEEKNEVLNKQTNVKSEIDELNSEKSNVQKEFNDWTTNLSSLSQQLDA 581

Query: 658 KMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVH 717
           +++ ++ +  K +K Q +ID L  +K  L  +   +K+ H KN + +E   NKEYLP+++
Sbjct: 582 QIFKINQINLKQSKAQNEIDNLEKQKKDLITQTEENKKLHEKNVEVLESVENKEYLPQIN 641

Query: 718 EIDDKISNLLGELSVIKQESANEKLKLGSITKKLESERQAHXXXXXXXXXXXXXXXXXXX 777
           +ID +IS LL ++++I+QE+ANE+  L +ITKKLE ER+AH                   
Sbjct: 642 DIDTQISTLLNQMTIIRQENANERTHLSAITKKLEDERRAHEEQLKLEAEERKRKEENLL 701

Query: 778 XXQREEHEAVAAGLKKQHEEELRKMKQDYEKRLQELKE 815
             QR+E E  A   + +HEE++ ++K+ Y  +L EL++
Sbjct: 702 EKQRQELEEQAHQAELEHEEQITQVKKTYNDQLTELQD 739

 Score = 90.5 bits (223), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 67/104 (64%), Gaps = 12/104 (11%)

Query: 68  EFASPFR---LESNEK------DAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRR 118
           ++ SPFR   L  N+       DA+ R+   FPTVS  S +SK  P++LGY+ + +  +R
Sbjct: 50  DWVSPFRQDALSGNQNNRLYVHDAKNRK---FPTVSATSPYSKQQPQDLGYKNIPKDVKR 106

Query: 119 AKDIQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDYT 162
           AKDI+FP YL +NE RQ QLLTE+E++E+ L Y+K  Q + D T
Sbjct: 107 AKDIKFPTYLTKNEERQYQLLTELELKEKHLKYLKKCQKITDLT 150

>Skud_7.441 Chr7 complement(730608..733031) [2424 bp, 807 aa] {ON}
           YGR130C (REAL)
          Length = 807

 Score =  225 bits (574), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 129/364 (35%), Positives = 208/364 (57%), Gaps = 8/364 (2%)

Query: 460 VTFPEVEKKR--SIFSIFGRKKKSQNR-----AP-NPLATPENPEILVKTDREGFLSKAV 511
           V F E  KK    IF+++     S  +     AP NP+ATPENPE++VKT   G+LSKAV
Sbjct: 353 VPFKERPKKERTGIFALWKSPTSSSAQKGGVTAPSNPVATPENPELIVKTKEHGYLSKAV 412

Query: 512 YDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNRXXXXXXXXXXXXXSMQEIKDDANE 571
           YDK+ Y+   H  WL +  + EK +Y+     Y  R             SM+ ++ + +E
Sbjct: 413 YDKINYDEKVHQAWLADLKAKEKAKYDATSTGYSERLQDLQNQIDEIENSMKAMRKETSE 472

Query: 572 LIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQKEIAALN 631
            IE+   RL K+ ++    +  KK  IF +T+ +++QK +E DE+  +Q  V+ EI  LN
Sbjct: 473 KIEVSKNRLVKQIIDVNTAHNNKKLMIFKDTENMKNQKLQEKDEVLGKQTAVKSEIDELN 532

Query: 632 AEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMA 691
           + K N+ +EF  WT  L++ S  LDA+++ ++ +  K +K Q +ID L  KK  L  +  
Sbjct: 533 SAKTNVQKEFNDWTTNLSNLSQQLDAQIFKINQINLKQSKVQNEIDALQKKKEDLIAQTE 592

Query: 692 AHKETHAKNTKAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKL 751
            +K+ H +N + +E   NKEYLP++++ID+++S LL ++++I+QE+ANEK +L +ITK+L
Sbjct: 593 ENKKLHERNVQTLESVENKEYLPQINDIDNQVSTLLNKMTIIRQENANEKTELSAITKRL 652

Query: 752 ESERQAHXXXXXXXXXXXXXXXXXXXXXQREEHEAVAAGLKKQHEEELRKMKQDYEKRLQ 811
           E ER+AH                     QR+E E  A   +  HE+++ ++KQ Y  +L 
Sbjct: 653 EDERRAHEEQLKLEAEERKRKEENLLEKQRQELEEQAHQAQLDHEQQITQVKQTYNDQLT 712

Query: 812 ELKE 815
           EL++
Sbjct: 713 ELQD 716

 Score = 96.3 bits (238), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/101 (44%), Positives = 68/101 (67%), Gaps = 6/101 (5%)

Query: 68  EFASPFRLESNEKDAEKR------RLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKD 121
           E+ SPFR ++  ++   R      + ++FPTVS  S +SK  PK+LGY+ + + ++RAKD
Sbjct: 52  EWVSPFRQDALSRNQNNRLYVADAKNKKFPTVSATSAYSKQQPKDLGYKNIPKNAKRAKD 111

Query: 122 IQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDYT 162
           I+FP YL +NE RQ QLLTE+E++E+ L Y+K  Q + D T
Sbjct: 112 IRFPTYLTKNEERQYQLLTELELKEKHLKYLKECQKITDLT 152

>CAGL0I10516g Chr9 (1039201..1041642) [2442 bp, 813 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130c
          Length = 813

 Score =  218 bits (556), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 136/375 (36%), Positives = 200/375 (53%), Gaps = 13/375 (3%)

Query: 453 YAAVPRVVTFPEVEKKRSIFSIFGRKKKS-------------QNRAPNPLATPENPEILV 499
           Y  VPR+    + E  +   S F R   +             Q++   P+ATPENPE++ 
Sbjct: 370 YDKVPRIPYTEQPESGKKFSSFFKRNDNAGHPVITDVPVIPDQSQLDFPIATPENPELIA 429

Query: 500 KTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNRXXXXXXXXXXXX 559
           KT+  G++SK +YDKV Y+   H  WL  F  SEK +Y++K  +Y+N             
Sbjct: 430 KTEEYGYMSKPIYDKVVYDETNHRRWLKGFKKSEKAKYDDKMEEYNNELEELQKEIDMIN 489

Query: 560 XSMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKHR 619
            SM+ +K +  + IE+    L KK  E    + E+KN IF ET+ I++QK ++  EI  +
Sbjct: 490 ESMENLKKETADKIEVSENNLVKKIFERNTLHNEQKNKIFKETENIKNQKIQQKKEILDK 549

Query: 620 QEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDEL 679
              VQ EI  LN  K  +  EF  WT  +      LDAK+  +  +  K  +TQ +I++L
Sbjct: 550 HAVVQDEITQLNDRKKEVREEFDKWTTNMTTLGQQLDAKIMKVTQITMKQDETQKEIEKL 609

Query: 680 SHKKAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESAN 739
             +K   + ++ A K+ H +  K VE + NKEYLPK+H ID++IS LL EL++IKQE+AN
Sbjct: 610 ETQKKEYQAQIDAAKKEHEEGQKVVESYENKEYLPKIHTIDNQISELLNELAIIKQENAN 669

Query: 740 EKLKLGSITKKLESERQAHXXXXXXXXXXXXXXXXXXXXXQREEHEAVAAGLKKQHEEEL 799
           E+ +L  ITK+LE ER+AH                     QR E E  A   K++HEE++
Sbjct: 670 EQTELSKITKELEEERRAHEEKLKLEAEERERQEKNLLEKQRLELEEKAEQQKREHEEQV 729

