Re-run this search with the SEG filter switched off

Re-run this search as BLASTP i.e. protein query (default)

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
ZYRO0D09966g3.493ON1781785793e-76
TDEL0D056103.493ON1751784049e-50
Kpol_1017.63.493ON1871213702e-44
TBLA0C044903.493ON1861203475e-41
TPHA0D032803.493ON1841213398e-40
YPR149W (NCE102)3.493ON1731783362e-39
CAGL0L08448g3.493ON1731783334e-39
Skud_16.4443.493ON1731783301e-38
Suva_7.4193.493ON1741783257e-38
SAKL0F02750g3.493ON1701783249e-38
TBLA0D029603.493ON1891213242e-37
Smik_16.4023.493ON1731783222e-37
CAGL0I10494g3.493ON1721793134e-36
KAFR0C019703.493ON1791793102e-35
NDAI0G009303.493ON1761783074e-35
Suva_16.4783.493ON1661783022e-34
KAFR0G037003.493ON1861203014e-34
KNAG0A079503.493ON1821203005e-34
Skud_7.4423.493ON1741782962e-33
KNAG0B008003.493ON1821192953e-33
KLTH0F14850g3.493ON1711782934e-33
YGR131W (FHN1)3.493ON1741782874e-32
Smik_6.2273.493ON1741782858e-32
NCAS0E008003.493ON1741782822e-31
AFR312W3.493ON1681202752e-30
NDAI0B058803.493ON1821832753e-30
Kwal_55.212383.493ON1701782743e-30
KLLA0D16280g3.493ON1691782734e-30
NCAS0F035603.493ON1831212692e-29
Ecym_12363.493ON1691202265e-23
KNAG0L023302.61ON30567681.8
KLTH0B07326g2.61ON307103654.4
Kpol_303.72.662ON708104655.2
Kwal_12.673singletonOFF9623615.9
KAFR0F003402.61ON31169646.0
SAKL0D10252g1.365ON42580638.6
BLASTX 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ZYRO0D09966g
         (537 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly ...   227   3e-76
TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3....   160   9e-50
Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}...   147   2e-44
TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3....   138   5e-41
TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.49...   135   8e-40
YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Prot...   134   2e-39
CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {...   132   4e-39
Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W...   131   1e-38
Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W (...   129   7e-38
SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {O...   129   9e-38
TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON...   129   2e-37
Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W...   128   2e-37
CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa] ...   125   4e-36
KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.49...   124   2e-35
NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON...   122   4e-35
Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W...   120   2e-34
KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.49...   120   4e-34
KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3....   120   5e-34
Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W (...   118   2e-33
KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON...   118   3e-33
KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} simil...   117   4e-33
YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein...   115   4e-32
Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W (...   114   8e-32
NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON...   113   2e-31
AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic h...   110   2e-30
NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3....   110   3e-30
Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W...   110   3e-30
KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} simil...   109   4e-30
NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.49...   108   2e-29
Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON} ...    92   5e-23
KNAG0L02330 Chr12 complement(413866..414783) [918 bp, 305 aa] {O...    31   1.8  
KLTH0B07326g Chr2 complement(591369..592292) [924 bp, 307 aa] {O...    30   4.4  
Kpol_303.7 s303 complement(17437..19563) [2127 bp, 708 aa] {ON} ...    30   5.2  
Kwal_12.673 s12 (39766..40056) [291 bp, 96 aa] {OFF} [contig 461...    28   5.9  
KAFR0F00340 Chr6 (83466..84401) [936 bp, 311 aa] {ON} Anc_2.61 Y...    29   6.0  
SAKL0D10252g Chr4 (857985..859262) [1278 bp, 425 aa] {ON} simila...    29   8.6  

>ZYRO0D09966g Chr4 (841449..841985) [537 bp, 178 aa] {ON} weakly
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 178

 Score =  227 bits (579), Expect = 3e-76
 Identities = 123/178 (69%), Positives = 123/178 (69%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA
Sbjct: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 60

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           NIFVPFAFPVILFILD                GIRTHSCTNRHYLDSNKITQGSTSRCRE
Sbjct: 61  NIFVPFAFPVILFILDFLNFVFTFTAATALAVGIRTHSCTNRHYLDSNKITQGSTSRCRE 120

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            KMVM                      RTQQANVGVPTISQV
Sbjct: 121 AQAVVAFFYFAFFIFLFKMVMSFLSLLSNGAFGSSSGFSSRRRRTQQANVGVPTISQV 178

>TDEL0D05610 Chr4 (1011746..1012273) [528 bp, 175 aa] {ON} Anc_3.493
           YPR149W
          Length = 175