Query: 800 RKMKQDYEKRLQELK 814
           RKMK+ YE  L  +K
Sbjct: 730 RKMKEQYENELNNVK 744

 Score = 88.6 bits (218), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 55/74 (74%)

Query: 89  RFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQFPIYLRENEARQDQLLTEVEIREQK 148
           +FPTVS  S  +   PKELG++T+ + ++RAKDI+FP+YL ENE RQ  +L E+E++E K
Sbjct: 122 KFPTVSATSALANQDPKELGFKTLDKSTKRAKDIKFPVYLTENEFRQQTILKELELKEGK 181

Query: 149 LAYIKNSQIVHDYT 162
           L Y+K+SQ + D T
Sbjct: 182 LQYLKDSQKIIDLT 195

>NCAS0E00810 Chr5 (148764..150842) [2079 bp, 692 aa] {ON} Anc_3.492
           YGR130C
          Length = 692

 Score =  214 bits (544), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 123/349 (35%), Positives = 199/349 (57%), Gaps = 5/349 (1%)

Query: 476 GRKKKSQNRAP----NPLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFIS 531
            +K K +  AP    NP+A+P N E +VKT + G+LSKAVYDK++Y+  +H +WL ++ +
Sbjct: 252 NQKSKKETEAPEKPSNPVASPTNQEEIVKTAQFGYLSKAVYDKIQYDEQQHKKWLADYET 311

Query: 532 SEKKRYEEKQVDYDNRXXXXXXXXXXXXXSMQEIKDDANELIEIRHGRLSKKFLESTQQY 591
            + ++YE K  +Y                 +++ + D  E I++ HG+L KK  +     
Sbjct: 312 KQNEKYEAKMQEYKKSLQDMDNQMSELNDLIEKCELDTKEKIDVMHGQLVKKVFDKKGVQ 371

Query: 592 IEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADY 651
           I  K  IF+ETK I+ +K  E + + +   EV++ I  L  EK+ +  E+  WT  + + 
Sbjct: 372 INDKMKIFNETKQIKLEKLSEKENVLNDNTEVKQTIDELTNEKNKVRSEYDNWTTNMTNI 431

Query: 652 SAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEKHANKE 711
            + LDAK++ +  +       Q +ID L+ +K  L+ E+A +K  H  N K VE   NKE
Sbjct: 432 GSELDAKLFKISQINVTQMNLQNKIDALTSQKNNLQDEIAKNKNIHDSNVKLVESVDNKE 491

Query: 712 YLPKVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKLESERQAHXXXXXXXXXXXXX 771
           YLPK+++ID++I+ LL +++++KQE+ANEK++L  ITKKLE ER+AH             
Sbjct: 492 YLPKLNDIDNEINGLLNQMTIVKQENANEKVQLAEITKKLEDERRAHEEQLQLEAEERKR 551

Query: 772 XXXXXXXXQREEHEAVAAGLKKQHEEELRKMKQDYEKRLQELKEHQSKQ 820
                   QR+E EA A  ++  H++E+  +K DYE +L+E K +Q KQ
Sbjct: 552 QEENLLGKQRDELEAKANTMQVNHQQEIDALKNDYETKLEEFK-NQLKQ 599

 Score = 82.4 bits (202), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 62/97 (63%)

Query: 66  LGEFASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQFP 125
           + ++ASPFR E +  + +  + +RFPTVS  S ++  +PK+ G+ T+ +G   AKDI FP
Sbjct: 70  MSDYASPFRAEYSNVNVQNEKTRRFPTVSATSNYTLKNPKQKGFTTIKKGQNFAKDIYFP 129

Query: 126 IYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDYT 162
            YL ENE RQ   L  +E +E+ L Y+++SQ + D T
Sbjct: 130 NYLTENEQRQQAELLILEKKEKDLKYLQDSQNIIDLT 166

>SAKL0F02772g Chr6 (234381..236702) [2322 bp, 773 aa] {ON} similar
           to uniprot|P53278 Saccharomyces cerevisiae YGR130C
           Protein of unknown function green fluorescent protein
           (GFP)-fusion protein localizes to the cytoplasm in a
           punctate pattern
          Length = 773

 Score =  213 bits (543), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 125/343 (36%), Positives = 195/343 (56%), Gaps = 5/343 (1%)

Query: 468 KRSIFSIFGRKKKSQNRAPNPLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLT 527
           K  +F+++ R  K       PLATP++PE +V+TD+ G++SKA+YDK++Y+   H   L 
Sbjct: 334 KTGVFALWTRSDKQDQ----PLATPQDPEYIVRTDK-GYMSKAIYDKLEYDEQVHQNELA 388

Query: 528 EFISSEKKRYEEKQVDYDNRXXXXXXXXXXXXXSMQEIKDDANELIEIRHGRLSKKFLES 587
            F   +  +Y+  + +Y+++             +M++++ D  E I++    LSKK L+ 
Sbjct: 389 TFNKEQADKYDATEKEYNDKLTLLQSQIDELQATMEQLRLDTKEKIKVSESELSKKMLDL 448

Query: 588 TQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNR 647
              +I  KN IF ET+ I+ QK  E DEI  + EEV+ EI  LN  K  +  EF  +  +
Sbjct: 449 NATHISSKNVIFKETENIKTQKIAERDEITAKHEEVKAEIEELNVLKKQVDAEFNEYQAK 508

Query: 648 LADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEKH 707
           L D +A LD+K+  +  L  K  +    I EL+ KK  +E E    +E H ++T  +E  
Sbjct: 509 LDDLTAQLDSKVEKIQELNDKQMEITGLIAELNQKKLEIETETRDAEELHKESTGILESI 568

Query: 708 ANKEYLPKVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKLESERQAHXXXXXXXXX 767
            NKEYLPK++ ID +++ LLG L++IKQE+AN+K +  +ITK+LE ER+AH         
Sbjct: 569 KNKEYLPKINAIDSQVATLLGSLTLIKQENANQKTEFAAITKRLEEERKAHEEKLRREEE 628

Query: 768 XXXXXXXXXXXXQREEHEAVAAGLKKQHEEELRKMKQDYEKRL 810
                       QREE EA A   + +HEEELR++K+++EK L
Sbjct: 629 ERKRLEEERLQKQREELEAKAEDARLKHEEELRQIKEEHEKAL 671

 Score = 62.0 bits (149), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 54/93 (58%), Gaps = 2/93 (2%)

Query: 68  EFASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQFPIY 127
           +++SPFR +     A+  + ++FPTVS  S        +LGY+ +    RRAKDI  P Y
Sbjct: 44  DYSSPFRSQQELIAAKNVKAKKFPTVSATS--GTASAADLGYKVIDSAKRRAKDISVPRY 101

Query: 128 LRENEARQDQLLTEVEIREQKLAYIKNSQIVHD 160
           L+  + +Q + L ++E +E  L Y+K+SQ + D
Sbjct: 102 LKNTDEKQRKKLDKLEFKENHLQYLKDSQKIVD 134

>TDEL0D05600 Chr4 complement(1009252..1011354) [2103 bp, 700 aa]
           {ON} Anc_3.492 YGR130C
          Length = 700

 Score =  210 bits (534), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 112/314 (35%), Positives = 188/314 (59%), Gaps = 1/314 (0%)

Query: 493 ENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNRXXXXX 552
           ENPE +VKT ++G+L+K +YDK+  ++ +H+EW+ ++   E++++++K+ + + +     
Sbjct: 346 ENPEHVVKT-KDGYLTKVIYDKITLQDRQHNEWIAKYKKDEQQKFDDKRAESNRKINSLR 404

Query: 553 XXXXXXXXSMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQDQKDKE 612
                    M +++ D +  IE+    L++KF E TQ +I+KKN +F +T+ I+ QK  E
Sbjct: 405 AQIKEIKNEMAQLRSDTDAKIEVSENELTRKFFEMTQVHIQKKNQVFKDTEVIKSQKLSE 464

Query: 613 TDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKT 672
            D +  +Q EVQKEI  LN EK+ +  E   WT  + + SA +DAK+  L  +  K   T
Sbjct: 465 KDSVLDKQGEVQKEIDELNIEKEKVEEECQKWTKDIEELSARIDAKVADLEEVNVKQKNT 524

Query: 673 QAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHEIDDKISNLLGELSV 732
           Q +I++L  +K  +  ++  +  THA+N K +E   NK YLPK++E+D++IS LLG+L+ 
Sbjct: 525 QEEINKLQQQKVDILDQIEKNNLTHAENEKVIEGAKNKTYLPKLNEVDNQISVLLGQLTT 584

Query: 733 IKQESANEKLKLGSITKKLESERQAHXXXXXXXXXXXXXXXXXXXXXQREEHEAVAAGLK 792
           I+Q  ANE+ +L +ITKKL+ ER  H                     QR+E EA A   +
Sbjct: 585 IRQHCANERTELSAITKKLDKERLEHEEKLKLEAENRRRKEEDLLGKQRKELEAKAQEAR 644

Query: 793 KQHEEELRKMKQDY 806
           ++HE+E++K+K DY
Sbjct: 645 EKHEQEMQKLKTDY 658

 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 60/89 (67%)

Query: 68  EFASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQFPIY 127
           ++ SPFR E     A++RR QRFPT S  S +    P+ELGY+ +G G +RAKDI FP+Y
Sbjct: 39  DYVSPFRDEQEVLSAQRRRTQRFPTTSAASAYVNARPEELGYKKIGAGEKRAKDISFPVY 98

Query: 128 LRENEARQDQLLTEVEIREQKLAYIKNSQ 156
           L E E +Q +LL E+E++E  L Y+K+ Q
Sbjct: 99  LEEIEKKQLELLRELEVKEAHLRYLKDCQ 127

>NDAI0G00940 Chr7 (196273..198243) [1971 bp, 656 aa] {ON} Anc_3.492
           YGR130C
          Length = 656

 Score =  174 bits (441), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 109/328 (33%), Positives = 183/328 (55%)

Query: 487 NPLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDN 546
           NP ATP + E +VKT + G LSK++YD+++Y+  +H ++L  + +  +++Y+ K  +Y+N
Sbjct: 227 NPKATPNSKEEIVKTKKFGILSKSIYDQLQYDQQQHEQYLASYKAEMQEKYDVKMQEYEN 286

Query: 547 RXXXXXXXXXXXXXSMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQ 606
                          +++ K D +  ++I +  L K+  +      + K  IF ETK I+
Sbjct: 287 ELKSLDEKIVASNELIEQCKKDTDAKLDIMNAELVKRMFDERSVQTDDKMKIFSETKLIK 346

Query: 607 DQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQ 666
            +K  E   ++   ++V  EI  LN EK+ ++ EF  WT  + + +  LDAK++ +  + 
Sbjct: 347 REKIDEKINVEELDDQVVGEIDQLNKEKEKVYDEFNEWTFNMTNIAEQLDAKLFKIKQIN 406

Query: 667 QKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHEIDDKISNL 726
                 Q +ID L+++K  L KE+ A+K THA N + +E   NK+YLPK++ ID +I++L
Sbjct: 407 ITQMNLQNKIDGLNNEKLGLTKEIEANKFTHANNVETIENVDNKQYLPKLNNIDSQINDL 466

Query: 727 LGELSVIKQESANEKLKLGSITKKLESERQAHXXXXXXXXXXXXXXXXXXXXXQREEHEA 786
           L +L++IKQE+ANEK++L  +T+KLE ER  H                     QREE E 
Sbjct: 467 LNQLTLIKQENANEKIQLSELTQKLEKERMDHEEKLKLDAEERKRQEENLLGKQREELEQ 526

Query: 787 VAAGLKKQHEEELRKMKQDYEKRLQELK 814
            A  L+  HE E+  +K  YE++L + K
Sbjct: 527 KANDLQLNHETEMTNLKTSYEQQLADFK 554

 Score = 66.2 bits (160), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/98 (38%), Positives = 58/98 (59%), Gaps = 3/98 (3%)

Query: 68  EFASPFR---LESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQF 124
           E+ SPFR   + +N+   +  + +RFPTVS  S ++    KE+G++ + +    AKDI F
Sbjct: 67  EYLSPFRSNLVTNNKAYIQNEKTKRFPTVSATSNYTNRTSKEMGFKKIPKDKNFAKDIFF 126

Query: 125 PIYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDYT 162
           P YL +NE RQ   LT++   E+ L Y K+SQ + D T
Sbjct: 127 PSYLTQNEQRQQIELTKLVKLEKDLQYKKDSQNIIDLT 164

>KLLA0D16236g Chr4 complement(1366718..1369333) [2616 bp, 871 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 871

 Score =  174 bits (442), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 116/359 (32%), Positives = 199/359 (55%), Gaps = 20/359 (5%)

Query: 471 IFSIFGRKKKSQNR---APN------------PLATPENPEILVKTDREGFLSKAVYDKV 515
           +F++F R KK ++    A N            P+ATPE+PE++V+T +EG++SK+VYDK+
Sbjct: 412 LFALFKRSKKPESSTKVAANAAAGTVVPGDDAPVATPEDPELIVRT-QEGYVSKSVYDKL 470

Query: 516 KYENHKHSEWLTEFISSEKKRYEEKQVDYDNRXXXXXXXXXXXXXSMQEIKDDANELIEI 575
           +Y+  +H   L  +   + +RYE K  +Y+ +              M++++ +  E +++
Sbjct: 471 QYDEDQHQAKLALYSKEQDERYETKAQEYEEKIQSIQAEIAELDAQMEQVRLEHEEKLKL 530

Query: 576 RHGRLSKKFLESTQQYIEKKNAIFHETKAIQDQ--KDKETDEIKHRQEEVQKEIAALNAE 633
           +    S+  LE+  ++I  K  ++ +T+ I++Q   DKE  E+ H+   VQ EI  L   
Sbjct: 531 KQVEKSQALLETNVKHINAKGDLYKQTEEIKNQTISDKEDKEVAHQT--VQSEIDELLLL 588

Query: 634 KDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAH 693
           KD + +E     +++ + +A LD K  +L+    K  +T A+I  L  +KA LE+E+   
Sbjct: 589 KDEVAKENQEHESKVEELTAELDNKTSALNESLAKKDETNAEIQALEEEKARLEQEIKEA 648