 Score =  160 bits (404), Expect = 9e-50
 Identities = 95/178 (53%), Positives = 103/178 (57%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           MLA+ DN LR VNF F VILLGLVG+LI SE  GH+SRVNFCMFAAAFGIV DSFYGILA
Sbjct: 1   MLAIVDNALRLVNFAFLVILLGLVGELISSED-GHSSRVNFCMFAAAFGIVTDSFYGILA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           NI+  FA+PVILF LD                GIRTHSC N+ YLDSN ITQGST RCR 
Sbjct: 60  NIWEVFAWPVILFALDFLNFAFTFSAATALAVGIRTHSCKNQDYLDSNNITQGSTQRCRL 119

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            KM+M                      R + A VGVPTISQV
Sbjct: 120 AQASVAFFYFSFFIFLAKMIM--SLIGIITNGPFSSRTTLTSRRRKSAQVGVPTISQV 175

>Kpol_1017.6 s1017 complement(22157..22720) [564 bp, 187 aa] {ON}
           complement(22157..22720) [564 nt, 188 aa]
          Length = 187

 Score =  147 bits (370), Expect = 2e-44
 Identities = 71/121 (58%), Positives = 88/121 (72%), Gaps = 1/121 (0%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML+L DNI+RA+NFCFFVI +GL+G L+ +EK GH+SRVN+CMF   F +V DSFYGILA
Sbjct: 1   MLSLADNIMRAINFCFFVICMGLIGSLLATEK-GHSSRVNYCMFVPPFAVVTDSFYGILA 59

Query: 181 NIFV-PFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCR 357
           NI+  PFA+P+ILF  D                GIRTHSC NR+Y+D+NKI QGST RCR
Sbjct: 60  NIWTTPFAWPIILFAFDFLNFAFTFTAGTVLSVGIRTHSCKNRNYIDNNKIIQGSTDRCR 119

Query: 358 E 360
           +
Sbjct: 120 K 120

>TBLA0C04490 Chr3 (1088664..1089224) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  138 bits (347), Expect = 5e-41
 Identities = 67/120 (55%), Positives = 83/120 (69%), Gaps = 1/120 (0%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML+ T N+LR +NFCF VI+ G++GKLI+SEK  H+ RVN+CMFAA F +V DSFY I A
Sbjct: 1   MLSRTANVLRIINFCFLVIITGMIGKLIESEKRPHSPRVNYCMFAAPFALVTDSFYAIPA 60

Query: 181 NIF-VPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCR 357
           N +  PFA+P++L+  D                GIRTHSC N+HYL SNKITQGST RCR
Sbjct: 61  NFWPSPFAWPILLWSFDFLNFTFTFTAGTVLSVGIRTHSCLNKHYLFSNKITQGSTERCR 120

>TPHA0D03280 Chr4 (676013..676567) [555 bp, 184 aa] {ON} Anc_3.493
           YPR149W
          Length = 184

 Score =  135 bits (339), Expect = 8e-40
 Identities = 68/121 (56%), Positives = 81/121 (66%), Gaps = 1/121 (0%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML L DNILR VNFCFFVI LGLVG L+ ++   H+SRVN+C+F   F +V D+FYG LA
Sbjct: 1   MLGLADNILRGVNFCFFVICLGLVGSLLATQNQ-HSSRVNYCIFVPPFALVTDTFYGALA 59

Query: 181 NIF-VPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCR 357
           NI+  P A+P+ILF  D                G RTHSCTN+ YLDSN ITQGST RCR
Sbjct: 60  NIWSTPLAWPIILFCFDFLNFAFTFTAGTVLAVGTRTHSCTNQSYLDSNNITQGSTDRCR 119

Query: 358 E 360
           +
Sbjct: 120 K 120

>YPR149W Chr16 (829918..830439) [522 bp, 173 aa] {ON}  NCE102Protein
           of unknown function; contains transmembrane domains;
           involved in secretion of proteins that lack classical
           secretory signal sequences; component of the
           detergent-insoluble glycolipid-enriched complexes (DIGs)
          Length = 173

 Score =  134 bits (336), Expect = 2e-39
 Identities = 75/178 (42%), Positives = 93/178 (52%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           MLAL DNILR +NF F VI +GL+  L+ ++ H H+SRVN+CMFA A+GI  DS YG+ A
Sbjct: 1   MLALADNILRIINFLFLVISIGLISSLLNTQ-HRHSSRVNYCMFACAYGIFTDSLYGVFA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N   P A+P++LF LD                GIR HSC N  Y+DSNKITQGS +RCR+
Sbjct: 60  NFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            K +M                      R +   VGVPTISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLM----SVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>CAGL0L08448g Chr12 complement(928396..928917) [522 bp, 173 aa] {ON}
           highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 173

 Score =  132 bits (333), Expect = 4e-39
 Identities = 76/178 (42%), Positives = 92/178 (51%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           MLA+TDN+LR VNF F VI +GL+  LI +    H+SRVN+CMFAAA+GI  DS YG+ A
Sbjct: 1   MLAVTDNLLRIVNFVFMVICIGLISDLIATRDR-HSSRVNYCMFAAAYGIATDSLYGVFA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N F   A+P+ILF LD                GIR HSC N HY ++NKI QGS  RCRE
Sbjct: 60  NFFEILAWPLILFTLDFLNFAFMLTAGCVLAVGIRAHSCNNAHYRENNKIIQGSERRCRE 119