Query: 694 KETHAKNTKAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKLES 753
           +E H +N   +E   NKEYLPKV+EI+ +IS+LL  L +I+QE AN+K++  S+T++LE 
Sbjct: 649 QELHQQNVSKIESIDNKEYLPKVNEINTEISSLLASLGLIQQEIANQKVEFSSVTRRLEE 708

Query: 754 ERQAHXXXXXXXXXXXXXXXXXXXXXQREEHEAVAAGLKKQHEEELRKMKQDYEKRLQE 812
           ER+ H                     QR E+E  A   + +HEEEL  +KQ +++ L+E
Sbjct: 709 ERKQHEEQLLKEKEERERLEKERLEKQRTEYEKQAEEARLKHEEELANLKQTHDEALKE 767

 Score = 60.1 bits (144), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 83/171 (48%), Gaps = 32/171 (18%)

Query: 1   MFRSKRP-DPFTGLYEEA-HRREQARK------GTFLTQVVNSDGANLLDVADXXXXXXX 52
           +FR +   DPF GL ++A H  EQ ++       + L +V      +  ++ D       
Sbjct: 6   LFRKRNEIDPFAGLLDDADHAAEQQQQHDLTNSNSILKRVTTKQQQHQEELDD------- 58

Query: 53  XXXXXXXXXXXXHLGEFASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTM 112
                          E+ SPFR     + A + R ++FPT+S  +V  ++ P+++GY  +
Sbjct: 59  --------------NEYHSPFRTAEETQRARQVRQEKFPTLSQGAV--QLDPEQMGYSVV 102

Query: 113 -GRGSRRAKDIQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDYT 162
             +  ++AKDI  P  L++ EA Q   LT +E +E++L Y + SQ + D T
Sbjct: 103 TDKSVKKAKDIIIPSGLKDTEAEQKVRLTALEKKEKQLRYWRKSQKIVDLT 153

>Kpol_480.14 s480 (29882..31981) [2100 bp, 699 aa] {ON}
           (29882..31981) [2100 nt, 700 aa]
          Length = 699

 Score =  165 bits (417), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 110/344 (31%), Positives = 189/344 (54%), Gaps = 12/344 (3%)

Query: 471 IFSIFGRKKKSQNRAP---NPLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLT 527
           I +IF +   S N  P   NP+++PENPE ++KT + G+LSKAVYDKV+Y+   H  WL 
Sbjct: 337 IMAIF-KGNSSSNIQPVSKNPMSSPENPEYVIKTKQHGYLSKAVYDKVQYDQSVHQRWLD 395

Query: 528 EFISSEKKRYEEKQVDYDNRXXXXXXXXXXXXXSMQEIKDDANELIEIRHGRLSKKFLES 587
              ++E+++Y+ K+ +Y++               M E+K   ++ IE+   +L K  L+ 
Sbjct: 396 NLETTEEEKYQNKKTEYEDNLADIQSKIDNIHDLMDELKLKTSQKIEVMEYQLVKNILDM 455

Query: 588 TQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNR 647
           TQ + + KN IF ET+ ++ +K     +   +Q E++KEI  L+ E+  +  +F  W ++
Sbjct: 456 TQTHNDSKNKIFKETELMKLEKLNAKQDFISKQAEIRKEIENLSEEQTGVTDDFNEWNSK 515

Query: 648 LADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAV-EK 706
           L + +A LDAK+  +    Q+    + ++ +L+  K  LE+E+  ++E H  NT+ + + 
Sbjct: 516 LNEITAQLDAKIEDIRAKNQQKLDIEQEMAKLNISKMELEEEIKKNEEIHKNNTELLTDL 575

Query: 707 HANKEYLPKVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKLESERQAHXXXXXXXX 766
           +  K YLP+++EID++I+  L +LS IK+E+  E  +L  +TKKLE ER A         
Sbjct: 576 NVRKNYLPRINEIDNEIAGRLEKLSTIKKETIEENNRLTILTKKLEDERIARENEIRLKN 635

Query: 767 XXXXXXXXXXXXXQREEHEAVAAGLKKQHEEELRKMKQDYEKRL 810
                        Q        A LK +H EEL ++++ YEK++
Sbjct: 636 EKLKREQEQKLQKQ-------LAELKAKHNEELLEIQKKYEKKM 672

 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 69/97 (71%), Gaps = 3/97 (3%)

Query: 65  HLGEFASPFRLESNEKDA---EKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKD 121
           H  E+ SPFR  SN + A   + ++++RFPTVS +S FS++ P ELGY+ + + ++RAKD
Sbjct: 34  HNVEYVSPFRDPSNVQAANYAKAKKMERFPTVSASSHFSRMSPNELGYKNISKSTKRAKD 93

Query: 122 IQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIV 158
           I FP +L  NE RQ  ++T++E++E  L Y++NSQI+
Sbjct: 94  ISFPSFLIANERRQGGIITDLELKEANLKYLRNSQIL 130

>KLTH0F14828g Chr6 complement(1213675..1216185) [2511 bp, 836 aa]
           {ON} weakly similar to uniprot|P53278 Saccharomyces
           cerevisiae YGR130C Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm in a punctate pattern
          Length = 836

 Score =  166 bits (419), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 116/364 (31%), Positives = 193/364 (53%), Gaps = 16/364 (4%)

Query: 463 PEVEKKRSIFSIFGRKKKSQNRAPNPLATPENPEILVKTDREGFLSKAVYDKVKYENHKH 522
           P V     IF+++ R  K       P+A+P +PE +VK D+ G++SKA+YD ++YE   H
Sbjct: 355 PRVPFATGIFALWTRSDKRGQ----PVASPNDPEFIVKFDK-GYMSKALYDTLEYEEAIH 409

Query: 523 SEWLTEFISSEKKRYEEKQVDYDNRXXXXXXXXXXXXXSMQEIKDDANELIEIRHGRLSK 582
              + ++      +YE K  +Y++R             +M+ ++ D  E IEI   +LS 
Sbjct: 410 KREMDDYTKEHDAKYEAKANEYEDRLTSLKSQIAELEATMETLQKDTTEKIEISEAKLSA 469

Query: 583 KFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQ---KEIAALNAEKDNIHR 639
           + ++   ++   KN IF ET+ ++  K +E + ++ +QE+V+   +E+  L AE D  +R
Sbjct: 470 QMIDLNAEHSSSKNVIFKETENMKAAKVEEKEGVEAKQEDVKTELEELEKLRAEIDAENR 529

Query: 640 EFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAK 699
           E  G   R+ + +A LDAK+ ++  L  +  + QA ID+L  +K  L  E  A  E H  
Sbjct: 530 EHQG---RVDELTAELDAKLAAIQELNTQQAELQASIDDLQQQKDALISEANAADEQHGS 586

Query: 700 NTKAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKLESERQAHX 759
           N   +E   NKEYLPK++ ID KIS LL  L+V+KQE+AN K +  +++K+LE E +   
Sbjct: 587 NVAVLESIENKEYLPKLNAIDTKISELLTSLTVVKQETANHKTEFAAVSKRLEEEDEERK 646