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            KM+M                      R   A VGVP++SQV
Sbjct: 120 SQAAVAFFFFSMAIFLAKMIM----SLLNIFSNGAFGTKFIRRRRNNAEVGVPSVSQV 173

>Skud_16.444 Chr16 (783546..784067) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  131 bits (330), Expect = 1e-38
 Identities = 75/178 (42%), Positives = 94/178 (52%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           MLA  DNILR +NF F VI++GL+  L+ ++   ++SRVNFCMFAAA+GI  DS YG+ A
Sbjct: 1   MLAPADNILRIINFLFLVIVIGLISSLLNTQDR-NSSRVNFCMFAAAYGIFTDSLYGVFA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N F P A+P++LF LD                GIR HSC NR Y+DSN ITQGS +RCR+
Sbjct: 60  NFFEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNRSYVDSNGITQGSGTRCRQ 119

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            K +M                      R +   VGVPTISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLM----SVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>Suva_7.419 Chr7 (724883..725407) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  129 bits (325), Expect = 7e-38
 Identities = 73/178 (41%), Positives = 97/178 (54%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML++ DNI+R +N  F +I +GLV  LI S+   H+SRVNFCMFAAA+G++ DSFYG LA
Sbjct: 1   MLSVADNIVRIINAIFLIISIGLVSGLISSQTK-HSSRVNFCMFAAAYGLLTDSFYGCLA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N++    +PVI+F+LD                GIR HSC+N+ YLD+NKITQGS SRC +
Sbjct: 60  NLWSSLTYPVIMFVLDFLNFLFTFIAGTALAVGIRCHSCSNKTYLDNNKITQGSGSRCHQ 119

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            K+V+                      R Q   +G+PTISQV
Sbjct: 120 AKAAVVFFYFSCILFLIKVVVSIAAMVQNGGFGFGNSFGRRRARRQ---MGIPTISQV 174

>SAKL0F02750g Chr6 complement(232715..233227) [513 bp, 170 aa] {ON}
           similar to uniprot|Q12207 Saccharomyces cerevisiae
           YPR149W NCE102 and to uniprot|P53279 Saccharomyces
           cerevisiae YGR131W
          Length = 170

 Score =  129 bits (324), Expect = 9e-38
 Identities = 75/178 (42%), Positives = 94/178 (52%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML++ DN LR VNF F VI+LGL G LI ++   H+ RVNF +F AAF +V DSFY + A
Sbjct: 1   MLSILDNSLRLVNFAFLVIILGLTGSLIATQDE-HSPRVNFAIFTAAFALVTDSFYAVFA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N+F  FA+P++L   D                GIRTHSCTN  YL SN ITQGST RCR+
Sbjct: 60  NLFSAFAWPILLVTWDFLNFVFTFSAATALAVGIRTHSCTNESYLFSNNITQGSTDRCRK 119

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            K+V+                       +++ANVGVPTISQV
Sbjct: 120 AQATVAFLYFSFFIFLTKLVLSVINVFSSGAFGSGSG-------SRRANVGVPTISQV 170

>TBLA0D02960 Chr4 complement(721934..722503) [570 bp, 189 aa] {ON}
           Anc_3.493 YPR149W
          Length = 189

 Score =  129 bits (324), Expect = 2e-37
 Identities = 65/121 (53%), Positives = 77/121 (63%), Gaps = 1/121 (0%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML L DN+ R  NFCFFVI  G++G L+ +E   H+SRVN+CMF  A+G+V+DSFYGILA
Sbjct: 1   MLELYDNVFRIFNFCFFVITAGMIGNLLNTEHGHHSSRVNYCMFPPAWGLVSDSFYGILA 60

Query: 181 NIF-VPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCR 357
           N+   PFAFP ILF  D                GIRTHSCTN+ Y   N I QGS  RCR
Sbjct: 61  NLVPEPFAFPPILFAFDFLNFVFTFTAGTVLAVGIRTHSCTNKEYRRENYIIQGSERRCR 120

Query: 358 E 360
           E
Sbjct: 121 E 121

>Smik_16.402 Chr16 (701857..702378) [522 bp, 173 aa] {ON} YPR149W
           (REAL)
          Length = 173

 Score =  128 bits (322), Expect = 2e-37
 Identities = 73/178 (41%), Positives = 91/178 (51%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           MLAL DNILR +NF F VI + L+  L+ ++   H+SRVN+CMFA A+GI  DS YG+ A
Sbjct: 1   MLALADNILRIINFLFLVISIALISSLLNTQDK-HSSRVNYCMFACAYGIFTDSLYGVFA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N   P A+P++LF LD                GIR HSC N  Y+DSNKITQGS +RCR+
Sbjct: 60  NFIEPLAWPLVLFTLDFLNFVFTFTAGTVLAVGIRAHSCNNSSYVDSNKITQGSGTRCRQ 119