Query: 760 XXXXXXXXXXXXXXXXXXXXQREEHEAVAAGLKKQHEEELRKMKQ---DYEKRLQELKEH 816
                               QREEH+     L+++HE +L +  Q   ++E+ L  LKE 
Sbjct: 647 EKLRQEEENRKRLEAERLQKQREEHDQQILLLQQEHERQLAEASQKAAEHEQAL--LKER 704

Query: 817 QSKQ 820
           + ++
Sbjct: 705 EQRE 708

 Score = 63.9 bits (154), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 55/92 (59%), Gaps = 2/92 (2%)

Query: 69  FASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQFPIYL 128
           + SPFR   +   A+KR++Q+FPTVS +         ++GY+ +    RRAKDI  P YL
Sbjct: 41  YNSPFRTSQSLAAAQKRKMQKFPTVSASVSAHSS--SDMGYKVIDAARRRAKDIAVPRYL 98

Query: 129 RENEARQDQLLTEVEIREQKLAYIKNSQIVHD 160
           + N+ RQ + L ++E +E  L Y K+SQ + D
Sbjct: 99  QGNDERQRRRLDKLERKEDALKYKKDSQRIVD 130

>Kwal_55.21229 s55 complement(741011..743374) [2364 bp, 787 aa] {ON}
           YGR130C - 1:1 [contig 130] FULL
          Length = 787

 Score =  145 bits (367), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 103/359 (28%), Positives = 184/359 (51%), Gaps = 14/359 (3%)

Query: 463 PEVEKKRSIFSIFGRKKKSQNRAPNPLATPENPEILVKTDREGFLSKAVYDKVKYENHKH 522
           P V     IF+++ R  K       P+A+P++PE +VK D+ G++SKA+YD ++YE   H
Sbjct: 327 PRVPFATGIFALWTRSDKRGQ----PVASPDDPEFIVKFDK-GYMSKALYDTLEYEEAVH 381

Query: 523 SEWLTEFISSEKKRYEEKQVDYDNRXXXXXXXXXXXXXSMQEIKDDANELIEIRHGRLSK 582
            + + ++      +Y+ K  +Y++              +M++++ D  + I I    LS 
Sbjct: 382 KQEMDQYTKENTDKYDAKAQEYEDHLTSLKSQIAELEATMEQLQLDTTDKINISAAELSA 441

Query: 583 KFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQ---KEIAALNAEKDNIHR 639
           + +ES  ++   KN IF ET+  +  K  E   +  +Q+EV+   +E+ A  AE D  ++
Sbjct: 442 RMIESNAKHSNTKNVIFKETENSKAAKIDEKAAVVAKQDEVKAENEELEAQRAEADATNQ 501

Query: 640 EFIGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAK 699
           E +    R+ + +  LD+K  ++  L  +  + QA ID L  +K  L  +  A  E H  
Sbjct: 502 ELLS---RIDELTTQLDSKQSAIQELNDQQAEIQASIDALEQQKDTLVADATAADELHNS 558

Query: 700 NTKAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKLESERQAHX 759
           N   +E  +NK+YLPK++ +D +IS LL  L+++KQE+AN+  +  +++K+LE E +   
Sbjct: 559 NIAILEGISNKDYLPKINALDSQISQLLSSLALVKQETANQHTEFAAVSKRLEEENEERK 618

Query: 760 XXXXXXXXXXXXXXXXXXXXQREEHEAVAAGLKKQHEEELRKMKQ---DYEKRLQELKE 815
                               QR+EH+     L+++HE +L +  Q   D E  LQ+ +E
Sbjct: 619 EKLRLEEENRKRLEAERFQKQRDEHDQHVLTLQQEHERQLAEASQKAADTELLLQQERE 677

 Score = 72.0 bits (175), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 82/158 (51%), Gaps = 31/158 (19%)

Query: 1   MFRSKRPDPFTGLYEEAHRREQARKGTFLTQVVNSDGANLLDVADXXXXXXXXXXXXXXX 60
           MF+ K+ DPF  L+++   +++  KG FL +VV  +  +                     
Sbjct: 1   MFK-KKHDPFEHLFQQDQPKKETSKG-FLRKVVTKEQED--------------------- 37

Query: 61  XXXXHLGEFASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAK 120
                   ++SPFR   ++ +A+KR++QRFPTVS +S        E+G++ +    +RAK
Sbjct: 38  ------ATYSSPFRTSQSQVEAQKRKVQRFPTVSASS--GGNSSAEMGFKVIDAARKRAK 89

Query: 121 DIQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIV 158
           DI  P YL+ N+ RQ + L ++E +E  L Y K+SQ +
Sbjct: 90  DIAVPRYLQGNDERQRRRLDKLERKEDSLQYKKDSQKI 127

>TPHA0D04250 Chr4 complement(917249..919138) [1890 bp, 629 aa] {ON}
           Anc_3.492 YGR130C
          Length = 629

 Score =  142 bits (358), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 155/275 (56%), Gaps = 9/275 (3%)

Query: 489 LATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNRX 548
           +A+PENPE LV+T+    +SKAVYD++ YE   HSEWL  F ++E ++Y  K+ +Y+++ 
Sbjct: 315 VASPENPEYLVRTNEYNIVSKAVYDQMNYEQKLHSEWLKNFNAAEDEKYNTKKQEYEDKL 374

Query: 549 XXXXXXXXXXXXSMQEIKDDAN----ELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKA 604
                        ++E K  +N    + IEI   +L K  L+   +Y   K  +  ET+ 
Sbjct: 375 VELQKQLD----DIEEKKKISNMKKQQKIEIMEYQLVKNVLDVQSKYNVDKGKVIKETEL 430

Query: 605 IQDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHT 664
           ++ QK    +++  +Q +V+ EI  LN EK+ I  E+  W   L + +  LD K+  +  
Sbjct: 431 MKLQKINAKEDLLAKQLDVKNEIEKLNNEKEAITNEYNIWNGNLENLTTLLDEKIAKIEA 490

Query: 665 LQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEK-HANKEYLPKVHEIDDKI 723
           + + + + Q  I+ L  KK  LE E+  H+E    N   ++K +  K+YLP+++EID++I
Sbjct: 491 INENNMRIQKDIEVLQVKKLNLENEIKDHEEKDKLNKDVLQKLNVEKDYLPRLNEIDEQI 550

Query: 724 SNLLGELSVIKQESANEKLKLGSITKKLESERQAH 758
           +    +L++IK E+ +E  +L  +TKKLE ER AH
Sbjct: 551 AAKFDKLAIIKNETISENNQLSILTKKLEEERIAH 585

 Score = 81.6 bits (200), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 56/157 (35%), Positives = 81/157 (51%), Gaps = 37/157 (23%)

Query: 4   SKRPDPFTGLYEEAHRREQARKGTFLTQVVNSDGANLLDVADXXXXXXXXXXXXXXXXXX 63
           SKR D FT L  E H  ++ ++ TFLT+ ++    N                        
Sbjct: 2   SKRKDTFTVL--EDHPGQEPQQ-TFLTRHISRKSEN------------------------ 34

Query: 64  XHLGEFASPFR-----LESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRR 118
               E+ SPFR     + SN   + K +  +FPT S  S F+K+ P E+GY ++ +  +R
Sbjct: 35  ---TEYISPFRNPQDTVRSNYAKSLKEK--KFPTTSATSNFNKMVPGEMGYSSLAKNDKR 89