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            K +M                      R +   VGVPTISQV
Sbjct: 120 AQAAVAFLYFSCAIFLAKTLM----SIFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 173

>CAGL0I10494g Chr9 complement(1037855..1038373) [519 bp, 172 aa]
           {ON} highly similar to uniprot|Q12207 Saccharomyces
           cerevisiae YPR149w NCE2 or uniprot|P53279 Saccharomyces
           cerevisiae YGR131w
          Length = 172

 Score =  125 bits (313), Expect = 4e-36
 Identities = 72/179 (40%), Positives = 91/179 (50%), Gaps = 1/179 (0%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML++ DN+LR VN  F +I +GL   LI + K  H+SRVNFC+FAAA+GI  DS YGI A
Sbjct: 1   MLSVADNLLRIVNAVFLIICIGLASSLINTRKR-HSSRVNFCLFAAAYGIATDSLYGIFA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLD-SNKITQGSTSRCR 357
           N F P A+P++LF+LD                GIR HSC N+ YL+   KI QGS +RCR
Sbjct: 60  NFFEPLAWPLVLFVLDFLNFVFTFTAGTVLAVGIRAHSCNNKRYLERETKIVQGSGTRCR 119

Query: 358 EXXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
           +                 KM+M                      R     VGVP+ISQV
Sbjct: 120 QAQALVAFFYFSMAIFLAKMIM------SIVSVVSNGAFGAKLRRKHHTEVGVPSISQV 172

>KAFR0C01970 Chr3 (393616..394155) [540 bp, 179 aa] {ON} Anc_3.493
           YPR149W
          Length = 179

 Score =  124 bits (310), Expect = 2e-35
 Identities = 71/179 (39%), Positives = 87/179 (48%), Gaps = 1/179 (0%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML + DNILR +N  F +I + L   LI ++   HNSRVN+CMFA AFG+  DS YGI A
Sbjct: 1   MLGVADNILRLINAVFLIIAIALTSALINTQNGHHNSRVNYCMFACAFGLFFDSIYGICA 60

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N F   A+P++LF LD                GIR HSC N+ YLDSNKI +GS  RCRE
Sbjct: 61  NFFQVLAWPLLLFTLDFLNFAFTFSAATALAVGIRAHSCGNQSYLDSNKIVRGSGQRCRE 120

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANV-GVPTISQV 534
                            KM+M                      +    +V GVP ISQV
Sbjct: 121 AQALVAFLYFSTAIFIAKMIMSCINLFQNGAFSSGSSRFISRRKKHATDVGGVPNISQV 179

>NDAI0G00930 Chr7 complement(194039..194569) [531 bp, 176 aa] {ON}
           Anc_3.493 YGR131W
          Length = 176

 Score =  122 bits (307), Expect = 4e-35
 Identities = 71/178 (39%), Positives = 92/178 (51%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML++ DN+LR +N  F VI +GL   L+ +++ GHNSR+N+CMF   + ++ DSF+GILA
Sbjct: 1   MLSVADNLLRLLNAMFLVICIGLNSALLNTQQ-GHNSRINYCMFTCVYCLLTDSFFGILA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N F   +FP ILF LD                GIR+HSC N+ YLD NKITQGS +RCRE
Sbjct: 60  NFFEFLSFPFILFTLDFLNFSFTFVAGTVLATGIRSHSCNNQSYLDRNKITQGSGNRCRE 119

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            K+ M                      R   A VGVP+ISQV
Sbjct: 120 SQALVAFFYFSMFIFLIKLAM-STISMIQNGAFSNTFTSRRRRRNGAAEVGVPSISQV 176

>Suva_16.478 Chr16 (826406..826906) [501 bp, 166 aa] {ON} YPR149W
           (REAL)
          Length = 166

 Score =  120 bits (302), Expect = 2e-34
 Identities = 73/178 (41%), Positives = 91/178 (51%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           MLA  DNILR +NF F VI +GL+  L+ ++  G++SR+N+CMFA A+ IV DS YG+ A
Sbjct: 1   MLAPVDNILRIINFLFLVISIGLISSLLNTQS-GNSSRINYCMFAVAYAIVTDSLYGVFA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N F P A+P+ILF LD                 IR HSC N+ YL SN ITQGS +RCRE
Sbjct: 60  NFFEPLAWPLILFSLD-------FLNFVFTFTAIRAHSCRNQTYLASNSITQGSGNRCRE 112

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            K +M                      R +   VGVPTISQV
Sbjct: 113 AQAAVAFLYFSCAIFLAKTLM----SVFNMISNGAFGSGSFSKRRRTGQVGVPTISQV 166

>KAFR0G03700 Chr7 (763909..764469) [561 bp, 186 aa] {ON} Anc_3.493
           YPR149W
          Length = 186

 Score =  120 bits (301), Expect = 4e-34
 Identities = 59/120 (49%), Positives = 76/120 (63%), Gaps = 1/120 (0%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNS-RVNFCMFAAAFGIVADSFYGIL 177
           MLA+ DN LR VNFCF VI +  + +L+ + + GHNS RVN+CMFA AFGI+ DS YG+ 
Sbjct: 1   MLAIADNSLRLVNFCFMVITMAFIAQLLNT-RQGHNSARVNYCMFAVAFGILTDSIYGLF 59

Query: 178 ANIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCR 357
           AN F   A+P+ILF+ D                GIR H+C N  Y +SNKI +GS +RCR
Sbjct: 60  ANFFEQLAWPIILFVFDFLNFVFFFTAGTVLAVGIRAHNCNNEAYRNSNKIVRGSETRCR 119

>KNAG0A07950 Chr1 (1269265..1269813) [549 bp, 182 aa] {ON} Anc_3.493
           YPR149W
          Length = 182

 Score =  120 bits (300), Expect = 5e-34
 Identities = 58/120 (48%), Positives = 77/120 (64%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           MLAL D  LR VNF F VI +GL+  L+ ++ HGH+SR+N+CMF AA+GI  DSFYG++A
Sbjct: 1   MLALADIFLRLVNFVFLVICMGLISALLNTQ-HGHSSRINYCMFTAAYGITTDSFYGVVA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N + P ++P++L  LD                GIR HSC N  Y + NKI QGS +RCR+
Sbjct: 60  NFWEPLSWPLLLGALDFLNFVFTLTAGCVLAVGIRAHSCKNVAYRNKNKIVQGSENRCRQ 119

>Skud_7.442 Chr7 (733950..734474) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  118 bits (296), Expect = 2e-33
 Identities = 67/178 (37%), Positives = 92/178 (51%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML+  DN++R V+  F +I +GL+G L+ ++ +G +SRVNFCMFAAA+G++ DSFYG LA
Sbjct: 1   MLSAADNLIRIVSAVFLIISIGLIGGLMGTQTNG-SSRVNFCMFAAAYGLITDSFYGFLA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N +    +P IL +LD                GIR HSC N+ YL+ N ITQGS+SRC +
Sbjct: 60  NFWSSLTYPAILLVLDFLNFLFTFAAATALAVGIRCHSCKNKTYLEQNNITQGSSSRCHQ 119

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            K+ +                      R Q   +GVPTISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVSVAGMMQNGGFGFNTGYGRRRARRQ---MGVPTISQV 174

>KNAG0B00800 Chr2 complement(147427..147975) [549 bp, 182 aa] {ON}
           Anc_3.493 YPR149W
          Length = 182

 Score =  118 bits (295), Expect = 3e-33
 Identities = 59/119 (49%), Positives = 73/119 (61%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML + DN+LR +NFCF VI L  +  LI ++K  H SRVN+CMFAAA+GI  D  YG+LA
Sbjct: 1   MLGVADNLLRLLNFCFLVICLAFISTLINTQKF-HISRVNYCMFAAAYGIATDGLYGLLA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCR 357
           N + P A+P+ILF LD                GIR HSC N  Y + N I QGS +RCR
Sbjct: 60  NFWEPLAWPLILFTLDFLNFAFTLTAGIVLAVGIRAHSCKNVRYRERNHIIQGSENRCR 118

>KLTH0F14850g Chr6 (1217267..1217782) [516 bp, 171 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 171

 Score =  117 bits (293), Expect = 4e-33
 Identities = 68/178 (38%), Positives = 89/178 (50%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML++ DN LRA+NF F VI+LGL G L  + K  +N +VNF +F AAFG++ DS Y I A
Sbjct: 1   MLSILDNSLRALNFAFLVIILGLTGSLAATHKTHNNPQVNFAIFTAAFGLLFDSLYAIPA 60

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N     A+P+++ + D                 IRTHSCTN+ YLDSN +TQGST RCR+
Sbjct: 61  NFVSALAWPLLIAVFDFLNFVFTFAAATALAVAIRTHSCTNQDYLDSNTVTQGSTDRCRK 120

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            K+ +                        +  NVGVPTISQV
Sbjct: 121 AQASVAFLYFSFFIFLAKLGL-------SLVNLISVGAFGAGSSRRTGNVGVPTISQV 171

>YGR131W Chr7 (754726..755250) [525 bp, 174 aa] {ON}  FHN1Protein of
           unknown function; induced by ketoconazole; promoter
           region contains sterol regulatory element motif, which
           has been identified as a Upc2p-binding site;
           overexpression complements function of Nce102p in NCE102
           deletion strain
          Length = 174