Query: 119 AKDIQFPIYLRENEARQDQLLTEVEIREQKLAYIKNS 155
           AKDIQFP YL +NE RQ QLL E++I+E KL  ++ S
Sbjct: 90  AKDIQFPKYLLDNEKRQAQLLMELQIKEHKLHELQKS 126

>KNAG0B00810 Chr2 (148815..151088) [2274 bp, 757 aa] {ON} Anc_3.492
           YGR130C
          Length = 757

 Score =  101 bits (252), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 136/272 (50%), Gaps = 4/272 (1%)

Query: 487 NPLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDN 546
           NP AT + PE+L+K  + G +S AV++KV Y++  H   + ++   ++ ++ +K  +Y+ 
Sbjct: 297 NPQATEDTPELLLKLPKYGHVSAAVFNKVLYDDKVHKAEMADYQREQESKFAKKLQEYEQ 356

Query: 547 RXXXXXXXXXXXXXSMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQ 606
           +              M + K D     E+   +  K+  +S   + + K  + HE + ++
Sbjct: 357 KLAQVDDRKLSVLAKMNDAKLDKIAKSEVIENQKIKQLFDSNATFNDSKVKVLHEAQLVK 416

Query: 607 DQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQ 666
            QK ++   I  ++  +Q E+  L  EK +  +++  WT  L + +  LDA+++ L    
Sbjct: 417 LQKLQDLKFISQKKTLMQHEVNQLTLEKSHAEKDYHLWTTNLTNITERLDAQLFKLSQFN 476

Query: 667 QKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEKHANKEYLPKVHE---IDDKI 723
            K  K   QI +L+ +K  LE E+ A++ +     + +      ++L K HE   + D I
Sbjct: 477 HKQDKITRQIRDLTQRKTELEAEIDANQFSKGNADRNLADLETGQHL-KSHELVKVTDSI 535

Query: 724 SNLLGELSVIKQESANEKLKLGSITKKLESER 755
              L  L+V+KQE + E+LKL  IT ++E  R
Sbjct: 536 QGKLDSLAVVKQEISGERLKLIGITNEMERAR 567

 Score = 77.8 bits (190), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 63/99 (63%), Gaps = 4/99 (4%)

Query: 68  EFASPFR----LESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQ 123
           E+ SPFR     ++++K  + +R ++FPTVS  S+++  + +ELG+  +    RRA+DI 
Sbjct: 47  EYVSPFRGGQLTKASKKQLQLQRTKKFPTVSATSLYNSYNTRELGFSKVTDDQRRARDIV 106

Query: 124 FPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDYT 162
           FP YL ENE RQ  +L ++E REQ L +++  Q V D T
Sbjct: 107 FPEYLLENEDRQRLILKDLEKREQTLLHLQRCQSVLDRT 145

>Ecym_1237 Chr1 (487203..489386) [2184 bp, 727 aa] {ON} similar to
           Ashbya gossypii AFR310C
          Length = 727

 Score = 89.0 bits (219), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 67/286 (23%), Positives = 140/286 (48%), Gaps = 10/286 (3%)

Query: 468 KRSIFSIFGRKKKSQNRAPNPL-ATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWL 526
           K+ IF+++ R +K     P  L ATPE+PE +V T++ G++SK +YD+++YE   H E L
Sbjct: 305 KKGIFALWKRSEK-----PEKLNATPEDPEFIVLTEK-GYMSKNIYDRLEYEEELHQEKL 358

Query: 527 TEFISSEKKRYEEKQVDYDNRXXXXXXXXXXXXXSMQEIKDDANELIEIRHGRLSKKFLE 586
                +   +YE+    Y+ +             +M ++K      ++     LS+  ++
Sbjct: 359 ASLDQNSAAKYEDTARAYEEKLASLNNEIAEVHAAMDQLKSQTENEMKAIEASLSQNLMD 418

Query: 587 STQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTN 646
              ++ E+K  +  E +  ++ K  E + I  +  +V+ E+ AL   +     E   + +
Sbjct: 419 IQAKHDEQKETLLKEAENEKNAKITEKNTINEKLTQVEPELEALKRLELERKVELQQYQS 478

Query: 647 RLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEK 706
            +   +A LDA++  L  +  + T+    +  L  ++  +EK+++      A N + ++ 
Sbjct: 479 EVQALTAELDARLGELQNVSDEQTEVNLSMAALEERRVQIEKDISESNAVVANNKELLQ- 537

Query: 707 HANKEYLPKVHEIDDKISNLLGELSVIKQESANEKLKLGSITKKLE 752
             N E  P +  +D+++S +   +S ++QE A +K +L  ++ K E
Sbjct: 538 --NLENHPSIAALDNQVSEVTRTVSAVEQEHAAQKDELTELSTKKE 581

 Score = 46.6 bits (109), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 29/95 (30%), Positives = 47/95 (49%), Gaps = 10/95 (10%)

Query: 67  GEFASPFRLESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQFPI 126
           GE+ SPFR +    +AE+ R  +FPT   +S            R      R+A+DI  P 
Sbjct: 55  GEYVSPFRDDKAVAEAERIRDLKFPTTGHHSTV----------RVKDNVKRKAQDIAEPR 104

Query: 127 YLRENEARQDQLLTEVEIREQKLAYIKNSQIVHDY 161
                + +Q + L E+ ++E +L Y++NSQ + D 
Sbjct: 105 SFGTTDLKQQKQLDELGMKENQLEYLRNSQKIVDV 139

>TBLA0C04480 Chr3 complement(1084476..1086884) [2409 bp, 802 aa]
           {ON} Anc_3.492 YGR130C
          Length = 802

 Score = 81.3 bits (199), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 60/92 (65%), Gaps = 3/92 (3%)

Query: 68  EFASPFR---LESNEKDAEKRRLQRFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQF 124
           ++ SPFR     SN   A K++  R+PT+S  S +S + P++LGY+ +   ++RAKDI F
Sbjct: 55  QYKSPFRDTQTPSNMNVALKKKNHRYPTISATSPYSNMTPQDLGYKNIHPSTKRAKDIPF 114

Query: 125 PIYLRENEARQDQLLTEVEIREQKLAYIKNSQ 156
           P+ L ENE RQD+L  ++  +E +L Y++ SQ
Sbjct: 115 PVLLIENEIRQDKLFAQLTEKESQLDYLQKSQ 146

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 42/68 (61%), Gaps = 3/68 (4%)

Query: 482 QNRAPNPLATPENPEILVKT---DREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYE 538
            N   NP ATP+NPE+LVKT   +    LSK+VYD V Y    H++ + ++I+    +Y+
Sbjct: 371 MNNVINPKATPKNPELLVKTRYNNNSIILSKSVYDLVNYNIKVHNKRVKDYINDSNIKYK 430

Query: 539 EKQVDYDN 546
           EK  +++N
Sbjct: 431 EKNEEFNN 438

>KAFR0C01960 Chr3 complement(390752..392443) [1692 bp, 563 aa] {ON}
           Anc_3.492 YGR130C
          Length = 563

 Score = 80.1 bits (196), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/267 (23%), Positives = 135/267 (50%), Gaps = 13/267 (4%)