 Score =  115 bits (287), Expect = 4e-32
 Identities = 65/178 (36%), Positives = 88/178 (49%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML+  DN++R +N  F +I +GL+  LI ++   H+SRVNFCMFAA +G+V DS YG LA
Sbjct: 1   MLSAADNLVRIINAVFLIISIGLISGLIGTQTK-HSSRVNFCMFAAVYGLVTDSLYGFLA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N +    +P IL +LD                GIR HSC N+ YL+ NKI QGS+SRC +
Sbjct: 60  NFWTSLTYPAILLVLDFLNFIFTFVAATALAVGIRCHSCKNKTYLEQNKIIQGSSSRCHQ 119

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            K+ +                      R Q   +G+PTISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVATMGMMQNGGFGSNTGFSRRRARRQ---MGIPTISQV 174

>Smik_6.227 Chr6 (372610..373134) [525 bp, 174 aa] {ON} YGR131W
           (REAL)
          Length = 174

 Score =  114 bits (285), Expect = 8e-32
 Identities = 66/178 (37%), Positives = 87/178 (48%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML+  DN++R +N  F +I +GL+  LI ++   H+SRVNFCMF AA+G+V DS YG LA
Sbjct: 1   MLSAADNLIRIINAVFLIISIGLISGLISTQAK-HSSRVNFCMFTAAYGLVTDSLYGFLA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N +    +P IL  LD                GIR HSC N+ YL+ NKITQ S+SRC +
Sbjct: 60  NFWSSLTYPAILLALDILNFIFTFVAATALAVGIRCHSCKNKTYLEQNKITQASSSRCHQ 119

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            K+ +                      R Q   +GVPTISQV
Sbjct: 120 SQAAVAFFYFSCFLFLIKVTVTAAGTIQNGGFGFNSGFGRRRARRQ---LGVPTISQV 174

>NCAS0E00800 Chr5 complement(147211..147735) [525 bp, 174 aa] {ON}
           Anc_3.493 YGR131W
          Length = 174

 Score =  113 bits (282), Expect = 2e-31
 Identities = 65/178 (36%), Positives = 86/178 (48%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML + DN+LR +N  F VI +GL   L+ ++ H +NSR+N+CMF  A+ +  DS YGI A
Sbjct: 1   MLGVADNLLRILNAVFLVICIGLNSALLNTKTH-NNSRINYCMFTCAYCLTTDSIYGIFA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N F   A P + F LD                GIR HSC + HY++SNKITQG  +RCRE
Sbjct: 60  NFFDILALPALCFCLDFLNFAFTFVAGTVLATGIRAHSCKSEHYVNSNKITQGFKNRCRE 119

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            K++M                      R   A +GVP+ISQV
Sbjct: 120 SQALVAFFYFSMAIFLAKLIM---STINMIQNGAFTQHIGRRRRRNAAEIGVPSISQV 174

>AFR312W Chr6 (1004068..1004574) [507 bp, 168 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPR149W (NCE102) and
           YGR131W
          Length = 168

 Score =  110 bits (275), Expect = 2e-30
 Identities = 56/120 (46%), Positives = 73/120 (60%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML++ DN LRAVNF F +I+LGL G LI  +++ H SRVNF +F A F +V DSFY I+A
Sbjct: 1   MLSILDNSLRAVNFVFLIIVLGLTGSLIHGQRNSH-SRVNFGLFTAVFALVTDSFYSIVA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N    FA+P+I   LD                 I  HSC+NR +LD N I++ ST RCR+
Sbjct: 60  NFISAFAWPIITIALDVLNLIFTFAAATALGQSIGAHSCSNRGFLDGNTISEQSTDRCRK 119

>NDAI0B05880 Chr2 (1422880..1423428) [549 bp, 182 aa] {ON} Anc_3.493
           YGR131W
          Length = 182

 Score =  110 bits (275), Expect = 3e-30
 Identities = 65/183 (35%), Positives = 91/183 (49%), Gaps = 5/183 (2%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML+  DNILR +N  F V+ +  +  L+ ++++ ++SR+NFCMFAAAFG++ DSF+G+  
Sbjct: 1   MLSKVDNILRVINAIFLVLTMAFISALLNTQRN-NSSRINFCMFAAAFGLLTDSFFGVAF 59

Query: 181 NIFVPFA-FPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCR 357
           N+F   A +P++LFI D                 IR HSC N  Y++SN ITQGS +RCR
Sbjct: 60  NMFDALASWPILLFIFDFLNFVFTFTAGTVLAVAIRAHSCKNERYVNSNSITQGSENRCR 119

Query: 358 EXXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQAN----VGVPTI 525
                             KM+M                      R    +    VGVPTI
Sbjct: 120 MSQAAVAFFYFSCFIFLAKMIMSGINMASNGLFGSGTWAGSRSKRRTNRSGANEVGVPTI 179

Query: 526 SQV 534
           SQV
Sbjct: 180 SQV 182

>Kwal_55.21238 s55 (744992..745504) [513 bp, 170 aa] {ON} YPR149W
           (NCE102) - Involved in secretion of proteins that lack
           classical secretory signal sequences [contig 130] FULL
          Length = 170

 Score =  110 bits (274), Expect = 3e-30
 Identities = 64/178 (35%), Positives = 89/178 (50%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML++ DN LRA NF F +I+LGL G L  + +  +N +VNF +FAAAFG++ D+ Y I A
Sbjct: 1   MLSILDNSLRAANFVFLLIVLGLTGSLAAT-RDNNNPQVNFAVFAAAFGLLFDTLYAIPA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N     A+P+++ + D                 IR HSCTN  Y+D+NK+TQGS+ RCR+
Sbjct: 60  NFISALAWPLLIAVFDFLNFVFTFAAATALAVAIRVHSCTNSDYVDNNKVTQGSSDRCRK 119

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            K+ +                        + ANVGVPTISQV
Sbjct: 120 AQASVAFLYFAFFVFLVKLALSLVNVFSVGAFSTSSG-------RKSANVGVPTISQV 170

>KLLA0D16280g Chr4 (1370792..1371301) [510 bp, 169 aa] {ON} similar
           to uniprot|Q12207 Saccharomyces cerevisiae YPR149W
           NCE102 and to uniprot|P53279 Saccharomyces cerevisiae
           YGR131W
          Length = 169

 Score =  109 bits (273), Expect = 4e-30
 Identities = 67/178 (37%), Positives = 86/178 (48%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML++ DN LR VNF F +I+LGLVG LI ++ H  +SRVNF +FAA FGIV DS Y ++A
Sbjct: 1   MLSILDNSLRGVNFVFLIIVLGLVGNLIATQDHS-SSRVNFAIFAAVFGIVFDSLYALIA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N     A+P+IL  LD                GIR  SCTN  +   NKI +GS  RCR+
Sbjct: 60  NFISALAWPIILVSLDFLNWVFTFSAATALAVGIRGGSCTNDSFTSGNKIAEGSKDRCRK 119

Query: 361 XXXXXXXXXXXXXXXXXKMVMXXXXXXXXXXXXXXXXXXXXXXRTQQANVGVPTISQV 534
                            K ++                        ++  VGVPTISQV
Sbjct: 120 AQASTVFLYFSFAIFLVKFIL--------SIVNAITSGAFGTSSNRKTQVGVPTISQV 169

>NCAS0F03560 Chr6 (710517..711068) [552 bp, 183 aa] {ON} Anc_3.493
           YGR131W
          Length = 183

 Score =  108 bits (269), Expect = 2e-29
 Identities = 56/121 (46%), Positives = 76/121 (62%), Gaps = 2/121 (1%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML+  DN LR  N  F V+ +  +  L+ ++ HG +SRVN+CMFAAAFG++ DSF+G+ A
Sbjct: 1   MLSKVDNTLRFFNGIFLVLAIAFISTLLSTQNHG-SSRVNYCMFAAAFGLLTDSFFGMAA 59

Query: 181 NIFVPF--AFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRC 354
           N+ + F  ++P+ILF+ D                GIR HSC NR YL+SNKI QGS  RC
Sbjct: 60  NL-IDFLSSWPIILFVFDFLNFVFTFTAGTVLAVGIRCHSCNNRRYLESNKIIQGSGIRC 118

Query: 355 R 357
           R
Sbjct: 119 R 119

>Ecym_1236 Chr1 complement(485252..485761) [510 bp, 169 aa] {ON}
           similar to Ashbya gossypii AFR312W
          Length = 169

 Score = 91.7 bits (226), Expect = 5e-23
 Identities = 47/120 (39%), Positives = 64/120 (53%)
 Frame = +1

Query: 1   MLALTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILA 180
           ML++ DN LRA NF F +I+L L G LI  +   H SRVNF +F A F ++ DS Y +LA
Sbjct: 1   MLSILDNSLRAANFLFLIIVLALTGSLINGQNRSH-SRVNFGLFTAIFALLFDSLYSVLA 59

Query: 181 NIFVPFAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHYLDSNKITQGSTSRCRE 360
           N     A+P++L   D                 I  HSC+N  +L  N I++G   RCR+
Sbjct: 60  NFISALAWPILLITTDVLNLIFTFAAATALGAAIGPHSCSNSGFLRGNDISEGREGRCRK 119

>KNAG0L02330 Chr12 complement(413866..414783) [918 bp, 305 aa] {ON}
           Anc_2.61 YDL218W
          Length = 305

 Score = 30.8 bits (68), Expect = 1.8
 Identities = 18/67 (26%), Positives = 33/67 (49%)
 Frame = +1

Query: 22  ILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILANIFVPFA 201
           ILR + FC  V+++ L+   + S     + R NFC+     G    +FY I+  I + + 
Sbjct: 38  ILRFLQFCSAVLVMSLLAYSLNSYNFFGSKRANFCLSVGVIG----TFY-IMCVIVLVWL 92