Query: 488 PLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSEWLTEFISSEKKRYEEKQVDYDNR 547
           P+A+PEN E +VK      +SK VYDK++++   + +++ ++ + +  +  + + +Y+ +
Sbjct: 247 PVASPENKETVVKLTSGKKISKYVYDKIEHDTKVNDQYIVKYQNDQLNKLNKLKSEYNEK 306

Query: 548 XXXXXXXXXXXXXSMQEIKDDANELIEIRHGRLSKKFLESTQQYIEKKNAIFHETKAIQD 607
                         ++ +  ++    E+   +L K  ++ST  + + K  I  +T  ++ 
Sbjct: 307 IKSIQLEKFKTLNEIENLNLESFNNFEVIQNKLVKNLMDSTATFSDNKVKILRKTGQLKL 366

Query: 608 QKDKETDEIKHRQEEVQKEIAALNAEKDNIHREFIGWTNRLADYSAHLDAKMYSLHTLQQ 667
           QK  E   +  ++  +++E   +N EKD+    F      L +    LDAK++ L     
Sbjct: 367 QKLNELKFLNQKRNLIRREANMINVEKDSYKTNFNYINCSLNEILQELDAKLFKLSQDNI 426

Query: 668 KHTKTQAQIDELSHKKAVLEKEMAA--HKETHA-KNTKAVEKHANKEYLPKVHEIDDKIS 724
           ++   + +I++L  KK  L  E+ +  +K+ H   ++K +E          ++E+D++I+
Sbjct: 427 RNENLEHEINKLQSKKQTLLDEIDSIEYKKLHPDDDSKQLE----------LNEMDEQIN 476

Query: 725 NLLGELSVIKQESANEKLKLGSITKKL 751
           + L  L++IKQE  NEKLK+  +T  L
Sbjct: 477 SKLSNLNLIKQEIINEKLKISKLTNDL 503

 Score = 47.8 bits (112), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 59/99 (59%), Gaps = 8/99 (8%)

Query: 67  GEFASPFRLESNEKDAEKRRLQ-----RFPTVSPNSVFSKVHPKELGYRTMGRGSRRAKD 121
            ++ SPFR  +  ++ +K++LQ     +FP VS  S ++    K++ Y+ +      A+D
Sbjct: 49  NKYNSPFRNNAPSRE-QKKQLQDLKTAKFPLVSATSTYN-TDTKDV-YKDLDPKKNFARD 105

Query: 122 IQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQIVHD 160
           I+FP  L +NE RQ+Q+L +++I++  L  +K+S  V D
Sbjct: 106 IKFPSRLIDNENRQNQILLDLKIKQDALDRLKDSLQVID 144

>AFR310C Chr6 complement(1001490..1003361) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR130C
          Length = 623

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 71/275 (25%), Positives = 131/275 (47%), Gaps = 9/275 (3%)

Query: 465 VEKKRSIFSIFGRKKKSQNRAPNPLATPENPEILVKTDREGFLSKAVYDKVKYENHKHSE 524
           ++K   +  +F    K Q   PN   TPE PE+++ T+R G++SKAVYD++  E   H  
Sbjct: 258 LQKGGKLGGLFKHHDKEQLLVPN--GTPEEPEVVLLTNR-GYMSKAVYDRLNDEEKAH-- 312

Query: 525 WLTEFISSEKKRYEEKQV---DYDNRXXXXXXXXXXXXXSMQEIKDDANELIEIRHGRLS 581
            L   ++S++   ++ Q+    Y+                +  ++ +    I+     LS
Sbjct: 313 -LGRLVNSDEDAAQDYQLVSQHYEKEIADLDAEISKLRADITALQAETEGQIDGLEASLS 371

Query: 582 KKFLESTQQYIEKKNAIFHETKAIQDQKDKETDEIKHRQEEVQKEIAALNAEKDNIHREF 641
           K   +   +  +K++ +  + +A + ++  + +EI H+ +E+Q EI  L   K+N   E 
Sbjct: 372 KNIQDMKAENADKQHVLHEQAEAQRAEQLADKEEIVHQNQELQPEIDRLRKLKENTAVEI 431

Query: 642 IGWTNRLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNT 701
                R+      LDA+   L  +  +  +    +  L  +KA LE+E+A   E   +N 
Sbjct: 432 TECQARIDQLQQQLDAQSRELRLVTDQQAEVSVVLATLQEQKAQLEREVADSNEFTKRNR 491

Query: 702 KAVEKHANKEYLPKVHEIDDKISNLLGELSVIKQE 736
           +A+E+    +Y   V EID K S +L E++ I+QE
Sbjct: 492 EALERLNQTDYTATVREIDAKNSEILTEIAKIRQE 526

>KAFR0G03690 Chr7 complement(762143..763234) [1092 bp, 363 aa] {ON}
           Anc_3.492 YGR130C
          Length = 363

 Score = 59.3 bits (142), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/98 (37%), Positives = 55/98 (56%), Gaps = 6/98 (6%)

Query: 65  HLGEFASPFRLESNEKDAEKRRLQR---FPTVSPNSVFSKVHPKELGYRTM--GRGSRR- 118
           H  ++ SPFR   N       R  +   +   +PNS F+K++   +GY+T+   R SR+ 
Sbjct: 35  HDAKYQSPFRRNINPNYLNYIREHKNAKYTITNPNSDFNKLNLNTVGYKTIPTDRKSRKI 94

Query: 119 AKDIQFPIYLRENEARQDQLLTEVEIREQKLAYIKNSQ 156
           AKDI FP  LRENE  Q   L E++ +E  L ++K+SQ
Sbjct: 95  AKDIDFPRSLRENEEAQTNFLNELKTKENNLKFLKDSQ 132

 Score = 42.0 bits (97), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/140 (25%), Positives = 68/140 (48%), Gaps = 7/140 (5%)

Query: 476 GRKKKSQNRAPNPLATPENPE-ILVKTDREGFL---SKAVYDKVKYENHKHSEWLTEFIS 531
           G KKK      N LATP+N E ++V   ++G L   SK V+D ++YEN  H + L +  +
Sbjct: 175 GNKKKE---LKNSLATPQNKEQVIVLRKKDGLLYYFSKEVFDNIQYENKIHHDKLKKLNA 231

Query: 532 SEKKRYEEKQVDYDNRXXXXXXXXXXXXXSMQEIKDDANELIEIRHGRLSKKFLESTQQY 591
              +R+  K  +YD +              ++++    +   +    + +K +L    +Y
Sbjct: 232 KGDERHASKINEYDTQVSNLNTKIDIENEKIRKLNSKISHFKDFSDFKSTKNYLFKMTEY 291

Query: 592 IEKKNAIFHETKAIQDQKDK 611
              K  ++ E +AI++Q+++
Sbjct: 292 NNTKTRLYGEIEAIKNQRNQ 311

>KNAG0A07940 Chr1 complement(1267543..1268370) [828 bp, 275 aa] {ON}
           Anc_3.492 YGR130C
          Length = 275

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 71/148 (47%), Gaps = 10/148 (6%)

Query: 472 FSIFGRKKKSQNRAPNPLATPENPE-ILVKTDREGF---LSKAVYDKVKYENHKHSEWLT 527
           +S +G+  +++ R  NP+ATPE PE +++     G     SK ++D ++ +   H+ WL 
Sbjct: 107 YSEYGQCNEAEFR--NPVATPETPEEVVIYKHLNGTNKAYSKEIFDNIQRDICNHNAWLL 164

Query: 528 EFISSEKKRYEEKQVDYDNRXXXXXXXXXXXXXSMQEIKDDANELIEIRHGRLSKKFLES 587
                   +   K  +Y+ +             +M  ++      I++   RL+K FL  
Sbjct: 165 SREGKANDQCATKMEEYNKQLAVLDDQIKSEKAAMNNLRRKQQRAIDLNENRLTKTFLLQ 224

Query: 588 TQQYIEKKNAIFHETK----AIQDQKDK 611
           TQQ+  +KN I+ ET+    AI+  +DK
Sbjct: 225 TQQFTAEKNKIYKETERLNFAIRKHQDK 252

 Score = 48.1 bits (113), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 43/68 (63%), Gaps = 1/68 (1%)

Query: 91  PTVSPNSVFSKVHPKELGYRTMGRGSRRAKDIQFPIYLRENEARQDQLLTEVEIREQKLA 150
           P  +P+S ++ + P+ELGY+      + A++I FP  L ENE RQ  +L +++ +EQ L 
Sbjct: 14  PISNPHSSYNTLKPEELGYK-QKFPKKYAREIHFPAELTENEMRQRAILQDLDEKEQHLD 72

Query: 151 YIKNSQIV 158
           ++K SQ V
Sbjct: 73  HLKKSQRV 80

>NDAI0B05860 Chr2 complement(1420277..1422322) [2046 bp, 681 aa]
           {ON} 
          Length = 681

 Score = 42.0 bits (97), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 22/62 (35%), Positives = 35/62 (56%), Gaps = 8/62 (12%)

Query: 487 NPLATPENPEILVK-TDREGFLSKAVYDKVKYENHKHSEWL-------TEFISSEKKRYE 538
           NP+AT  NPEIL+K  D +  ++K  YDK+   N  H+ W+       +   +++ K Y+
Sbjct: 383 NPIATTTNPEILIKLNDDKTIITKQTYDKLLELNQDHANWMINNNGESSNLYNTKFKTYQ 442

Query: 539 EK 540
           EK
Sbjct: 443 EK 444

>NCAS0F03550 Chr6 complement(708778..710103) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 40.0 bits (92), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 8/64 (12%)

Query: 488 PLATPENPEILVKT--DREGFLSKAVYDKVKYENHKHSEWLTEFIS------SEKKRYEE 539
           P+ATP+NPEILV+   ++   +SK  YD++     +H  WL  + +      +++ ++ +
Sbjct: 180 PIATPQNPEILVQLTENQNKIVSKETYDRLVQVQSEHDAWLKSYNAENMANYNQRHQWYQ 239

Query: 540 KQVD 543
           KQ+D
Sbjct: 240 KQID 243

>TPHA0F01250 Chr6 (286089..289925) [3837 bp, 1278 aa] {ON} Anc_2.253
           YIL115C
          Length = 1278

 Score = 37.4 bits (85), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 47/96 (48%), Gaps = 23/96 (23%)

Query: 861 STGAKSTGAK----STGAKSTDAK----STGAKSTDAK---------STDAKPNATKSGV 903
           STG  ST +K    STG  STDAK    STG  STD+K         STD+KP    +G 
Sbjct: 517 STGFGSTDSKPAFGSTGFGSTDAKPAFGSTGFGSTDSKPAFGSTGFGSTDSKPAFGSTGF 576

Query: 904 GATTK-----STGPQATDSTSGKVHNPFTDSGVTKS 934
           G+T       STG  +TD  S      F  +G TKS
Sbjct: 577 GSTDSKPAFGSTGFGSTDKKSPFAGTAFGTTG-TKS 611

>Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {ON}
           YNL272C (REAL)
          Length = 790

 Score = 35.4 bits (80), Expect = 0.90,   Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 22/38 (57%)

Query: 856 TDGIKSTGAKSTGAKSTGAKSTDAKSTGAKSTDAKSTD 893
           T G  STG  STG  STG  ST   STG  STD  +TD
Sbjct: 567 TTGESSTGESSTGESSTGESSTGESSTGESSTDDSATD 604

>KNAG0A04320 Chr1 complement(591254..595846) [4593 bp, 1530 aa] {ON}
            Anc_8.443 YDL197C
          Length = 1530

 Score = 33.5 bits (75), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/95 (26%), Positives = 46/95 (48%), Gaps = 16/95 (16%)

Query: 647  RLADYSAHLDAKMYSLHTLQQKHTKTQAQIDELSHKKAVLEKEMAAHKETHAKNTKAVEK 706
            ++ D    +D ++ +L+ +          + +LS +K  LEKE+A+HK+   K +  +EK
Sbjct: 1244 KMIDTQKLMDTRVLNLNNM----------VVQLSRRKFELEKELASHKQYLVKTSTYIEK 1293

Query: 707  HANKEYLPKVHEIDDKISNLLGELSVIKQESANEK 741
             + +    K    DD      G + ++KQE   EK
Sbjct: 1294 MSEEMQKKKAATTDD------GTVLLLKQELKKEK 1322

>Kwal_56.22599 s56 (197120..197860) [741 bp, 246 aa] {ON} YOL088C
           (MPD2) - 1:1 [contig 184] FULL
          Length = 246

 Score = 32.0 bits (71), Expect = 5.9,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 3/76 (3%)

Query: 683 KAVLEKEMAAHKETHAKNTKAVEK--HANKEYLPKVHEIDDKISNLLGELSVIKQESANE 740
           K +   E+    ET   +   V+K   A++EYL +VH+++ +I  L   L    +E   E
Sbjct: 165 KVIENNELDRELETILSDRSCVDKRCEASREYLSQVHQVEKEIQKLENILRSNPEEELEE 224

Query: 741 -KLKLGSITKKLESER 755
            K +L  + KK +SE+
Sbjct: 225 TKFRLKLLAKKHDSEK 240

>Kwal_49.19399 s49 complement(145..885) [741 bp, 246 aa] {ON}
           YOL088C (MPD2) - protein disulfide isomerase related
           protein [contig 369] FULL
          Length = 246

 Score = 32.0 bits (71), Expect = 5.9,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 3/76 (3%)

Query: 683 KAVLEKEMAAHKETHAKNTKAVEK--HANKEYLPKVHEIDDKISNLLGELSVIKQESANE 740
           K +   E+    ET   +   V+K   A++EYL +VH+++ +I  L   L    +E   E
Sbjct: 165 KVIENNELDRELETILSDRSCVDKRCEASREYLSQVHQVEKEIQKLENILRSNPEEELEE 224

Query: 741 -KLKLGSITKKLESER 755
            K +L  + KK +SE+
Sbjct: 225 TKFRLKLLAKKHDSEK 240

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.124    0.332 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 90,590,580
Number of extensions: 3711105
Number of successful extensions: 19871
Number of sequences better than 10.0: 847
Number of HSP's gapped: 19567
Number of HSP's successfully gapped: 1511
Length of query: 994
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 875
Effective length of database: 39,836,145
Effective search space: 34856626875
Effective search space used: 34856626875
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 71 (32.0 bits)