Query: 202 FPVILFI 222
            P ++ +
Sbjct: 93  MPKVVLV 99

>KLTH0B07326g Chr2 complement(591369..592292) [924 bp, 307 aa] {ON}
           weakly similar to uniprot|Q7LGR3 Saccharomyces
           cerevisiae YDL218W
          Length = 307

 Score = 29.6 bits (65), Expect = 4.4
 Identities = 27/103 (26%), Positives = 47/103 (45%), Gaps = 7/103 (6%)
 Frame = +1

Query: 25  LRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAA---FGIVADSFYGILAN-IFV 192
           LRA+ F   VI LGL+  +++   +  + + NF +  AA   F ++  S  G+L + + +
Sbjct: 5   LRALQFISSVIALGLLAYVLKGYSYHGSHKTNFGLAVAAISVFYLMLLSLLGVLLHKLLL 64

Query: 193 P---FAFPVILFILDXXXXXXXXXXXXXXXXGIRTHSCTNRHY 312
           P     F +I+ IL                 G++T S  N +Y
Sbjct: 65  PGLYLLFEIIITILWLCAFVVLAKTHGSRACGLQTTSTYNPNY 107

>Kpol_303.7 s303 complement(17437..19563) [2127 bp, 708 aa] {ON}
           complement(17437..19563) [2127 nt, 709 aa]
          Length = 708

 Score = 29.6 bits (65), Expect = 5.2
 Identities = 24/104 (23%), Positives = 39/104 (37%)
 Frame = -1

Query: 423 HNHLEQKDEECKVEECNNCLCFSTSRSRTLSDFVRVQVVSVCTAVSPDTNXXXXXSGKSE 244
           H++ +Q+     V E ++ L +S       SDF      S+ T+  P           S+
Sbjct: 401 HHNQQQQQHRHHVAEHSSSLIYSDDSGYERSDFEEDGDESLLTSDLPSITSNNSKLNTSD 460

Query: 243 NEVQKV*DEQNNWESKWNKDVGQNTVERVCNDTEGSSKHTEVHS 112
           NE     D   N     + D+ QN    + ND +      E+ S
Sbjct: 461 NESDD--DNDTNDNEDMDNDLKQNNPINIINDKKNIILDIEIKS 502

>Kwal_12.673 s12 (39766..40056) [291 bp, 96 aa] {OFF} [contig 461]
           FULL
          Length = 96

 Score = 28.1 bits (61), Expect = 5.9
 Identities = 11/23 (47%), Positives = 15/23 (65%), Gaps = 2/23 (8%)
 Frame = +3

Query: 201 FPSYFVHLRLF--ELRFHFYRCY 263
           FP  ++HL L+   L+FH Y CY
Sbjct: 21  FPQIYLHLLLYLRRLKFHCYHCY 43

>KAFR0F00340 Chr6 (83466..84401) [936 bp, 311 aa] {ON} Anc_2.61
           YDL218W
          Length = 311

 Score = 29.3 bits (64), Expect = 6.0
 Identities = 20/69 (28%), Positives = 34/69 (49%)
 Frame = +1

Query: 10  LTDNILRAVNFCFFVILLGLVGKLIQSEKHGHNSRVNFCMFAAAFGIVADSFYGILANIF 189
           + ++ILR + F    I+LGL+   + S  +  + R NF +   A G+    FY  LA  F
Sbjct: 22  IPNSILRFLQFASTSIVLGLIAFALHSYHNHGSRRANFALAVGAIGV----FY-CLAVFF 76

Query: 190 VPFAFPVIL 216
           +    P ++
Sbjct: 77  LTLIAPQLV 85

>SAKL0D10252g Chr4 (857985..859262) [1278 bp, 425 aa] {ON} similar
           to uniprot|P25040 Saccharomyces cerevisiae YOL022C
           Protein required for cell viability
          Length = 425

 Score = 28.9 bits (63), Expect = 8.6
 Identities = 23/80 (28%), Positives = 34/80 (42%)
 Frame = -1

Query: 411 EQKDEECKVEECNNCLCFSTSRSRTLSDFVRVQVVSVCTAVSPDTNXXXXXSGKSENEVQ 232
           EQ +E C   + N      T+ +   +D  RV  V +CT  S   N      G  +N+ +
Sbjct: 88  EQVEEACASRKLN-----LTTTNHISTDDDRVLYVFICTKCSRKANSIRCVRGVKKNKSK 142

Query: 231 KV*DEQNNWESKWNKDVGQN 172
              D  N  E   N D+G+N
Sbjct: 143 S--DVNNLSEKMENVDLGKN 160

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,868,568
Number of extensions: 569941
Number of successful extensions: 1682
Number of sequences better than 10.0: 36
Number of HSP's gapped: 1602
Number of HSP's successfully gapped: 36
Length of query: 179
Length of database: 53,481,399
Length adjustment: 102
Effective length of query: 77
Effective length of database: 41,785,467
Effective search space: 3217480959
Effective search space used: 3217480959
Neighboring words threshold: 12
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 31 (16.5 bits)